Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Signal recognition particle 19 kDa protein

Gene

SRP19

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Signal-recognition-particle assembly, binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • 7S RNA binding Source: UniProtKB
  • RNA binding Source: UniProtKB

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionRibonucleoprotein, RNA-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-1799339 SRP-dependent cotranslational protein targeting to membrane

Protein family/group databases

Transport Classification Database

More...
TCDBi
3.A.5.9.1 the general secretory pathway (sec) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Signal recognition particle 19 kDa protein
Short name:
SRP19
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SRP19
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000153037.13

Human Gene Nomenclature Database

More...
HGNCi
HGNC:11300 SRP19

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
182175 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P09132

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Signal recognition particle

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
6728

Open Targets

More...
OpenTargetsi
ENSG00000153037

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA36124

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SRP19

Domain mapping of disease mutations (DMDM)

More...
DMDMi
115502457

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001351971 – 144Signal recognition particle 19 kDa proteinAdd BLAST144

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P09132

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P09132

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P09132

PeptideAtlas

More...
PeptideAtlasi
P09132

PRoteomics IDEntifications database

More...
PRIDEi
P09132

ProteomicsDB human proteome resource

More...
ProteomicsDBi
52203
52204 [P09132-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P09132

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P09132

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000153037 Expressed in 87 organ(s), highest expression level in adenohypophysis

CleanEx database of gene expression profiles

More...
CleanExi
HS_SRP19

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P09132 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P09132 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA029272

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Signal recognition particle consists of a 7S RNA molecule of 300 nucleotides and six protein subunits: SRP72, SRP68, SRP54, SRP19, SRP14 and SRP9.2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
SRP68Q9UHB92EBI-2680090,EBI-1048560

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
112606, 34 interactors

Database of interacting proteins

More...
DIPi
DIP-41412N

Protein interaction database and analysis system

More...
IntActi
P09132, 16 interactors

Molecular INTeraction database

More...
MINTi
P09132

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000424870

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1144
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Database of protein disorder

More...
DisProti
DP00570

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P09132

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P09132

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P09132

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni136 – 144Basic region, potentially involved in RNA-binding9

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the SRP19 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3198 Eukaryota
COG1400 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000004950

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000237221

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG059463

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P09132

KEGG Orthology (KO)

More...
KOi
K03105

Identification of Orthologs from Complete Genome Data

More...
OMAi
CVENPTH

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0VWO

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P09132

TreeFam database of animal gene trees

More...
TreeFami
TF106248

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.56.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002778 Signal_recog_particle_SRP19
IPR036521 SRP19-like_sf

The PANTHER Classification System

More...
PANTHERi
PTHR17453 PTHR17453, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01922 SRP19, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF69695 SSF69695, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P09132-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MACAAARSPA DQDRFICIYP AYLNNKKTIA EGRRIPISKA VENPTATEIQ
60 70 80 90 100
DVCSAVGLNV FLEKNKMYSR EWNRDVQYRG RVRVQLKQED GSLCLVQFPS
110 120 130 140
RKSVMLYAAE MIPKLKTRTQ KTGGADQSLQ QGEGSKKGKG KKKK
Length:144
Mass (Da):16,156
Last modified:October 3, 2006 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iE25F661972338CAE
GO
Isoform 2 (identifier: P09132-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     101-144: RKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKGKKKK → HYTLSLTSGS

Note: No experimental confirmation available.
Show »
Length:110
Mass (Da):12,400
Checksum:iF199656A14C743E1
GO
Isoform 3 (identifier: P09132-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     15-144: FICIYPAYLN...SKKGKGKKKK → LLKILQLQRF...ALYSSHHVSQ

Show »
Length:78
Mass (Da):8,739
Checksum:i55C1707F8C5C2AE0
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RBG4D6RBG4_HUMAN
Signal recognition particle 19 kDa ...
SRP19
43Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WYR0A0A087WYR0_HUMAN
Signal recognition particle 19 kDa ...
SRP19
120Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WWU9A0A087WWU9_HUMAN
HCG2039564, isoform CRA_a
SRP19 hCG_2039564
104Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2U3TZN1A0A2U3TZN1_HUMAN
HCG2040106
SRP19 hCG_2040106
101Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8Y4M3A0A2R8Y4M3_HUMAN
Signal recognition particle 19 kDa ...
SRP19
77Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0278004A → T1 PublicationCorresponds to variant dbSNP:rs17855423Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04452415 – 144FICIY…GKKKK → LLKILQLQRFKMYVQQLDLT YFLRKIKCTLENGIVMSNTE AESGSSSNRKMGASALYSSH HVSQ in isoform 3. 1 PublicationAdd BLAST130
Alternative sequenceiVSP_042540101 – 144RKSVM…GKKKK → HYTLSLTSGS in isoform 2. 1 PublicationAdd BLAST44

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X12791 mRNA Translation: CAA31280.1
BU661702 mRNA No translation available.
AK311803 mRNA Translation: BAG34746.1
AC008536 Genomic DNA No translation available.
AC008575 Genomic DNA No translation available.
CH471086 Genomic DNA Translation: EAW48999.1
CH471086 Genomic DNA Translation: EAW49000.1
BC010947 mRNA Translation: AAH10947.1
BC017830 mRNA Translation: AAH17830.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS4108.1 [P09132-1]
CCDS56375.1 [P09132-2]
CCDS56376.1 [P09132-3]

Protein sequence database of the Protein Information Resource

More...
PIRi
S01700

NCBI Reference Sequences

More...
RefSeqi
NP_001191122.1, NM_001204193.1 [P09132-2]
NP_001191123.1, NM_001204194.1
NP_001191125.1, NM_001204196.1 [P09132-3]
NP_003126.1, NM_003135.2 [P09132-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.637001

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000282999; ENSP00000282999; ENSG00000153037 [P09132-2]
ENST00000505459; ENSP00000424870; ENSG00000153037 [P09132-1]
ENST00000515463; ENSP00000425562; ENSG00000153037 [P09132-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
6728

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:6728

UCSC genome browser

More...
UCSCi
uc003kqb.3 human [P09132-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Wikipedia

Signal recognition particle entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X12791 mRNA Translation: CAA31280.1
BU661702 mRNA No translation available.
AK311803 mRNA Translation: BAG34746.1
AC008536 Genomic DNA No translation available.
AC008575 Genomic DNA No translation available.
CH471086 Genomic DNA Translation: EAW48999.1
CH471086 Genomic DNA Translation: EAW49000.1
BC010947 mRNA Translation: AAH10947.1
BC017830 mRNA Translation: AAH17830.1
CCDSiCCDS4108.1 [P09132-1]
CCDS56375.1 [P09132-2]
CCDS56376.1 [P09132-3]
PIRiS01700
RefSeqiNP_001191122.1, NM_001204193.1 [P09132-2]
NP_001191123.1, NM_001204194.1
NP_001191125.1, NM_001204196.1 [P09132-3]
NP_003126.1, NM_003135.2 [P09132-1]
UniGeneiHs.637001

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1JIDX-ray1.80A1-120[»]
1MFQX-ray3.10B14-120[»]
1RY1electron microscopy12.00B14-120[»]
2J37electron microscopy8.00B14-120[»]
3KTVX-ray3.80B/D1-120[»]
4P3EX-ray3.50B1-120[»]
5M73X-ray3.40B/F11-118[»]
DisProtiDP00570
ProteinModelPortaliP09132
SMRiP09132
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112606, 34 interactors
DIPiDIP-41412N
IntActiP09132, 16 interactors
MINTiP09132
STRINGi9606.ENSP00000424870

Protein family/group databases

TCDBi3.A.5.9.1 the general secretory pathway (sec) family

PTM databases

iPTMnetiP09132
PhosphoSitePlusiP09132

Polymorphism and mutation databases

BioMutaiSRP19
DMDMi115502457

Proteomic databases

EPDiP09132
MaxQBiP09132
PaxDbiP09132
PeptideAtlasiP09132
PRIDEiP09132
ProteomicsDBi52203
52204 [P09132-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000282999; ENSP00000282999; ENSG00000153037 [P09132-2]
ENST00000505459; ENSP00000424870; ENSG00000153037 [P09132-1]
ENST00000515463; ENSP00000425562; ENSG00000153037 [P09132-3]
GeneIDi6728
KEGGihsa:6728
UCSCiuc003kqb.3 human [P09132-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
6728
DisGeNETi6728
EuPathDBiHostDB:ENSG00000153037.13

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SRP19
HGNCiHGNC:11300 SRP19
HPAiHPA029272
MIMi182175 gene
neXtProtiNX_P09132
OpenTargetsiENSG00000153037
PharmGKBiPA36124

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3198 Eukaryota
COG1400 LUCA
GeneTreeiENSGT00390000004950
HOGENOMiHOG000237221
HOVERGENiHBG059463
InParanoidiP09132
KOiK03105
OMAiCVENPTH
OrthoDBiEOG091G0VWO
PhylomeDBiP09132
TreeFamiTF106248

Enzyme and pathway databases

ReactomeiR-HSA-1799339 SRP-dependent cotranslational protein targeting to membrane

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SRP19 human
EvolutionaryTraceiP09132

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
6728

Protein Ontology

More...
PROi
PR:P09132

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000153037 Expressed in 87 organ(s), highest expression level in adenohypophysis
CleanExiHS_SRP19
ExpressionAtlasiP09132 baseline and differential
GenevisibleiP09132 HS

Family and domain databases

Gene3Di3.30.56.30, 1 hit
InterProiView protein in InterPro
IPR002778 Signal_recog_particle_SRP19
IPR036521 SRP19-like_sf
PANTHERiPTHR17453 PTHR17453, 1 hit
PfamiView protein in Pfam
PF01922 SRP19, 1 hit
SUPFAMiSSF69695 SSF69695, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSRP19_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P09132
Secondary accession number(s): B2R4E9
, D6RCQ5, Q05D77, Q96FG6
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 1, 1989
Last sequence update: October 3, 2006
Last modified: December 5, 2018
This is version 189 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again