UniProtKB - P0ABE7 (C562_ECOLX)

BLAST

>sp|P0ABE7|C562_ECOLX Soluble cytochrome b562 OS=Escherichia coli OX=562 GN=cybC PE=1 SV=1
MRKSLLAILAVSSLVFSSASFAADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAAL
DAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTR
NAYHQKYR

Align
Format
Add to basket Added to basket
History
Entry version 108 (07 Nov 2018)
Sequence version 1 (25 Oct 2005)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

Soluble cytochrome b562

Gene

cybC

Organism

Escherichia coli

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Electron-transport protein of unknown function.

Caution

In strains K / NM522 and K12 / MG1655 the cybC gene has a 26 bp deletion and lacks the first 7 amino acids. It is not translated in those strains.Curated

Cofactorⁱ

heme bNote: Binds 1 heme b (iron(II)-protoporphyrin IX) group per molecule.

Redox potential

E₀ is about +180 mV.

Sites

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Metal bindingⁱ	29	Iron (heme B axial ligand)		1
Metal bindingⁱ	124	Iron (heme B axial ligand)		1

GO - Molecular functionⁱ

electron transfer activity Source: InterPro
heme binding Source: InterPro
iron ion binding Source: InterPro

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Biological process	Electron transport, Transport
Ligand	Heme, Iron, Metal-binding

Enzyme and pathway databases

BioCycⁱ	MetaCyc:CYTOCHROME-B562-MONOMER

BioCycⁱ

MetaCyc:CYTOCHROME-B562-MONOMER

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Soluble cytochrome b562 Short name: Cytochrome b-562
Gene namesⁱ	Name:cybC
Organismⁱ	Escherichia coli
Taxonomic identifierⁱ	562 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Bacteria › Proteobacteria › Gammaproteobacteria › Enterobacterales › Enterobacteriaceae › Escherichia

Subcellular locationⁱ

Periplasm
1 Publication
Manual assertion based on experiment inⁱ
- Ref.1
  "Cloning and expression of the gene encoding the soluble cytochrome b562 of Escherichia coli."
  Nikkila H., Gennis R.B., Sligar S.G.
  Eur. J. Biochem. 202:309-313(1991) [PubMed] [Europe PMC] [Abstract]
  Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], SUBCELLULAR LOCATION.

GO - Cellular componentⁱ

periplasmic space Source: UniProtKB-SubCell

View the complete GO annotation on QuickGO ...

Keywords - Cellular componentⁱ

Periplasm

Pathology & Biotechⁱ

Chemistry databases

Drug and drug target database More...DrugBankⁱ	DB02182 Hybrid Between B and C Type Hemes (Protoporphyrin Ixcontaining Fe)

DrugBankⁱ

DB02182 Hybrid Between B and C Type Hemes (Protoporphyrin Ixcontaining Fe)

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Signal peptideⁱ	1 – 22	1 PublicationAdd BLAST		22
ChainⁱPRO_0000003640	23 – 128	Soluble cytochrome b562Add BLAST		106

Interactionⁱ

Subunit structureⁱ

Monomer.1 Publication

Protein-protein interaction databases

IntActⁱ	P0ABE7, 23 interactors

IntActⁱ

P0ABE7, 23 interactors

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Helixⁱ	27 – 41	Combined sources	15
Helixⁱ	45 – 63	Combined sources	19
Beta strandⁱ	70 – 73	Combined sources	4
Beta strandⁱ	75 – 77	Combined sources	3
Helixⁱ	78 – 102	Combined sources	25
Helixⁱ	106 – 123	Combined sources	18
Helixⁱ	125 – 127	Combined sources	3

Show more details

3D structure databases

ProteinModelPortalⁱ	P0ABE7
SMRⁱ	P0ABE7
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ	P0ABE7

EvolutionaryTraceⁱ

P0ABE7

Family & Domainsⁱ

Sequence similaritiesⁱ

Belongs to the cytochrome b562 family.Curated

Keywords - Domainⁱ

Signal

Phylogenomic databases

eggNOGⁱ	COG3783 LUCA
HOGENOMⁱ	HOG000127440

Family and domain databases

InterProⁱ	View protein in InterPro IPR009155 Cyt_b562 IPR010980 Cyt_c/b562
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF07361 Cytochrom_B562, 1 hit
PIRSFⁱ	PIRSF000029 Cytochrome_b562, 1 hit
SUPFAMⁱ	SSF47175 SSF47175, 1 hit

Sequenceⁱ

Sequence statusⁱ: Complete.

Sequence processingⁱ: The displayed sequence is further processed into a mature form.

P0ABE7-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MRKSLLAILA VSSLVFSSAS FAADLEDNME TLNDNLKVIE KADNAAQVKD 
        60         70         80         90        100
ALTKMRAAAL DAQKATPPKL EDKSPDSPEM KDFRHGFDIL VGQIDDALKL 
       110        120 
ANEGKVKEAQ AAAEQLKTTR NAYHQKYR

Length:128

Mass (Da):14,061

Last modified:October 25, 2005 - v1

Checksum:ⁱD7D822AC8FEED751

Sequence cautionⁱ

The sequence AAA97133 differs from that shown. Reason: Erroneous initiation.Curated

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	S74736 Genomic DNA Translation: AAB20782.1 X67290 Genomic DNA Translation: CAA47706.1 U14003 Genomic DNA Translation: AAA97133.1 Different initiation.
PIRⁱ	S19544 CBEC62
NCBI Reference Sequences More...RefSeqⁱ	WP_001232240.1, NZ_UIMX01000013.1

Protein	Similar proteins		Species	Score	Length	Source
P0ABE7	Soluble cytochrome b562		Shigella sp.		128	UniRef100_P0ABE7
Soluble cytochrome b562		Klebsiella pneumoniae IS22		128
Soluble cytochrome b562		Shigella flexneri 1235-66		128
Cytochrome b562		ECOLX		128
Soluble cytochrome b562		SHIFL		128
+45

Protein	Similar proteins		Species	Score	Length	Source
P0ABE7	Soluble cytochrome b562		ECO57		128	UniRef90_P0ABE7
Soluble cytochrome b562		ECOL6		128
Soluble cytochrome b562		Shigella sp.		128
Soluble cytochrome b562		Klebsiella pneumoniae IS22		128
Soluble cytochrome b562		Shigella flexneri 1235-66		128
+357

Protein	Similar proteins		Species	Score	Length	Source
P0ABE7	Soluble cytochrome b562		ECO57		128	UniRef50_P0ABE7
Soluble cytochrome b562		ECOL6		128
Probable soluble cytochrome b562 2		YERPE		128
Soluble cytochrome b562		SALTI		128
Soluble cytochrome b562	)	SALTY		128
+820

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	S74736 Genomic DNA Translation: AAB20782.1 X67290 Genomic DNA Translation: CAA47706.1 U14003 Genomic DNA Translation: AAA97133.1 Different initiation.
PIRⁱ	S19544 CBEC62
RefSeqⁱ	WP_001232240.1, NZ_UIMX01000013.1

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	1APC	NMR	-	A	23-128	[»]
	1LM3	X-ray	2.70	B/D	23-128	[»]
	1M6T	X-ray	1.81	A	23-128	[»]
	1QPU	NMR	-	A	23-128	[»]
	1QQ3	NMR	-	A	23-128	[»]
	256B	X-ray	1.40	A/B	23-128	[»]
	2BC5	X-ray	2.25	A/B/C/D	23-128	[»]
	2QLA	X-ray	2.90	A/B/C/D	23-128	[»]
	3C62	X-ray	1.87	A/B/C/D	23-128	[»]
	3C63	X-ray	1.75	A/B/C/D	23-128	[»]
	3DE8	X-ray	1.72	A/B/C/D	23-128	[»]
	3DE9	X-ray	2.04	A	23-128	[»]
	3FOO	X-ray	2.40	A/B/C/D/E/F/G/H/I/J/K/L	23-128	[»]
	3FOP	X-ray	3.00	A/B	23-128	[»]
	3HNI	X-ray	2.35	A/B/C/D/E/F/G/H	23-128	[»]
	3HNJ	X-ray	2.00	A/B/C/D	23-128	[»]
	3HNK	X-ray	2.10	A/B	23-128	[»]
	3HNL	X-ray	2.20	A/B	23-128	[»]
	3IQ5	X-ray	2.05	A/B/C/D	23-128	[»]
	3IQ6	X-ray	2.35	A/B/C/D/E/F/G/H	23-128	[»]
	3L1M	X-ray	2.30	A	23-128	[»]
	3M15	X-ray	2.60	A/B/C	23-128	[»]
	3M4B	X-ray	2.50	A/B/C/D	23-128	[»]
	3M4C	X-ray	1.90	A/B/C/D	23-128	[»]
	3M79	X-ray	2.10	A/B/C/D/E/F/G/H	23-128	[»]
	3NMI	X-ray	2.01	A/B/C/D/E/F	23-128	[»]
	3NMJ	X-ray	3.10	A/B/C/D	23-128	[»]
	3NMK	X-ray	2.80	A/B/C/D	23-128	[»]
	3TOL	X-ray	2.00	A/B/C/D	23-128	[»]
	3TOM	X-ray	2.30	A/B/C/D	23-128	[»]
	3U8P	X-ray	2.75	A/B/C	23-128	[»]
	4EA3	X-ray	3.01	A/B	23-128	[»]
	4EIY	X-ray	1.80	A	23-128	[»]
	4IAQ	X-ray	2.80	A	23-128	[»]
	4IAR	X-ray	2.70	A	23-128	[»]
	4IB4	X-ray	2.70	A	23-128	[»]
	4JE9	X-ray	2.12	A/B	23-128	[»]
	4JEA	X-ray	1.22	A/B/C/D	23-128	[»]
	4JEB	X-ray	2.30	A/B	23-128	[»]
	4JKV	X-ray	2.45	A/B	23-127	[»]
	4L6R	X-ray	3.30	A	23-128	[»]
	4N6H	X-ray	1.80	A	23-128	[»]
	4NC3	X-ray	2.80	A	23-128	[»]
	4NTJ	X-ray	2.62	A	23-128	[»]
	4O9R	X-ray	3.20	A	23-128	[»]
	4OR2	X-ray	2.80	A/B	23-128	[»]
	4PXZ	X-ray	2.50	A	23-128	[»]
	4PY0	X-ray	3.10	A	23-128	[»]
	4QIM	X-ray	2.61	A	23-128	[»]
	4QIN	X-ray	2.60	A	23-128	[»]
	4RWA	X-ray	3.28	A/B	23-127	[»]
	4RWD	X-ray	2.70	A/B	23-127	[»]
	4U9D	X-ray	2.50	A/B/C/D	23-128	[»]
	4U9E	X-ray	2.80	A	23-128	[»]
	4YAY	X-ray	2.90	A	23-128	[»]
	4Z34	X-ray	3.00	A	23-64	[»]
				A	73-127	[»]
	4Z35	X-ray	2.90	A	23-64	[»]
				A	73-127	[»]
	4Z36	X-ray	2.90	A	23-64	[»]
				A	78-127	[»]
	4ZUD	X-ray	2.80	A	23-128	[»]
	5AWI	X-ray	1.85	A/B	23-128	[»]
5BU7	X-ray	2.46	A/B	23-128	[»]
5DHG	X-ray	3.00	A/B	23-128	[»]
5DHH	X-ray	3.00	A/B	23-128	[»]
5IU4	X-ray	1.72	A	23-128	[»]
5IU7	X-ray	1.90	A	23-128	[»]
5IU8	X-ray	2.00	A	23-128	[»]
5IUA	X-ray	2.20	A	23-128	[»]
5IUB	X-ray	2.10	A	23-128	[»]
5JTB	X-ray	2.80	A	27-128	[»]
5K2A	X-ray	2.50	A	23-128	[»]
5K2B	X-ray	2.50	A	23-128	[»]
5K2C	X-ray	1.90	A	23-128	[»]
5K2D	X-ray	1.90	A	23-128	[»]
5L31	X-ray	2.40	A/B/C/D	23-128	[»]
5L32	X-ray	2.10	A/B/C/D	23-128	[»]
5L7D	X-ray	3.20	A/B	23-127	[»]
5L7I	X-ray	3.30	A/B	23-127	[»]
5MZJ	X-ray	2.00	A	23-128	[»]
5MZP	X-ray	2.10	A	23-128	[»]
5N2R	X-ray	2.80	A	23-127	[»]
5N2S	X-ray	3.30	A	22-127	[»]
5NDD	X-ray	2.80	A	23-127	[»]
5NDZ	X-ray	3.60	A	23-127	[»]
5NJ6	X-ray	4.00	A	23-127	[»]
5NLX	X-ray	2.14	A	23-127	[»]
5NM2	X-ray	1.95	A	23-127	[»]
5NM4	X-ray	1.70	A	23-127	[»]
5OLG	X-ray	1.87	A	23-127	[»]
5OLH	X-ray	2.60	A	23-128	[»]
5OLO	X-ray	3.10	A	23-127	[»]
5OLV	X-ray	2.00	A	23-128	[»]
5OLZ	X-ray	1.90	A	23-128	[»]
5OM1	X-ray	2.10	A	23-128	[»]
5OM4	X-ray	2.00	A	23-128	[»]
5TUD	X-ray	3.00	A/D	23-128	[»]
5TVN	X-ray	2.90	A	23-128	[»]
5UEN	X-ray	3.20	A/B	23-127	[»]
5UIG	X-ray	3.50	A	27-128	[»]
5UNF	X-ray	2.80	A/B	23-128	[»]
5UNG	X-ray	2.80	B	23-128	[»]
5UNH	X-ray	2.90	A/B	23-128	[»]
5UVI	X-ray	3.20	A	27-128	[»]
5VRA	X-ray	2.35	A	23-128	[»]
5WIU	X-ray	1.96	A	24-128	[»]
5WIV	X-ray	2.14	A	24-128	[»]
5XJM	X-ray	3.20	A	23-128	[»]
5XZI	X-ray	2.65	A	23-128	[»]
5XZJ	X-ray	1.98	A/B/C/D	23-128	[»]
5YM7	X-ray	1.56	A	23-128	[»]
5YO3	X-ray	1.70	A	23-128	[»]
5YO4	X-ray	1.37	A	23-128	[»]
5YO5	X-ray	2.20	A/B/C/D/E/F/G/H	23-128	[»]
5YO6	X-ray	1.20	A	23-128	[»]
6AQF	X-ray	2.51	A	23-128	[»]
6B73	X-ray	3.10	A/B	23-128	[»]
6BQG	X-ray	3.00	A	23-128	[»]
6BQH	X-ray	2.70	A	23-128	[»]
6C1Q	X-ray	2.90	B	23-128	[»]
6C1R	X-ray	2.20	B	23-128	[»]
6CC4	X-ray	3.50	A	23-127	[»]
6CMO	electron microscopy	4.50	R	23-127	[»]
6D32	X-ray	3.75	A	23-127	[»]
6D35	X-ray	3.90	A	23-127	[»]
6DHY	X-ray	2.22	A/B/C/D	23-128	[»]
6DHZ	X-ray	2.80	A/B/C/D	23-128	[»]
6DRX	X-ray	3.10	A	23-123	[»]
6DRY	X-ray	2.92	A	23-123	[»]
6DRZ	X-ray	3.10	A	23-123	[»]
6DS0	X-ray	3.19	A	23-128	[»]
ProteinModelPortalⁱ	P0ABE7
SMRⁱ	P0ABE7
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

IntActⁱ	P0ABE7, 23 interactors

IntActⁱ

P0ABE7, 23 interactors

Chemistry databases

DrugBankⁱ	DB02182 Hybrid Between B and C Type Hemes (Protoporphyrin Ixcontaining Fe)

DrugBankⁱ

DB02182 Hybrid Between B and C Type Hemes (Protoporphyrin Ixcontaining Fe)

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Phylogenomic databases

eggNOGⁱ	COG3783 LUCA
HOGENOMⁱ	HOG000127440

Enzyme and pathway databases

BioCycⁱ	MetaCyc:CYTOCHROME-B562-MONOMER

BioCycⁱ

MetaCyc:CYTOCHROME-B562-MONOMER

Miscellaneous databases

EvolutionaryTraceⁱ	P0ABE7

EvolutionaryTraceⁱ

P0ABE7

Family and domain databases

InterProⁱ	View protein in InterPro IPR009155 Cyt_b562 IPR010980 Cyt_c/b562
Pfamⁱ	View protein in Pfam PF07361 Cytochrom_B562, 1 hit
PIRSFⁱ	PIRSF000029 Cytochrome_b562, 1 hit
SUPFAMⁱ	SSF47175 SSF47175, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	C562_ECOLX
Accessionⁱ	P0ABE7Primary (citable) accession number: P0ABE7 Secondary accession number(s): P00192, P76805, Q8XCE3
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	July 21, 1986
	Last sequence update:	October 25, 2005
	Last modified:	November 7, 2018
	This is version 108 of the entry and version 1 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Prokaryotic Protein Annotation Program

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P0ABE7 (C562_ECOLX)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Soluble cytochrome b562

cybC

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Caution

Redox potential

Sites

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

GO - Cellular componenti

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Chemistry databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Phylogenomic databases

Family and domain databases

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

Sequence databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Chemistry databases

Protocols and materials databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

GO - Cellular componentⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Keywords - Domainⁱ

Sequence cautionⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ