UniProtKB - P09385 (STXA_BP933)

BLAST

>sp|P09385|STXA_BP933 Shiga-like toxin 2 subunit A OS=Enterobacteria phage 933W OX=10730 GN=stxA2 PE=1 SV=2
MKCILFKWVLCLLLGFSSVSYSREFTIDFSTQQSYVSSLNSIRTEISTPLEHISQGTTSV
SVINHTPPGSYFAVDIRGLDVYQARFDHLRLIIEQNNLYVAGFVNTATNTFYRFSDFTHI
SVPGVTTVSMTTDSSYTTLQRVAALERSGMQISRHSLVSSYLALMEFSGNTMTRDASRAV
LRFVTVTAEALRFRQIQREFRQALSETAPVYTMTPGDVDLTLNWGRISNVLPEYRGEDGV
RVGRISFNNISAILGTVAVILNCHHQGARSVRAVNEESQPECQITGDRPVIKINNTLWES
NTAAAFLNRKSQFLYTTGK

Align
Format
Add to basket Added to basket
History
Entry version 106 (22 Nov 2017)
Sequence version 2 (01 Feb 1996)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

Shiga-like toxin 2 subunit A

Gene

stxA2

Organism

Enterobacteria phage 933W (Bacteriophage 933W)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

The A subunit is responsible for inhibiting protein synthesis through the catalytic inactivation of 60S ribosomal subunits. After endocytosis, the A subunit is cleaved by furin in two fragments, A1 and A2: A1 is the catalytically active fragment, and A2 is essential for holotoxin assembly with the B subunits.

Catalytic activityⁱ

Endohydrolysis of the N-glycosidic bond at one specific adenosine on the 28S rRNA.

Sites

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Active siteⁱ	189	By similarity		1

GO - Molecular functionⁱ

rRNA N-glycosylase activity Source: UniProtKB-EC
toxin activity Source: UniProtKB-KW

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

modulation of host virulence by virus Source: UniProtKB-KW
negative regulation of translation Source: UniProtKB-KW

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Hydrolase, Protein synthesis inhibitor, Toxin, Viral exotoxin
Biological process	Modulation of host virulence by virus, Virulence

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Shiga-like toxin 2 subunit A (EC:3.2.2.22) Short name: SLT-2 A subunit Short name: SLT-2a Short name: SLT-IIa Alternative name(s): Verocytotoxin 2 subunit A Verotoxin 2 subunit A rRNA N-glycosidase 2
Gene namesⁱ	Name:stxA2 Synonyms:stx2A Ordered Locus Names:L0103
Organismⁱ	Enterobacteria phage 933W (Bacteriophage 933W)
Taxonomic identifierⁱ	10730 [NCBI]
Taxonomic lineageⁱ	Viruses › dsDNA viruses, no RNA stage › Caudovirales › Podoviridae › Sepvirinae › Nona33virus › Escherichia virus 933W
Virus hostⁱ	Escherichia coli O157:H7 [TaxID: 83334]
Proteomesⁱ	UP000002135 Componentⁱ: Genome

Subcellular locationⁱ

Secreted

GO - Cellular componentⁱ

extracellular region Source: UniProtKB-SubCell

View the complete GO annotation on QuickGO ...

Keywords - Cellular componentⁱ

Secreted

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Signal peptideⁱ	1 – 22	Sequence analysisAdd BLAST		22
ChainⁱPRO_0000030792	23 – 319	Shiga-like toxin 2 subunit AAdd BLAST		297

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Disulfide bondⁱ	263 ↔ 282

Sites

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Siteⁱ	272 – 273	Cleavage; by furinBy similarity		2

Keywords - PTMⁱ

Disulfide bond

Interactionⁱ

Subunit structureⁱ

Shiga-like toxin contains a single A subunit and multiple copies of a B subunit.

Protein-protein interaction databases

IntActⁱ	P09385, 1 interactor

IntActⁱ

P09385, 1 interactor

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Beta strandⁱ	24 – 28	Combined sources	5
Helixⁱ	32 – 46	Combined sources	15
Beta strandⁱ	47 – 55	Combined sources	9
Beta strandⁱ	58 – 63	Combined sources	6
Beta strandⁱ	71 – 77	Combined sources	7
Beta strandⁱ	89 – 94	Combined sources	6
Turnⁱ	95 – 97	Combined sources	3
Beta strandⁱ	100 – 105	Combined sources	6
Turnⁱ	106 – 109	Combined sources	4
Beta strandⁱ	110 – 113	Combined sources	4
Helixⁱ	115 – 117	Combined sources	3
Beta strandⁱ	125 – 129	Combined sources	5
Helixⁱ	136 – 143	Combined sources	8
Helixⁱ	154 – 166	Combined sources	13
Beta strandⁱ	169 – 171	Combined sources	3
Helixⁱ	174 – 186	Combined sources	13
Helixⁱ	188 – 192	Combined sources	5
Helixⁱ	194 – 201	Combined sources	8
Helixⁱ	202 – 204	Combined sources	3
Helixⁱ	215 – 222	Combined sources	8
Helixⁱ	224 – 230	Combined sources	7
Helixⁱ	231 – 233	Combined sources	3
Beta strandⁱ	240 – 242	Combined sources	3
Beta strandⁱ	245 – 247	Combined sources	3
Helixⁱ	250 – 256	Combined sources	7
Beta strandⁱ	284 – 287	Combined sources	4
Beta strandⁱ	290 – 293	Combined sources	4
Beta strandⁱ	296 – 299	Combined sources	4
Helixⁱ	300 – 306	Combined sources	7
Helixⁱ	312 – 317	Combined sources	6

Show more details

3D structure databases

ProteinModelPortalⁱ	P09385
SMRⁱ	P09385
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ	P09385

EvolutionaryTraceⁱ

P09385

Family & Domainsⁱ

Region

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Regionⁱ	23 – 272	A1By similarityAdd BLAST		250
Regionⁱ	273 – 314	A2By similarityAdd BLAST		42

Sequence similaritiesⁱ

Belongs to the ribosome-inactivating protein family.Curated

Keywords - Domainⁱ

Signal

Phylogenomic databases

KEGG Orthology (KO) More...KOⁱ	K11006
Database of Orthologous Groups More...OrthoDBⁱ	VOG090002CW

Family and domain databases

Gene3Dⁱ	3.40.420.10, 1 hit 4.10.470.10, 1 hit
InterProⁱ	View protein in InterPro IPR036041 Ribosome-inact_prot_sf IPR001574 Ribosome_inactivat_prot IPR017988 Ribosome_inactivat_prot_CS IPR016138 Ribosome_inactivat_prot_sub1 IPR016139 Ribosome_inactivat_prot_sub2 IPR016331 Shiga-like_toxin_subunit_A
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF00161 RIP, 1 hit
PIRSFⁱ	PIRSF001924 Shigella_toxin_subunit_A, 1 hit
SUPFAMⁱ	SSF56371 SSF56371, 1 hit
PROSITEⁱ	View protein in PROSITE PS00275 SHIGA_RICIN, 1 hit

Sequenceⁱ

Sequence statusⁱ: Complete.

Sequence processingⁱ: The displayed sequence is further processed into a mature form.

P09385-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MKCILFKWVL CLLLGFSSVS YSREFTIDFS TQQSYVSSLN SIRTEISTPL 
        60         70         80         90        100
EHISQGTTSV SVINHTPPGS YFAVDIRGLD VYQARFDHLR LIIEQNNLYV 
       110        120        130        140        150
AGFVNTATNT FYRFSDFTHI SVPGVTTVSM TTDSSYTTLQ RVAALERSGM 
       160        170        180        190        200
QISRHSLVSS YLALMEFSGN TMTRDASRAV LRFVTVTAEA LRFRQIQREF 
       210        220        230        240        250
RQALSETAPV YTMTPGDVDL TLNWGRISNV LPEYRGEDGV RVGRISFNNI 
       260        270        280        290        300
SAILGTVAVI LNCHHQGARS VRAVNEESQP ECQITGDRPV IKINNTLWES 
       310 
NTAAAFLNRK SQFLYTTGK

Length:319

Mass (Da):35,714

Last modified:February 1, 1996 - v2

Checksum:ⁱ98F73319ACAE48D6

Natural variant

Feature key	Position(s)	DescriptionActions	Length
Natural variantⁱ	17	S → P in strain: OX3:H21.	1
Natural variantⁱ	26	T → M in strain: OX3:H21.	1
Natural variantⁱ	277	E → D in strain: FLY16 and CS1718.	1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	X07865 Genomic DNA Translation: CAA30714.1 M59432 Unassigned DNA Translation: AAA19623.1 L11079 Unassigned DNA Translation: AAA16362.1 Y10775 Genomic DNA Translation: CAA71747.1 AB017524 Genomic DNA Translation: BAA33759.1 AB015057 Genomic DNA Translation: BAA34372.1 AF461167 Genomic DNA Translation: AAM70033.1 AB048239 Genomic DNA Translation: BAB83026.1 AB048240 Genomic DNA Translation: BAB83028.1 AY443052 Genomic DNA Translation: AAS07596.1 AF125520 Genomic DNA Translation: AAD25445.1
PIRⁱ	I76713 S01032
NCBI Reference Sequences More...RefSeqⁱ	NP_049500.1, NC_000924.1

Genome annotation databases

GeneIDⁱ	1261950
KEGGⁱ	vg:1261950

Protein	Similar proteins		Species	Score	Length	Source
P09385	Shiga toxin 2 subunit A		BPVT2		319	UniRef100_P09385
Shiga-like toxin II subunit A		Escherichia phage ArgO145		319
Shiga-like toxin II subunit A		Escherichia phage PA29		319
Shiga toxin 2 subunit A		Escherichia phage P13803		319
Shiga-like toxin II subunit A		Escherichia phage PA30		319
+81

Protein	Similar proteins		Species	Score	Length	Source
P09385	Shiga toxin 2 subunit A		BPVT2		319	UniRef90_P09385
Shiga-like toxin II subunit A		Escherichia phage ArgO145		319
Shiga-like toxin II subunit A		Escherichia phage PA29		319
Shiga toxin 2 subunit A		Escherichia phage P13803		319
Shiga-like toxin II subunit A		Escherichia phage PA30		319
+382

Protein	Similar proteins		Species	Score	Length	Source
P09385	Shiga toxin subunit A		SHIDS		315	UniRef50_P09385
Shiga toxin subunit A		BP788		315
Shiga-like toxin 1 subunit A		BPH30		315
Shiga toxin subunit A	)	SHIDY		315
Shiga-like toxin 1 subunit A		BPH19		315
+539

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	X07865 Genomic DNA Translation: CAA30714.1 M59432 Unassigned DNA Translation: AAA19623.1 L11079 Unassigned DNA Translation: AAA16362.1 Y10775 Genomic DNA Translation: CAA71747.1 AB017524 Genomic DNA Translation: BAA33759.1 AB015057 Genomic DNA Translation: BAA34372.1 AF461167 Genomic DNA Translation: AAM70033.1 AB048239 Genomic DNA Translation: BAB83026.1 AB048240 Genomic DNA Translation: BAB83028.1 AY443052 Genomic DNA Translation: AAS07596.1 AF125520 Genomic DNA Translation: AAD25445.1
PIRⁱ	I76713 S01032
RefSeqⁱ	NP_049500.1, NC_000924.1

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	1R4P	X-ray	1.77	A	23-319	[»]
	2GA4	X-ray	1.80	A	23-319	[»]
ProteinModelPortalⁱ	P09385
SMRⁱ	P09385
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

IntActⁱ	P09385, 1 interactor

IntActⁱ

P09385, 1 interactor

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

GeneIDⁱ	1261950
KEGGⁱ	vg:1261950

Phylogenomic databases

KOⁱ	K11006
OrthoDBⁱ	VOG090002CW

Miscellaneous databases

EvolutionaryTraceⁱ	P09385

EvolutionaryTraceⁱ

P09385

Family and domain databases

Gene3Dⁱ	3.40.420.10, 1 hit 4.10.470.10, 1 hit
InterProⁱ	View protein in InterPro IPR036041 Ribosome-inact_prot_sf IPR001574 Ribosome_inactivat_prot IPR017988 Ribosome_inactivat_prot_CS IPR016138 Ribosome_inactivat_prot_sub1 IPR016139 Ribosome_inactivat_prot_sub2 IPR016331 Shiga-like_toxin_subunit_A
Pfamⁱ	View protein in Pfam PF00161 RIP, 1 hit
PIRSFⁱ	PIRSF001924 Shigella_toxin_subunit_A, 1 hit
SUPFAMⁱ	SSF56371 SSF56371, 1 hit
PROSITEⁱ	View protein in PROSITE PS00275 SHIGA_RICIN, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	STXA_BP933
Accessionⁱ	P09385Primary (citable) accession number: P09385 Secondary accession number(s): Q9R398
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	July 1, 1989
	Last sequence update:	February 1, 1996
	Last modified:	November 22, 2017
	This is version 106 of the entry and version 2 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Viral Protein Annotation Program

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P09385 (STXA_BP933)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Shiga-like toxin 2 subunit A

stxA2

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Sites

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

GO - Cellular componenti

Keywords - Cellular componenti

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Sites

Keywords - PTMi

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Phylogenomic databases

Family and domain databases

Natural variant

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Protocols and materials databases

Genome annotation databases

Phylogenomic databases

Miscellaneous databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

GO - Cellular componentⁱ

Keywords - Cellular componentⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Keywords - Domainⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ