UniProtKB - P0AE88 (CPXR_ECOLI)

BLAST

>sp|P0AE88|CPXR_ECOLI Transcriptional regulatory protein CpxR OS=Escherichia coli (strain K12) OX=83333 GN=cpxR PE=1 SV=1
MNKILLVDDDRELTSLLKELLEMEGFNVIVAHDGEQALDLLDDSIDLLLLDVMMPKKNGI
DTLKALRQTHQTPVIMLTARGSELDRVLGLELGADDYLPKPFNDRELVARIRAILRRSHW
SEQQQNNDNGSPTLEVDALVLNPGRQEASFDGQTLELTGTEFTLLYLLAQHLGQVVSREH
LSQEVLGKRLTPFDRAIDMHISNLRRKLPDRKDGHPWFKTLRGRGYLMVSAS

Align
Format
Add to basket Added to basket
History
Entry version 111 (07 Nov 2018)
Sequence version 1 (06 Dec 2005)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

Transcriptional regulatory protein CpxR

Gene

cpxR

Organism

Escherichia coli (strain K12)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Response regulator member of the two-component regulatory system CpxA/CpxR which responds to envelope stress response by activating expression of downstream genes including cpxP, degP, dsbA and ppiA (PubMed:7883164, PubMed:9401031). Required for efficient binding of stationary phase cells to hydrophobic surfaces, part of the process of biofilm formation (PubMed:11830644). Induced upon cell surface binding, subsequently induces genes it controls (cpxP, dsbA and spy, degP is only partially induced) (PubMed:11830644). Binds and activates transcription from the degP promoter (PubMed:7883164); binding is enhanced by phosphorylation (PubMed:9401031). This system combats a variety of extracytoplasmic protein-mediated toxicities by increasing the transcription of the periplasmic protease, DegP in concert with sigma factor E (PubMed:7883164), as well as that of CpxP protein. Other downstream effectors may include SrkA (PubMed:23416055).4 Publications

Activity regulationⁱ

The two-component system is activated by envelope stress such as overexpression of some (misfolded) periplasmic proteins (PubMed:7883164, PubMed:9351822). Activated by spheroplasting (which removes the periplasm) in an autoregulatory cpxA-cpxR-dependent fashion (PubMed:10972835). Cpx two-component system is activated at pH 8.0; in a degP deletion mutant activation is halved (PubMed:9473036, PubMed:16166523). The CpxA kinase activity is inhibited by periplasmic accessory protein CpxP; proteolysis of CpxP relieves inhibition (PubMed:16166523, PubMed:17259177, PubMed:25207645).5 Publications

Regions

Feature key	Position(s)	DescriptionActions	Graphical view	Length
DNA bindingⁱ	131 – 230	OmpR/PhoB-typePROSITE-ProRule annotationAdd BLAST		100

GO - Molecular functionⁱ

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

cell adhesion Source: UniProtKB-KW
negative regulation of transcription, DNA-templated
Source: EcoCyc
Inferred from direct assayⁱ
positive regulation of transcription, DNA-templated
Source: CACAO
Inferred from direct assayⁱ
- 15743952
regulation of cell-substrate adhesion
Source: UniProtKB
Inferred from mutant phenotypeⁱ
- 11830644

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Activator, DNA-binding
Biological process	Cell adhesion, Stress response, Transcription, Transcription regulation, Two-component regulatory system

Enzyme and pathway databases

BioCycⁱ	EcoCyc:CPXR-MONOMER

BioCycⁱ

EcoCyc:CPXR-MONOMER

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Transcriptional regulatory protein CpxR
Gene namesⁱ	Name:cpxR Synonyms:yiiA Ordered Locus Names:b3912, JW3883
Organismⁱ	Escherichia coli (strain K12)
Taxonomic identifierⁱ	83333 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Bacteria › Proteobacteria › Gammaproteobacteria › Enterobacterales › Enterobacteriaceae › Escherichia › Escherichia coli
Proteomesⁱ	UP000000318 Componentⁱ: Chromosome UP000000625 Componentⁱ: Chromosome

Organism-specific databases

EcoGeneⁱ	EG10020 cpxR

EcoGeneⁱ

EG10020 cpxR

Subcellular locationⁱ

Cytoplasm Curated

GO - Cellular componentⁱ

cytosol
Source: EcoCyc
Inferred from direct assayⁱ
- 18304323

View the complete GO annotation on QuickGO ...

Keywords - Cellular componentⁱ

Cytoplasm

Pathology & Biotechⁱ

Disruption phenotypeⁱ

Loss of the Cpx envelope stress response (PubMed:10972835). A double cpxR-cpxA mutant decreases transcription of degP (PubMed:7883164). Cells are less sensitive to killing by nalidixic acid; double cpxR-srkA disruption mutants are as sensitive to killing as single srkA mutants, suggesting the SrkA protein kinase is partially regulated by CpxR. Hypersensitive to alkaline pH (greater than pH 8.8) (PubMed:9473036). Decreased numbers of stationary phase cells bind to hydrophobic surfaces, cellular adhesion has altered dynamic properties; no induction of cpxR when cells bind to hydrophobic surfaces (PubMed:11830644).5 Publications

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000081078	1 – 232	Transcriptional regulatory protein CpxRAdd BLAST		232

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Modified residueⁱ	51	4-aspartylphosphatePROSITE-ProRule annotation		1

Post-translational modificationⁱ

Phosphorylated by CpxA.1 Publication2 Publications

Keywords - PTMⁱ

Phosphoprotein

Proteomic databases

EPDⁱ	P0AE88
PaxDbⁱ	P0AE88
PRIDEⁱ	P0AE88

Expressionⁱ

Inductionⁱ

Induced about 3-fold when stationary phase cells bind to hydrophobic surfaces; requires direct contact with hydrophobic surfaces for up-regulation of Cpx activity (PubMed:11830644).1 Publication

Interactionⁱ

Subunit structureⁱ

Interacts with cognate sensor kinase CpxA.1 Publication

Binary interactionsⁱ

With	Entry	#Exp.	IntAct
cpxA	P0AE82	3	EBI-550918,EBI-9141330
lysA	P00861	4	EBI-550918,EBI-553837
secB	P0AG86	3	EBI-550918,EBI-555877

Protein-protein interaction databases

BioGridⁱ	4262645, 290 interactors
Database of interacting proteins More...DIPⁱ	DIP-47991N
IntActⁱ	P0AE88, 11 interactors
STRINGⁱ	316385.ECDH10B_4102

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Beta strandⁱ	3 – 7	Combined sources	5
Helixⁱ	11 – 23	Combined sources	13
Beta strandⁱ	27 – 33	Combined sources	7
Helixⁱ	34 – 40	Combined sources	7
Beta strandⁱ	47 – 50	Combined sources	4
Beta strandⁱ	55 – 57	Combined sources	3
Helixⁱ	59 – 66	Combined sources	8
Turnⁱ	67 – 69	Combined sources	3
Beta strandⁱ	74 – 79	Combined sources	6
Helixⁱ	83 – 91	Combined sources	9
Beta strandⁱ	95 – 101	Combined sources	7
Helixⁱ	104 – 123	Combined sources	20
Beta strandⁱ	134 – 136	Combined sources	3
Beta strandⁱ	139 – 142	Combined sources	4
Turnⁱ	143 – 146	Combined sources	4
Beta strandⁱ	147 – 150	Combined sources	4
Helixⁱ	159 – 170	Combined sources	12
Turnⁱ	171 – 173	Combined sources	3
Helixⁱ	178 – 186	Combined sources	9
Helixⁱ	196 – 207	Combined sources	12
Beta strandⁱ	217 – 221	Combined sources	5
Turnⁱ	222 – 224	Combined sources	3
Beta strandⁱ	225 – 228	Combined sources	4

Show more details

3D structure databases

ProteinModelPortalⁱ	P0AE88
SMRⁱ	P0AE88
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Family & Domainsⁱ

Domains and Repeats

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Domainⁱ	3 – 115	Response regulatoryPROSITE-ProRule annotationAdd BLAST		113

Phylogenomic databases

eggNOGⁱ	ENOG4105E3W Bacteria COG0745 LUCA
HOGENOMⁱ	HOG000034819
InParanoidⁱ	P0AE88
KEGG Orthology (KO) More...KOⁱ	K07662
PhylomeDBⁱ	P0AE88

Family and domain databases

Conserved Domains Database More...CDDⁱ	cd00156 REC, 1 hit cd00383 trans_reg_C, 1 hit
Gene3Dⁱ	1.10.10.10, 1 hit
InterProⁱ	View protein in InterPro IPR011006 CheY-like_superfamily IPR001867 OmpR/PhoB-type_DNA-bd IPR001789 Sig_transdc_resp-reg_receiver IPR039420 WalR-like IPR036388 WH-like_DNA-bd_sf
PANTHERⁱ	PTHR26402 PTHR26402, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF00072 Response_reg, 1 hit PF00486 Trans_reg_C, 1 hit
SMARTⁱ	View protein in SMART SM00448 REC, 1 hit SM00862 Trans_reg_C, 1 hit
SUPFAMⁱ	SSF52172 SSF52172, 1 hit
PROSITEⁱ	View protein in PROSITE PS51755 OMPR_PHOB, 1 hit PS50110 RESPONSE_REGULATORY, 1 hit

Sequenceⁱ

Sequence statusⁱ: Complete.

P0AE88-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MNKILLVDDD RELTSLLKEL LEMEGFNVIV AHDGEQALDL LDDSIDLLLL 
        60         70         80         90        100
DVMMPKKNGI DTLKALRQTH QTPVIMLTAR GSELDRVLGL ELGADDYLPK 
       110        120        130        140        150
PFNDRELVAR IRAILRRSHW SEQQQNNDNG SPTLEVDALV LNPGRQEASF 
       160        170        180        190        200
DGQTLELTGT EFTLLYLLAQ HLGQVVSREH LSQEVLGKRL TPFDRAIDMH 
       210        220        230 
ISNLRRKLPD RKDGHPWFKT LRGRGYLMVS AS

Length:232

Mass (Da):26,312

Last modified:December 6, 2005 - v1

Checksum:ⁱ667FC2B246082F46

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	L14579 Unassigned DNA Translation: AAC36868.1 L19201 Genomic DNA Translation: AAB03045.1 U00096 Genomic DNA Translation: AAC76894.1 AP009048 Genomic DNA Translation: BAE77397.1 X13307 Genomic DNA Translation: CAA31686.1 M36795 Genomic DNA Translation: AAA23599.1
PIRⁱ	C65197
NCBI Reference Sequences More...RefSeqⁱ	NP_418348.1, NC_000913.3 WP_001033722.1, NZ_LN832404.1

Genome annotation databases

EnsemblBacteriaⁱ	AAC76894; AAC76894; b3912 BAE77397; BAE77397; BAE77397
GeneIDⁱ	948404
KEGGⁱ	ecj:JW3883 eco:b3912
PATRICⁱ	fig\|1411691.4.peg.2792

Protein	Similar proteins		Species	Score	Length	Source
P0AE88	Transcriptional regulatory protein CpxR		ECO57		232	UniRef100_P0AE89
Transcriptional regulatory protein CpxR		SHIFL		232
DNA-binding response regulator		Shigella sp.		232
DNA-binding response regulator		Escherichia coli O145 str. RM9872		232
Copper-sensing two-component system response regulator CpxR		KLEPN		232
+139

Protein	Similar proteins		Species	Score	Length	Source
P0AE88	Transcriptional regulatory protein CpxR		ECO57		232	UniRef90_P0AE89
Transcriptional regulatory protein CpxR		SHIFL		232
DNA-binding response regulator		Shigella sp.		232
DNA-binding response regulator		Escherichia coli O145 str. RM9872		232
Copper-sensing two-component system response regulator CpxR		KLEPN		232
+858

Protein	Similar proteins		Species	Score	Length	Source
P0AE88	Transcriptional regulatory protein CpxR homolog		HAEIN		227	UniRef50_P44895
Transcriptional regulatory protein CpxR		ECO57		232
Transcriptional regulatory protein CpxR		SHIFL		232
DNA-binding response regulator in two-component regulatory system with CpxA		HAEIF		227
Nucleoid-associated protein NdpA		Haemophilus influenzae PittII		227
+1690

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	L14579 Unassigned DNA Translation: AAC36868.1 L19201 Genomic DNA Translation: AAB03045.1 U00096 Genomic DNA Translation: AAC76894.1 AP009048 Genomic DNA Translation: BAE77397.1 X13307 Genomic DNA Translation: CAA31686.1 M36795 Genomic DNA Translation: AAA23599.1
PIRⁱ	C65197
RefSeqⁱ	NP_418348.1, NC_000913.3 WP_001033722.1, NZ_LN832404.1

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	4UHJ	X-ray	1.90	A/B/C	1-123	[»]
	4UHK	X-ray	2.60	A/B/C	1-123	[»]
	4UHS	X-ray	5.00	A/B/C	1-123	[»]
	4UHT	X-ray	1.15	A/B	131-231	[»]
ProteinModelPortalⁱ	P0AE88
SMRⁱ	P0AE88
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	4262645, 290 interactors
DIPⁱ	DIP-47991N
IntActⁱ	P0AE88, 11 interactors
STRINGⁱ	316385.ECDH10B_4102

Proteomic databases

EPDⁱ	P0AE88
PaxDbⁱ	P0AE88
PRIDEⁱ	P0AE88

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

EnsemblBacteriaⁱ	AAC76894; AAC76894; b3912 BAE77397; BAE77397; BAE77397
GeneIDⁱ	948404
KEGGⁱ	ecj:JW3883 eco:b3912
PATRICⁱ	fig\|1411691.4.peg.2792

Organism-specific databases

EchoBASEⁱ	EB0019
EcoGeneⁱ	EG10020 cpxR

Phylogenomic databases

eggNOGⁱ	ENOG4105E3W Bacteria COG0745 LUCA
HOGENOMⁱ	HOG000034819
InParanoidⁱ	P0AE88
KOⁱ	K07662
PhylomeDBⁱ	P0AE88

Enzyme and pathway databases

BioCycⁱ	EcoCyc:CPXR-MONOMER

BioCycⁱ

EcoCyc:CPXR-MONOMER

Miscellaneous databases

Protein Ontology More...PROⁱ	PR:P0AE88

PROⁱ

PR:P0AE88

Family and domain databases

CDDⁱ	cd00156 REC, 1 hit cd00383 trans_reg_C, 1 hit
Gene3Dⁱ	1.10.10.10, 1 hit
InterProⁱ	View protein in InterPro IPR011006 CheY-like_superfamily IPR001867 OmpR/PhoB-type_DNA-bd IPR001789 Sig_transdc_resp-reg_receiver IPR039420 WalR-like IPR036388 WH-like_DNA-bd_sf
PANTHERⁱ	PTHR26402 PTHR26402, 1 hit
Pfamⁱ	View protein in Pfam PF00072 Response_reg, 1 hit PF00486 Trans_reg_C, 1 hit
SMARTⁱ	View protein in SMART SM00448 REC, 1 hit SM00862 Trans_reg_C, 1 hit
SUPFAMⁱ	SSF52172 SSF52172, 1 hit
PROSITEⁱ	View protein in PROSITE PS51755 OMPR_PHOB, 1 hit PS50110 RESPONSE_REGULATORY, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	CPXR_ECOLI
Accessionⁱ	P0AE88Primary (citable) accession number: P0AE88 Secondary accession number(s): P16244, P76777, Q2M8K9
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	December 6, 2005
	Last sequence update:	December 6, 2005
	Last modified:	November 7, 2018
	This is version 111 of the entry and version 1 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Prokaryotic Protein Annotation Program

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Reference proteome

Documents

PDB cross-references
Index of Protein Data Bank (PDB) cross-references
Escherichia coli
Escherichia coli (strain K12): entries and cross-references to EcoGene

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P0AE88 (CPXR_ECOLI)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Transcriptional regulatory protein CpxR

cpxR

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Regions

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

GO - Cellular componenti

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Phylogenomic databases

Family and domain databases

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

GO - Cellular componentⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ