UniProtKB - P0A7U7 (RS20_ECOLI)
(max 400 entries)x
Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>
Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)
- BLAST>sp|P0A7U7|RS20_ECOLI 30S ribosomal protein S20 OS=Escherichia coli (strain K12) OX=83333 GN=rpsT PE=1 SV=2 MANIKSAKKRAIQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKAAAQKAFNEMQPIVDR QAAKGLIHKNKAARHKANLTAQINKLA
- Align
- Format
- Add to basketAdded to basket
- History
- Other tutorials and videos
- Help video
- Feedback
Protein
30S ribosomal protein S20
Gene
rpsT
Organism
Escherichia coli (strain K12)
Status
Reviewed-Annotation score:
Annotation score:5 out of 5
<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>Select a section on the left to see content.
<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni
Binds directly to 16S ribosomal RNA.
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni
- ornithine decarboxylase inhibitor activity Source: EcoCyc <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- small ribosomal subunit rRNA binding Source: EcoCyc <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- structural constituent of ribosome Source: CAFA <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi
- ribosomal small subunit assembly Source: CAFA <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- translation Source: InterPro
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi
| Molecular function | Ribonucleoprotein, Ribosomal protein, RNA-binding, rRNA-binding |
Enzyme and pathway databases
BioCyc Collection of Pathway/Genome Databases More...BioCyci | EcoCyc:EG10919-MONOMER MetaCyc:EG10919-MONOMER |
<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi | Recommended name: 30S ribosomal protein S20Alternative name(s): Small ribosomal subunit protein bS201 Publication <p>Manually curated information that is based on statements in scientific articles for which there is no experimental support.</p> <p><a href="/manual/evidences#ECO:0000303">More...</a></p> Manual assertion based on opinion ini
|
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi | Name:rpsT Ordered Locus Names:b0023, JW0022 |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>Organismi | Escherichia coli (strain K12) |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri | 83333 [NCBI] |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineagei | cellular organisms › Bacteria › Proteobacteria › Gammaproteobacteria › Enterobacterales › Enterobacteriaceae › Escherichia › Escherichia coli |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi |
|
Organism-specific databases
Escherichia coli strain K12 genome database More...EcoGenei | EG10919 rpsT |
<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Cellular componenti
- cytosol Source: EcoCyc <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- cytosolic small ribosomal subunit Source: CAFA <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi
Molecule processing
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methioninei | Removed1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| |||
| <p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_0000167958 | 2 – 87 | 30S ribosomal protein S20Add BLAST | 86 |
Proteomic databases
Encyclopedia of Proteome Dynamics More...EPDi | P0A7U7 |
PaxDb, a database of protein abundance averages across all three domains of life More...PaxDbi | P0A7U7 |
PRoteomics IDEntifications database More...PRIDEi | P0A7U7 |
<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni
<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei
Part of the 30S ribosomal subunit (PubMed:786731, PubMed:10094780, PubMed:12244297, PubMed:12809609, PubMed:16272117, PubMed:27934701, PubMed:27906160, PubMed:27906161).8 Publications
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.7"Primary structure of protein S20 from the small ribosomal subunit of Escherichia coli."
Wittmann-Liebold B., Marzinzig E., Lehmann A.
FEBS Lett. 68:110-114(1976) [PubMed] [Europe PMC] [Abstract]Cited for: PROTEIN SEQUENCE OF 2-87, SUBUNIT. - Ref.9"Observation of Escherichia coli ribosomal proteins and their posttranslational modifications by mass spectrometry."
Arnold R.J., Reilly J.P.
Anal. Biochem. 269:105-112(1999) [PubMed] [Europe PMC] [Abstract]Cited for: MASS SPECTROMETRY, SUBUNIT. - Ref.11"All-atom homology model of the Escherichia coli 30S ribosomal subunit."
Tung C.-S., Joseph S., Sanbonmatsu K.Y.
Nat. Struct. Biol. 9:750-755(2002) [PubMed] [Europe PMC] [Abstract]Cited for: 3D-STRUCTURE MODELING, SUBUNIT. - Ref.12"Study of the structural dynamics of the E. coli 70S ribosome using real-space refinement."
Gao H., Sengupta J., Valle M., Korostelev A., Eswar N., Stagg S.M., Van Roey P., Agrawal R.K., Harvey S.C., Sali A., Chapman M.S., Frank J.
Cell 113:789-801(2003) [PubMed] [Europe PMC] [Abstract]Cited for: STRUCTURE BY ELECTRON MICROSCOPY (11.50 ANGSTROMS), SUBUNIT. - Ref.13"Structures of the bacterial ribosome at 3.5 A resolution."
Schuwirth B.S., Borovinskaya M.A., Hau C.W., Zhang W., Vila-Sanjurjo A., Holton J.M., Cate J.H.D.
Science 310:827-834(2005) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (3.46 ANGSTROMS) OF 2 DIFFERENT RIBOSOME STRUCTURES, SUBUNIT. - Ref.14"Mechanistic insights into the alternative translation termination by ArfA and RF2."
Ma C., Kurita D., Li N., Chen Y., Himeno H., Gao N.
Nature 541:550-553(2017) [PubMed] [Europe PMC] [Abstract]Cited for: STRUCTURE BY ELECTRON MICROSCOPY (3.0 ANGSTROMS) OF 70S RIBOSOME IN COMPLEX WITH ARFA AND RF2, SUBUNIT. - Ref.15"Structural basis for ArfA-RF2-mediated translation termination on mRNAs lacking stop codons."
Huter P., Mueller C., Beckert B., Arenz S., Berninghausen O., Beckmann R., Wilson D.N.
Nature 541:546-549(2017) [PubMed] [Europe PMC] [Abstract]Cited for: STRUCTURE BY ELECTRON MICROSCOPY (3.1 ANGSTROMS) OF 70S RIBOSOME IN COMPLEX WITH ARFA AND RF2, SUBUNIT. - Ref.16"Translational termination without a stop codon."
James N.R., Brown A., Gordiyenko Y., Ramakrishnan V.
Science 354:1437-1440(2016) [PubMed] [Europe PMC] [Abstract]Cited for: STRUCTURE BY ELECTRON MICROSCOPY (2.97 ANGSTROMS) OF 70S RIBOSOME IN COMPLEX WITH ARFA AND RF2, SUBUNIT.
Protein-protein interaction databases
The Biological General Repository for Interaction Datasets (BioGrid) More...BioGridi | 4260844, 67 interactors |
Database of interacting proteins More...DIPi | DIP-35857N |
Protein interaction database and analysis system More...IntActi | P0A7U7, 70 interactors |
STRING: functional protein association networks More...STRINGi | 316385.ECDH10B_0024 |
<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei
Secondary structure
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more detailsHide details| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined helical regions within the protein sequence.<p><a href='/help/helix' target='_top'>More...</a></p>Helixi | 8 – 41 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 34 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined helical regions within the protein sequence.<p><a href='/help/helix' target='_top'>More...</a></p>Helixi | 44 – 64 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 21 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined hydrogen-bonded turns within the protein sequence. These elements correspond to the DSSP secondary structure code ‘T’.<p><a href='/help/turn' target='_top'>More...</a></p>Turni | 66 – 69 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 4 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined helical regions within the protein sequence.<p><a href='/help/helix' target='_top'>More...</a></p>Helixi | 70 – 83 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 14 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined hydrogen-bonded turns within the protein sequence. These elements correspond to the DSSP secondary structure code ‘T’.<p><a href='/help/turn' target='_top'>More...</a></p>Turni | 84 – 86 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 3 |
3D structure databases
Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase More...ProteinModelPortali | P0A7U7 |
SWISS-MODEL Repository - a database of annotated 3D protein structure models More...SMRi | P0A7U7 |
Database of comparative protein structure models More...ModBasei | Search... |
MobiDB: a database of protein disorder and mobility annotations More...MobiDBi | Search... |
Miscellaneous databases
Relative evolutionary importance of amino acids within a protein sequence More...EvolutionaryTracei | P0A7U7 |
<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi
<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi
Belongs to the bacterial ribosomal protein bS20 family.Curated
Phylogenomic databases
evolutionary genealogy of genes: Non-supervised Orthologous Groups More...eggNOGi | ENOG4105KQV Bacteria COG0268 LUCA |
The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms More...HOGENOMi | HOG000097048 |
InParanoid: Eukaryotic Ortholog Groups More...InParanoidi | P0A7U7 |
KEGG Orthology (KO) More...KOi | K02968 |
Identification of Orthologs from Complete Genome Data More...OMAi | ANKKSAM |
Database for complete collections of gene phylogenies More...PhylomeDBi | P0A7U7 |
Family and domain databases
Gene3D Structural and Functional Annotation of Protein Families More...Gene3Di | 1.20.58.110, 1 hit |
HAMAP database of protein families More...HAMAPi | MF_00500 Ribosomal_S20, 1 hit |
Integrated resource of protein families, domains and functional sites More...InterProi | View protein in InterPro IPR002583 Ribosomal_S20 IPR036510 Ribosomal_S20_sf |
The PANTHER Classification System More...PANTHERi | PTHR33398 PTHR33398, 1 hit |
Pfam protein domain database More...Pfami | View protein in Pfam PF01649 Ribosomal_S20p, 1 hit |
ProDom; a protein domain database More...ProDomi | View protein in ProDom or Entries sharing at least one domain PD004231 Ribosomal_S20, 1 hit |
Superfamily database of structural and functional annotation More...SUPFAMi | SSF46992 SSF46992, 1 hit |
TIGRFAMs; a protein family database More...TIGRFAMsi | TIGR00029 S20, 1 hit |
<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequencei
<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.
<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.
P0A7U7-1 [UniParc]FASTAAdd to basketAdded to basketShow »
10 20 30 40 50
MANIKSAKKR AIQSEKARKH NASRRSMMRT FIKKVYAAIE AGDKAAAQKA
60 70 80
FNEMQPIVDR QAAKGLIHKN KAARHKANLT AQINKLA
Length:87
Mass (Da):9,684
Last modified:January 23, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated
from the sequence. It is useful for tracking sequence updates.</p>
<p>It should be noted that while, in theory, two different sequences could
have the same checksum value, the likelihood that this would happen
is extremely low.</p>
<p>However UniProtKB may contain entries with identical sequences in case
of multiple genes (paralogs).</p>
<p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64)
using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1.
The algorithm is described in the ISO 3309 standard.
</p>
<p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br />
<strong>Cyclic redundancy and other checksums</strong><br />
<a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p>
Checksum:iF02154BE2D1E22D9
Experimental Info
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti | 38 | A → R in AAA24604 (PubMed:2985604).Curated | 1 |
<p>This subsection of the ‘Sequence’ section reports information derived from mass spectrometry experiments done on the entire protein or on biologically active derived peptide(s).<p><a href='/help/mass_spectrometry' target='_top'>More...</a></p>Mass spectrometryi
Molecular mass is 9553.6 Da from positions 2 - 87. Determined by MALDI. 1 Publication
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.9"Observation of Escherichia coli ribosomal proteins and their posttranslational modifications by mass spectrometry."
Arnold R.J., Reilly J.P.
Anal. Biochem. 269:105-112(1999) [PubMed] [Europe PMC] [Abstract]Cited for: MASS SPECTROMETRY, SUBUNIT.
Sequence databases
| Select the link destinations: EMBL nucleotide sequence database More...EMBLiGenBank nucleotide sequence database More...GenBankiDNA Data Bank of Japan; a nucleotide sequence database More...DDBJiLinks Updated | M10428 Genomic DNA Translation: AAA24604.1 X04382 Genomic DNA Translation: CAA27968.1 U00096 Genomic DNA Translation: AAC73134.1 AP009048 Genomic DNA Translation: BAB96593.1 |
Protein sequence database of the Protein Information Resource More...PIRi | A30425 R3EC20 |
NCBI Reference Sequences More...RefSeqi | NP_414564.1, NC_000913.3 WP_001274021.1, NZ_LN832404.1 |
Genome annotation databases
Ensembl bacterial and archaeal genome annotation project More...EnsemblBacteriai | AAC73134; AAC73134; b0023 BAB96593; BAB96593; BAB96593 |
Database of genes from NCBI RefSeq genomes More...GeneIDi | 944759 |
KEGG: Kyoto Encyclopedia of Genes and Genomes More...KEGGi | ecj:JW0022 eco:b0023 |
Pathosystems Resource Integration Center (PATRIC) More...PATRICi | fig|1411691.4.peg.2261 |
<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi
| Protein | Similar proteins | Species | Score | Length | |
|---|---|---|---|---|---|
| P0A7U7 | 30S ribosomal protein S20 | 87 | |||
| 30S ribosomal protein S20 | 87 | ||||
| 30S ribosomal protein S20 | 87 | ||||
| 30S ribosomal protein S20 | 87 | ||||
| 30S ribosomal protein S20 | 87 | ||||
| +218 | |||||
| Protein | Similar proteins | Species | Score | Length | |
|---|---|---|---|---|---|
| P0A7U7 | 30S ribosomal protein S20 | 87 | |||
| 30S ribosomal protein S20 | 87 | ||||
| 30S ribosomal protein S20 | 87 | ||||
| 30S ribosomal protein S20 | 93 | ||||
| UPI000A101B57 | 73 | ||||
| +576 | |||||
| Protein | Similar proteins | Species | Score | Length | |
|---|---|---|---|---|---|
| P0A7U7 | 30S ribosomal protein S20 | 87 | |||
| 30S ribosomal protein S20 (Fragment) | 74 | ||||
| 30S ribosomal protein S20 | 89 | ||||
| 30S ribosomal protein S20 | 89 | ||||
| 30S ribosomal protein S20 | 92 | ||||
| +2730 | |||||
<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi
Sequence databases
| Select the link destinations: EMBL nucleotide sequence database More...EMBLiGenBank nucleotide sequence database More...GenBankiDNA Data Bank of Japan; a nucleotide sequence database More...DDBJiLinks Updated | M10428 Genomic DNA Translation: AAA24604.1 X04382 Genomic DNA Translation: CAA27968.1 U00096 Genomic DNA Translation: AAC73134.1 AP009048 Genomic DNA Translation: BAB96593.1 |
Protein sequence database of the Protein Information Resource More...PIRi | A30425 R3EC20 |
NCBI Reference Sequences More...RefSeqi | NP_414564.1, NC_000913.3 WP_001274021.1, NZ_LN832404.1 |
3D structure databases
| Select the link destinations: Protein Data Bank Europe More...PDBeiProtein Data Bank RCSB More...RCSB PDBiProtein Data Bank Japan More...PDBjiLinks Updated | PDB entry | Method | Resolution (Å) | Chain | Positions | PDBsum |
| 1M5G | model | - | T | 3-87 | [»] | |
| 2YKR | electron microscopy | 9.80 | T | 3-87 | [»] | |
| 3J9Y | electron microscopy | 3.90 | t | 1-87 | [»] | |
| 3J9Z | electron microscopy | 3.60 | ST | 2-87 | [»] | |
| 3JA1 | electron microscopy | 3.60 | ST | 2-87 | [»] | |
| 3JBU | electron microscopy | 3.64 | T | 1-87 | [»] | |
| 3JBV | electron microscopy | 3.32 | T | 1-87 | [»] | |
| 3JCD | electron microscopy | 3.70 | t | 1-87 | [»] | |
| 3JCE | electron microscopy | 3.20 | t | 1-87 | [»] | |
| 3JCJ | electron microscopy | 3.70 | 3 | 1-87 | [»] | |
| 3JCN | electron microscopy | 4.60 | x | 1-87 | [»] | |
| 4A2I | electron microscopy | 16.50 | T | 3-87 | [»] | |
| 4ADV | electron microscopy | 13.50 | T | 2-87 | [»] | |
| 4U1U | X-ray | 2.95 | AT/CT | 3-87 | [»] | |
| 4U1V | X-ray | 3.00 | AT/CT | 3-87 | [»] | |
| 4U20 | X-ray | 2.90 | AT/CT | 3-87 | [»] | |
| 4U24 | X-ray | 2.90 | AT/CT | 3-87 | [»] | |
| 4U25 | X-ray | 2.90 | AT/CT | 3-87 | [»] | |
| 4U26 | X-ray | 2.80 | AT/CT | 3-87 | [»] | |
| 4U27 | X-ray | 2.80 | AT/CT | 3-87 | [»] | |
| 4V47 | electron microscopy | 12.30 | BT | 2-87 | [»] | |
| 4V48 | electron microscopy | 11.50 | BT | 2-87 | [»] | |
| 4V4H | X-ray | 3.46 | AT/CT | 1-87 | [»] | |
| 4V4Q | X-ray | 3.46 | AT/CT | 2-87 | [»] | |
| 4V4V | electron microscopy | 15.00 | AT | 5-87 | [»] | |
| 4V4W | electron microscopy | 15.00 | AT | 5-87 | [»] | |
| 4V50 | X-ray | 3.22 | AT/CT | 2-87 | [»] | |
| 4V52 | X-ray | 3.21 | AT/CT | 2-87 | [»] | |
| 4V53 | X-ray | 3.54 | AT/CT | 2-87 | [»] | |
| 4V54 | X-ray | 3.30 | AT/CT | 2-87 | [»] | |
| 4V55 | X-ray | 4.00 | AT/CT | 2-87 | [»] | |
| 4V56 | X-ray | 3.93 | AT/CT | 2-87 | [»] | |
| 4V57 | X-ray | 3.50 | AT/CT | 2-87 | [»] | |
| 4V5B | X-ray | 3.74 | BT/DT | 2-87 | [»] | |
| 4V5H | electron microscopy | 5.80 | AT | 3-87 | [»] | |
| 4V5Y | X-ray | 4.45 | AT/CT | 2-87 | [»] | |
| 4V64 | X-ray | 3.50 | AT/CT | 2-87 | [»] | |
| 4V65 | electron microscopy | 9.00 | AN | 1-87 | [»] | |
| 4V66 | electron microscopy | 9.00 | AN | 1-87 | [»] | |
| 4V69 | electron microscopy | 6.70 | AT | 3-87 | [»] | |
| 4V6C | X-ray | 3.19 | AT/CT | 1-87 | [»] | |
| 4V6D | X-ray | 3.81 | AT/CT | 1-87 | [»] | |
| 4V6E | X-ray | 3.71 | AT/CT | 1-87 | [»] | |
| 4V6K | electron microscopy | 8.25 | BX | 1-87 | [»] | |
| 4V6L | electron microscopy | 13.20 | AX | 1-87 | [»] | |
| 4V6M | electron microscopy | 7.10 | AT | 2-87 | [»] | |
| 4V6N | electron microscopy | 12.10 | BW | 2-87 | [»] | |
| 4V6O | electron microscopy | 14.70 | AW | 2-87 | [»] | |
| 4V6P | electron microscopy | 13.50 | AW | 2-87 | [»] | |
| 4V6Q | electron microscopy | 11.50 | AW | 2-87 | [»] | |
| 4V6R | electron microscopy | 11.50 | AW | 2-87 | [»] | |
| 4V6S | electron microscopy | 13.10 | BV | 2-87 | [»] | |
| 4V6T | electron microscopy | 8.30 | AT | 3-87 | [»] | |
| 4V6V | electron microscopy | 9.80 | AT | 2-87 | [»] | |
| 4V6Y | electron microscopy | 12.00 | AT | 3-87 | [»] | |
| 4V6Z | electron microscopy | 12.00 | AT | 3-87 | [»] | |
| 4V70 | electron microscopy | 17.00 | AT | 3-87 | [»] | |
| 4V71 | electron microscopy | 20.00 | AT | 3-87 | [»] | |
| 4V72 | electron microscopy | 13.00 | AT | 3-87 | [»] | |
| 4V73 | electron microscopy | 15.00 | AT | 3-87 | [»] | |
| 4V74 | electron microscopy | 17.00 | AT | 3-87 | [»] | |
| 4V75 | electron microscopy | 12.00 | AT | 3-87 | [»] | |
| 4V76 | electron microscopy | 17.00 | AT | 3-87 | [»] | |
| 4V77 | electron microscopy | 17.00 | AT | 3-87 | [»] | |
| 4V78 | electron microscopy | 20.00 | AT | 3-87 | [»] | |
| 4V79 | electron microscopy | 15.00 | AT | 3-87 | [»] | |
| 4V7A | electron microscopy | 9.00 | AT | 3-87 | [»] | |
| 4V7B | electron microscopy | 6.80 | AT | 1-87 | [»] | |
| 4V7C | electron microscopy | 7.60 | AT | 2-87 | [»] | |
| 4V7D | electron microscopy | 7.60 | BT | 2-87 | [»] | |
| 4V7I | electron microscopy | 9.60 | BT | 1-87 | [»] | |
| 4V7S | X-ray | 3.25 | AT/CT | 3-87 | [»] | |
| 4V7T | X-ray | 3.19 | AT/CT | 3-87 | [»] | |
| 4V7U | X-ray | 3.10 | AT/CT | 3-87 | [»] | |
| 4V7V | X-ray | 3.29 | AT/CT | 3-87 | [»] | |
| 4V85 | X-ray | 3.20 | AT | 1-87 | [»] | |
| 4V89 | X-ray | 3.70 | AT | 1-87 | [»] | |
| 4V9C | X-ray | 3.30 | AT/CT | 1-87 | [»] | |
| 4V9D | X-ray | 3.00 | AT/BT | 3-87 | [»] | |
| 4V9O | X-ray | 2.90 | BT/DT/FT/HT | 1-87 | [»] | |
| 4V9P | X-ray | 2.90 | BT/DT/FT/HT | 1-87 | [»] | |
| 4WF1 | X-ray | 3.09 | AT/CT | 3-87 | [»] | |
| 4WOI | X-ray | 3.00 | AT/DT | 1-87 | [»] | |
| 4WWW | X-ray | 3.10 | QT/XT | 3-87 | [»] | |
| 4YBB | X-ray | 2.10 | AT/BT | 2-87 | [»] | |
| 5AFI | electron microscopy | 2.90 | t | 1-87 | [»] | |
| 5H5U | electron microscopy | 3.00 | 1 | 2-87 | [»] | |
| 5IQR | electron microscopy | 3.00 | y | 1-87 | [»] | |
| 5IT8 | X-ray | 3.12 | AT/BT | 2-87 | [»] | |
| 5J5B | X-ray | 2.80 | AT/BT | 2-87 | [»] | |
| 5J7L | X-ray | 3.00 | AT/BT | 2-87 | [»] | |
| 5J88 | X-ray | 3.32 | AT/BT | 2-87 | [»] | |
| 5J8A | X-ray | 3.10 | AT/BT | 2-87 | [»] | |
| 5J91 | X-ray | 2.96 | AT/BT | 2-87 | [»] | |
| 5JC9 | X-ray | 3.03 | AT/BT | 2-87 | [»] | |
| 5JTE | electron microscopy | 3.60 | AT | 1-87 | [»] | |
| 5JU8 | electron microscopy | 3.60 | AT | 1-87 | [»] | |
| 5KCR | electron microscopy | 3.60 | 1t | 1-87 | [»] | |
| 5KCS | electron microscopy | 3.90 | 1t | 1-87 | [»] | |
| 5KPS | electron microscopy | 3.90 | 25 | 1-87 | [»] | |
| 5KPV | electron microscopy | 4.10 | 24 | 1-87 | [»] | |
| 5KPW | electron microscopy | 3.90 | 24 | 1-87 | [»] | |
| 5KPX | electron microscopy | 3.90 | 24 | 1-87 | [»] | |
| 5L3P | electron microscopy | 3.70 | t | 1-87 | [»] | |
| 5LZA | electron microscopy | 3.60 | t | 3-87 | [»] | |
| 5LZB | electron microscopy | 5.30 | t | 3-87 | [»] | |
| 5LZC | electron microscopy | 4.80 | t | 3-87 | [»] | |
| 5LZD | electron microscopy | 3.40 | t | 3-87 | [»] | |
| 5LZE | electron microscopy | 3.50 | t | 3-87 | [»] | |
| 5LZF | electron microscopy | 4.60 | t | 3-87 | [»] | |
| 5MDV | electron microscopy | 2.97 | y | 1-87 | [»] | |
| 5MDW | electron microscopy | 3.06 | y | 1-87 | [»] | |
| 5MDY | electron microscopy | 3.35 | y | 1-87 | [»] | |
| 5MDZ | electron microscopy | 3.10 | y | 1-87 | [»] | |
| 5ME0 | electron microscopy | 13.50 | T | 1-87 | [»] | |
| 5ME1 | electron microscopy | 13.50 | T | 1-87 | [»] | |
| 5MGP | electron microscopy | 3.10 | t | 3-87 | [»] | |
| 5MY1 | electron microscopy | 7.60 | T | 2-87 | [»] | |
| 5NO2 | electron microscopy | 5.16 | T | 2-87 | [»] | |
| 5NO3 | electron microscopy | 5.16 | T | 2-87 | [»] | |
| 5NO4 | electron microscopy | 5.16 | T | 2-87 | [»] | |
| 5NP6 | electron microscopy | 3.60 | W | 3-87 | [»] | |
| 5NWY | electron microscopy | 2.93 | J | 1-87 | [»] | |
| 5O2R | electron microscopy | 3.40 | t | 3-87 | [»] | |
| 5U4I | electron microscopy | 3.50 | t | 2-87 | [»] | |
| 5U9F | electron microscopy | 3.20 | T | 1-87 | [»] | |
| 5U9G | electron microscopy | 3.20 | T | 1-87 | [»] | |
| 5UYK | electron microscopy | 3.90 | T | 3-87 | [»] | |
| 5UYL | electron microscopy | 3.60 | T | 3-87 | [»] | |
| 5UYM | electron microscopy | 3.20 | T | 3-87 | [»] | |
| 5UYN | electron microscopy | 4.00 | T | 3-87 | [»] | |
| 5UYP | electron microscopy | 3.90 | T | 3-87 | [»] | |
| 5UYQ | electron microscopy | 3.80 | T | 3-87 | [»] | |
| 5UZ4 | electron microscopy | 5.80 | T | 1-87 | [»] | |
| 5WDT | electron microscopy | 3.00 | t | 3-87 | [»] | |
| 5WE4 | electron microscopy | 3.10 | t | 3-87 | [»] | |
| 5WE6 | electron microscopy | 3.40 | t | 3-87 | [»] | |
| 5WFK | electron microscopy | 3.40 | t | 3-87 | [»] | |
| 6BU8 | electron microscopy | 3.50 | T | 3-87 | [»] | |
| 6C4I | electron microscopy | 3.24 | t | 1-87 | [»] | |
| 6ENF | electron microscopy | 3.20 | t | 3-87 | [»] | |
| 6ENJ | electron microscopy | 3.70 | t | 3-87 | [»] | |
| 6ENU | electron microscopy | 3.10 | t | 3-87 | [»] | |
Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase More...ProteinModelPortali | P0A7U7 | |||||
SWISS-MODEL Repository - a database of annotated 3D protein structure models More...SMRi | P0A7U7 | |||||
Database of comparative protein structure models More...ModBasei | Search... | |||||
MobiDB: a database of protein disorder and mobility annotations More...MobiDBi | Search... | |||||
Protein-protein interaction databases
The Biological General Repository for Interaction Datasets (BioGrid) More...BioGridi | 4260844, 67 interactors |
Database of interacting proteins More...DIPi | DIP-35857N |
Protein interaction database and analysis system More...IntActi | P0A7U7, 70 interactors |
STRING: functional protein association networks More...STRINGi | 316385.ECDH10B_0024 |
Proteomic databases
Encyclopedia of Proteome Dynamics More...EPDi | P0A7U7 |
PaxDb, a database of protein abundance averages across all three domains of life More...PaxDbi | P0A7U7 |
PRoteomics IDEntifications database More...PRIDEi | P0A7U7 |
Protocols and materials databases
| Structural Biology Knowledgebase | Search... |
Genome annotation databases
Ensembl bacterial and archaeal genome annotation project More...EnsemblBacteriai | AAC73134; AAC73134; b0023 BAB96593; BAB96593; BAB96593 |
Database of genes from NCBI RefSeq genomes More...GeneIDi | 944759 |
KEGG: Kyoto Encyclopedia of Genes and Genomes More...KEGGi | ecj:JW0022 eco:b0023 |
Pathosystems Resource Integration Center (PATRIC) More...PATRICi | fig|1411691.4.peg.2261 |
Organism-specific databases
EchoBASE - an integrated post-genomic database for E. coli More...EchoBASEi | EB0912 |
Escherichia coli strain K12 genome database More...EcoGenei | EG10919 rpsT |
Phylogenomic databases
evolutionary genealogy of genes: Non-supervised Orthologous Groups More...eggNOGi | ENOG4105KQV Bacteria COG0268 LUCA |
The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms More...HOGENOMi | HOG000097048 |
InParanoid: Eukaryotic Ortholog Groups More...InParanoidi | P0A7U7 |
KEGG Orthology (KO) More...KOi | K02968 |
Identification of Orthologs from Complete Genome Data More...OMAi | ANKKSAM |
Database for complete collections of gene phylogenies More...PhylomeDBi | P0A7U7 |
Enzyme and pathway databases
BioCyc Collection of Pathway/Genome Databases More...BioCyci | EcoCyc:EG10919-MONOMER MetaCyc:EG10919-MONOMER |
Miscellaneous databases
Relative evolutionary importance of amino acids within a protein sequence More...EvolutionaryTracei | P0A7U7 |
Protein Ontology More...PROi | PR:P0A7U7 |
Family and domain databases
Gene3D Structural and Functional Annotation of Protein Families More...Gene3Di | 1.20.58.110, 1 hit |
HAMAP database of protein families More...HAMAPi | MF_00500 Ribosomal_S20, 1 hit |
Integrated resource of protein families, domains and functional sites More...InterProi | View protein in InterPro IPR002583 Ribosomal_S20 IPR036510 Ribosomal_S20_sf |
The PANTHER Classification System More...PANTHERi | PTHR33398 PTHR33398, 1 hit |
Pfam protein domain database More...Pfami | View protein in Pfam PF01649 Ribosomal_S20p, 1 hit |
ProDom; a protein domain database More...ProDomi | View protein in ProDom or Entries sharing at least one domain PD004231 Ribosomal_S20, 1 hit |
Superfamily database of structural and functional annotation More...SUPFAMi | SSF46992 SSF46992, 1 hit |
TIGRFAMs; a protein family database More...TIGRFAMsi | TIGR00029 S20, 1 hit |
ProtoNet; Automatic hierarchical classification of proteins More...ProtoNeti | Search... |
<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi
| <p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry namei | RS20_ECOLI | |
| <p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>Accessioni | P0A7U7Primary (citable) accession number: P0A7U7 Secondary accession number(s): P02378 | |
| <p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyi | Integrated into UniProtKB/Swiss-Prot: | July 21, 1986 |
| Last sequence update: | January 23, 2007 | |
| Last modified: | June 20, 2018 | |
| This is version 130 of the entry and version 2 of the sequence. See complete history. | ||
| <p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusi | Reviewed (UniProtKB/Swiss-Prot) | |
| Annotation program | Prokaryotic Protein Annotation Program | |
<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Technical termi
3D-structure, Complete proteome, Direct protein sequencing, Reference proteomeDocuments
- Escherichia coli
Escherichia coli (strain K12): entries and cross-references to EcoGene - PDB cross-references
Index of Protein Data Bank (PDB) cross-references - Ribosomal proteins
Ribosomal proteins families and list of entries - SIMILARITY comments
Index of protein domains and families
