Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Retinol-binding protein 1

Gene

RBP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Cytoplasmic retinol-binding protein (PubMed:22665496, PubMed:26900151, PubMed:28057518). Accepts retinol from the transport protein STRA6, and thereby contributes to retinol uptake, storage and retinoid homeostasis (PubMed:15632377, PubMed:22665496).4 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei41RetinolCombined sources1 Publication1
Binding sitei63RetinolCombined sources1 Publication1
Binding sitei109RetinolCombined sources2 Publications1

GO - Molecular functioni

  • all-trans-retinol binding Source: UniProtKB
  • retinal binding Source: UniProtKB-KW
  • retinoid binding Source: ProtInc

GO - Biological processi

  • lipid homeostasis Source: UniProtKB
  • retinoic acid biosynthetic process Source: InterPro
  • retinoid metabolic process Source: Reactome
  • vitamin A metabolic process Source: UniProtKB

Keywordsi

Biological processTransport
LigandRetinol-binding, Vitamin A

Enzyme and pathway databases

BioCyciMetaCyc:ENSG00000114115-MONOMER
ReactomeiR-HSA-2453864 Retinoid cycle disease events
R-HSA-2453902 The canonical retinoid cycle in rods (twilight vision)
R-HSA-975634 Retinoid metabolism and transport

Names & Taxonomyi

Protein namesi
Recommended name:
Retinol-binding protein 1
Alternative name(s):
Cellular retinol-binding protein
Short name:
CRBP
Cellular retinol-binding protein I
Short name:
CRBP-I
Gene namesi
Name:RBP1
Synonyms:CRBP1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

EuPathDBiHostDB:ENSG00000114115.9
HGNCiHGNC:9919 RBP1
MIMi180260 gene
neXtProtiNX_P09455

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Lipid droplet

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi22R → A: No effect on retinol binding. Abolishes interaction with STA6 and the ability to enhance STA6-mediated vitamin A uptake. 1 Publication1
Mutagenesisi30L → A: Decreases cellular retinol uptake and impairs retinol storage. 1 Publication1
Mutagenesisi31R → A: No effect on retinol binding. Abolishes interaction with STA6 and the ability to enhance STA6-mediated vitamin A uptake. 1 Publication1
Mutagenesisi32K → A: No effect on retinol binding. Abolishes interaction with STA6 and the ability to enhance STA6-mediated vitamin A uptake. 1 Publication1
Mutagenesisi41K → L: Strongly decreased affinity for retinol. Further decrease in affinity for retinol; when associated with L-109. 1 Publication1
Mutagenesisi59R → E: Decreases cellular retinol uptake and impairs retinol storage. 1 Publication1
Mutagenesisi109Q → L: Strongly decreased affinity for retinol. Further decrease in for retinol; when associated with L-41. 1 Publication1

Organism-specific databases

DisGeNETi5947
OpenTargetsiENSG00000114115
PharmGKBiPA34286

Chemistry databases

DrugBankiDB00459 Acitretin
DB00162 Vitamin A

Polymorphism and mutation databases

BioMutaiRBP1
DMDMi132387

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000673921 – 135Retinol-binding protein 1Add BLAST135

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Isoform 2 (identifier: P09455-2)
Modified residuei9Omega-N-methylarginineCombined sourcesCurated1
Isoform 3 (identifier: P09455-3)
Modified residuei9Omega-N-methylarginineCombined sources1

Keywords - PTMi

Methylation

Proteomic databases

EPDiP09455
MaxQBiP09455
PaxDbiP09455
PeptideAtlasiP09455
PRIDEiP09455
ProteomicsDBi52219

PTM databases

iPTMnetiP09455
PhosphoSitePlusiP09455

Expressioni

Tissue specificityi

Detected in nearly all the tissues with higher expression in adult ovary, pancreas, pituitary gland and adrenal gland, and fetal liver.1 Publication

Gene expression databases

BgeeiENSG00000114115 Expressed in 211 organ(s), highest expression level in pigmented layer of retina
CleanExiHS_RBP1
ExpressionAtlasiP09455 baseline and differential
GenevisibleiP09455 HS

Organism-specific databases

HPAiCAB018603
CAB019276
HPA007338

Interactioni

Subunit structurei

Interacts (only as retinol-free apoprotein) with STRA6.1 Publication

Protein-protein interaction databases

BioGridi111881, 13 interactors
IntActiP09455, 8 interactors
STRINGi9606.ENSP00000232219

Structurei

Secondary structure

1135
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliP09455
SMRiP09455
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni22 – 32Important for interaction with STRA61 PublicationAdd BLAST11

Domaini

Forms a beta-barrel structure that accommodates hydrophobic ligands in its interior.2 Publications

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG4015 Eukaryota
ENOG4111US8 LUCA
GeneTreeiENSGT00760000118898
HOGENOMiHOG000004831
HOVERGENiHBG005633
InParanoidiP09455
PhylomeDBiP09455
TreeFamiTF316894

Family and domain databases

Gene3Di2.40.128.20, 1 hit
InterProiView protein in InterPro
IPR012674 Calycin
IPR031264 CRBP1
IPR000463 Fatty_acid-bd
IPR031259 ILBP
IPR000566 Lipocln_cytosolic_FA-bd_dom
PANTHERiPTHR11955 PTHR11955, 1 hit
PTHR11955:SF56 PTHR11955:SF56, 1 hit
PfamiView protein in Pfam
PF00061 Lipocalin, 1 hit
PRINTSiPR00178 FATTYACIDBP
SUPFAMiSSF50814 SSF50814, 1 hit
PROSITEiView protein in PROSITE
PS00214 FABP, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P09455-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPVDFTGYWK MLVNENFEEY LRALDVNVAL RKIANLLKPD KEIVQDGDHM
60 70 80 90 100
IIRTLSTFRN YIMDFQVGKE FEEDLTGIDD RKCMTTVSWD GDKLQCVQKG
110 120 130
EKEGRGWTQW IEGDELHLEM RVEGVVCKQV FKKVQ
Length:135
Mass (Da):15,850
Last modified:January 23, 2007 - v2
Checksum:iFA47545761AFA3A2
GO
Isoform 2 (identifier: P09455-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MDPPAGFVRAGNPAVAAPQSPLSPEGAHFRAAHHPRSTGSRCPGSLQPSRPLVANWLQSLPEM
     85-135: TTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEMRVEGVVCKQVFKKVQ → SETGFSS

Note: No experimental confirmation available.Combined sourcesCurated
Show »
Length:153
Mass (Da):17,104
Checksum:i6142D55498572358
GO
Isoform 3 (identifier: P09455-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MDPPAGFVRAGNPAVAAPQSPLSPEGAHFRAAHHPRSTGSRCPGSLQPSRPLVANWLQSLPEM
     85-135: TTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEMRVEGVVCKQVFKKVQ → AGVQSRDLSSL

Note: No experimental confirmation available.Combined sources
Show »
Length:157
Mass (Da):17,523
Checksum:i454E1DC7BE53793A
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0A0MQT0A0A0A0MQT0_HUMAN
Retinol binding protein 1, cellular
RBP1 hCG_16055
197Annotation score:
H0YAK8H0YAK8_HUMAN
Retinol-binding protein 1
RBP1
98Annotation score:
A0A0A0MTB9A0A0A0MTB9_HUMAN
Retinol-binding protein 1
RBP1
91Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Isoform 2 (identifier: P09455-2)
Sequence conflicti18P → L in BAH13536 (PubMed:14702039).Combined sourcesCurated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0462011M → MDPPAGFVRAGNPAVAAPQS PLSPEGAHFRAAHHPRSTGS RCPGSLQPSRPLVANWLQSL PEM in isoform 2 and isoform 3. 1 Publication1
Alternative sequenceiVSP_04620285 – 135TTVSW…FKKVQ → SETGFSS in isoform 2. 1 PublicationAdd BLAST51
Alternative sequenceiVSP_04620385 – 135TTVSW…FKKVQ → AGVQSRDLSSL in isoform 3. 1 PublicationAdd BLAST51

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M11433 mRNA Translation: AAA60257.1
X07437, X07438 Genomic DNA Translation: CAA30318.1
AK290315 mRNA Translation: BAF83004.1
AK301684 mRNA Translation: BAH13536.1
AK309492 Genomic DNA No translation available.
CR541979 mRNA Translation: CAG46776.1
CR542005 mRNA Translation: CAG46802.1
AC046134 Genomic DNA No translation available.
BC121052 mRNA Translation: AAI21053.1
M36809 mRNA Translation: AAA35714.1
CCDSiCCDS46925.1 [P09455-2]
CCDS46926.1 [P09455-3]
PIRiS00399 RJHUO
RefSeqiNP_001124464.1, NM_001130992.1 [P09455-3]
NP_001124465.1, NM_001130993.1 [P09455-2]
NP_002890.2, NM_002899.3
UniGeneiHs.529571

Genome annotation databases

EnsembliENST00000492918; ENSP00000429166; ENSG00000114115 [P09455-3]
ENST00000617459; ENSP00000477621; ENSG00000114115 [P09455-2]
ENST00000619087; ENSP00000482165; ENSG00000114115 [P09455-1]
GeneIDi5947
KEGGihsa:5947
UCSCiuc011bmx.2 human [P09455-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M11433 mRNA Translation: AAA60257.1
X07437, X07438 Genomic DNA Translation: CAA30318.1
AK290315 mRNA Translation: BAF83004.1
AK301684 mRNA Translation: BAH13536.1
AK309492 Genomic DNA No translation available.
CR541979 mRNA Translation: CAG46776.1
CR542005 mRNA Translation: CAG46802.1
AC046134 Genomic DNA No translation available.
BC121052 mRNA Translation: AAI21053.1
M36809 mRNA Translation: AAA35714.1
CCDSiCCDS46925.1 [P09455-2]
CCDS46926.1 [P09455-3]
PIRiS00399 RJHUO
RefSeqiNP_001124464.1, NM_001130992.1 [P09455-3]
NP_001124465.1, NM_001130993.1 [P09455-2]
NP_002890.2, NM_002899.3
UniGeneiHs.529571

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5H8TX-ray1.21A2-135[»]
5H9AX-ray1.38A2-135[»]
5HA1X-ray1.35A2-135[»]
5HBSX-ray0.89A2-135[»]
5LJBX-ray1.26A1-135[»]
5LJCX-ray1.43A1-135[»]
5LJDX-ray1.61A1-135[»]
5LJEX-ray1.40A1-135[»]
5LJGX-ray1.15A1-135[»]
5LJHX-ray1.52A1-135[»]
5LJKX-ray1.70A1-135[»]
ProteinModelPortaliP09455
SMRiP09455
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111881, 13 interactors
IntActiP09455, 8 interactors
STRINGi9606.ENSP00000232219

Chemistry databases

DrugBankiDB00459 Acitretin
DB00162 Vitamin A

PTM databases

iPTMnetiP09455
PhosphoSitePlusiP09455

Polymorphism and mutation databases

BioMutaiRBP1
DMDMi132387

Proteomic databases

EPDiP09455
MaxQBiP09455
PaxDbiP09455
PeptideAtlasiP09455
PRIDEiP09455
ProteomicsDBi52219

Protocols and materials databases

DNASUi5947
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000492918; ENSP00000429166; ENSG00000114115 [P09455-3]
ENST00000617459; ENSP00000477621; ENSG00000114115 [P09455-2]
ENST00000619087; ENSP00000482165; ENSG00000114115 [P09455-1]
GeneIDi5947
KEGGihsa:5947
UCSCiuc011bmx.2 human [P09455-1]

Organism-specific databases

CTDi5947
DisGeNETi5947
EuPathDBiHostDB:ENSG00000114115.9
GeneCardsiRBP1
H-InvDBiHIX0030850
HGNCiHGNC:9919 RBP1
HPAiCAB018603
CAB019276
HPA007338
MIMi180260 gene
neXtProtiNX_P09455
OpenTargetsiENSG00000114115
PharmGKBiPA34286
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4015 Eukaryota
ENOG4111US8 LUCA
GeneTreeiENSGT00760000118898
HOGENOMiHOG000004831
HOVERGENiHBG005633
InParanoidiP09455
PhylomeDBiP09455
TreeFamiTF316894

Enzyme and pathway databases

BioCyciMetaCyc:ENSG00000114115-MONOMER
ReactomeiR-HSA-2453864 Retinoid cycle disease events
R-HSA-2453902 The canonical retinoid cycle in rods (twilight vision)
R-HSA-975634 Retinoid metabolism and transport

Miscellaneous databases

GeneWikiiRBP1
GenomeRNAii5947
PROiPR:P09455
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000114115 Expressed in 211 organ(s), highest expression level in pigmented layer of retina
CleanExiHS_RBP1
ExpressionAtlasiP09455 baseline and differential
GenevisibleiP09455 HS

Family and domain databases

Gene3Di2.40.128.20, 1 hit
InterProiView protein in InterPro
IPR012674 Calycin
IPR031264 CRBP1
IPR000463 Fatty_acid-bd
IPR031259 ILBP
IPR000566 Lipocln_cytosolic_FA-bd_dom
PANTHERiPTHR11955 PTHR11955, 1 hit
PTHR11955:SF56 PTHR11955:SF56, 1 hit
PfamiView protein in Pfam
PF00061 Lipocalin, 1 hit
PRINTSiPR00178 FATTYACIDBP
SUPFAMiSSF50814 SSF50814, 1 hit
PROSITEiView protein in PROSITE
PS00214 FABP, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiRET1_HUMAN
AccessioniPrimary (citable) accession number: P09455
Secondary accession number(s): A8K2Q0
, B7Z7A0, E7EWV0, F2Z2F2, Q6FGX8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 1, 1989
Last sequence update: January 23, 2007
Last modified: September 12, 2018
This is version 172 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again