Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Signal recognition particle 19 kDa protein

Gene

SRP19

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Signal-recognition-particle assembly, binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

GO - Molecular functioni

  • 7S RNA binding Source: UniProtKB
  • RNA binding Source: UniProtKB

GO - Biological processi

Keywordsi

Molecular functionRibonucleoprotein, RNA-binding

Enzyme and pathway databases

ReactomeiR-HSA-1799339 SRP-dependent cotranslational protein targeting to membrane

Protein family/group databases

TCDBi3.A.5.9.1 the general secretory pathway (sec) family

Names & Taxonomyi

Protein namesi
Recommended name:
Signal recognition particle 19 kDa protein
Short name:
SRP19
Gene namesi
Name:SRP19
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

EuPathDBiHostDB:ENSG00000153037.13
HGNCiHGNC:11300 SRP19
MIMi182175 gene
neXtProtiNX_P09132

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Signal recognition particle

Pathology & Biotechi

Organism-specific databases

DisGeNETi6728
OpenTargetsiENSG00000153037
PharmGKBiPA36124

Polymorphism and mutation databases

BioMutaiSRP19
DMDMi115502457

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001351971 – 144Signal recognition particle 19 kDa proteinAdd BLAST144

Proteomic databases

EPDiP09132
MaxQBiP09132
PaxDbiP09132
PeptideAtlasiP09132
PRIDEiP09132
ProteomicsDBi52203
52204 [P09132-2]

PTM databases

iPTMnetiP09132
PhosphoSitePlusiP09132

Expressioni

Gene expression databases

BgeeiENSG00000153037 Expressed in 87 organ(s), highest expression level in adenohypophysis
CleanExiHS_SRP19
ExpressionAtlasiP09132 baseline and differential
GenevisibleiP09132 HS

Organism-specific databases

HPAiHPA029272

Interactioni

Subunit structurei

Signal recognition particle consists of a 7S RNA molecule of 300 nucleotides and six protein subunits: SRP72, SRP68, SRP54, SRP19, SRP14 and SRP9.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
SRP68Q9UHB92EBI-2680090,EBI-1048560

Protein-protein interaction databases

BioGridi112606, 34 interactors
DIPiDIP-41412N
IntActiP09132, 15 interactors
MINTiP09132
STRINGi9606.ENSP00000424870

Structurei

Secondary structure

1144
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

DisProtiDP00570
ProteinModelPortaliP09132
SMRiP09132
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP09132

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni136 – 144Basic region, potentially involved in RNA-binding9

Sequence similaritiesi

Belongs to the SRP19 family.Curated

Phylogenomic databases

eggNOGiKOG3198 Eukaryota
COG1400 LUCA
GeneTreeiENSGT00390000004950
HOGENOMiHOG000237221
HOVERGENiHBG059463
InParanoidiP09132
KOiK03105
OMAiCVENPTH
OrthoDBiEOG091G0VWO
PhylomeDBiP09132
TreeFamiTF106248

Family and domain databases

Gene3Di3.30.56.30, 1 hit
InterProiView protein in InterPro
IPR002778 Signal_recog_particle_SRP19
IPR036521 SRP19-like_sf
PANTHERiPTHR17453 PTHR17453, 1 hit
PfamiView protein in Pfam
PF01922 SRP19, 1 hit
SUPFAMiSSF69695 SSF69695, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P09132-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MACAAARSPA DQDRFICIYP AYLNNKKTIA EGRRIPISKA VENPTATEIQ
60 70 80 90 100
DVCSAVGLNV FLEKNKMYSR EWNRDVQYRG RVRVQLKQED GSLCLVQFPS
110 120 130 140
RKSVMLYAAE MIPKLKTRTQ KTGGADQSLQ QGEGSKKGKG KKKK
Length:144
Mass (Da):16,156
Last modified:October 3, 2006 - v3
Checksum:iE25F661972338CAE
GO
Isoform 2 (identifier: P09132-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     101-144: RKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKGKKKK → HYTLSLTSGS

Note: No experimental confirmation available.
Show »
Length:110
Mass (Da):12,400
Checksum:iF199656A14C743E1
GO
Isoform 3 (identifier: P09132-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     15-144: FICIYPAYLN...SKKGKGKKKK → LLKILQLQRF...ALYSSHHVSQ

Show »
Length:78
Mass (Da):8,739
Checksum:i55C1707F8C5C2AE0
GO

Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RBG4D6RBG4_HUMAN
Signal recognition particle 19 kDa ...
SRP19
43Annotation score:
A0A087WYR0A0A087WYR0_HUMAN
Signal recognition particle 19 kDa ...
SRP19
120Annotation score:
A0A087WWU9A0A087WWU9_HUMAN
HCG2039564, isoform CRA_a
SRP19 hCG_2039564
104Annotation score:
A0A2U3TZN1A0A2U3TZN1_HUMAN
HCG2040106
SRP19 hCG_2040106
101Annotation score:
A0A2R8Y4M3A0A2R8Y4M3_HUMAN
Signal recognition particle 19 kDa ...
SRP19
77Annotation score:

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0278004A → T1 PublicationCorresponds to variant dbSNP:rs17855423Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04452415 – 144FICIY…GKKKK → LLKILQLQRFKMYVQQLDLT YFLRKIKCTLENGIVMSNTE AESGSSSNRKMGASALYSSH HVSQ in isoform 3. 1 PublicationAdd BLAST130
Alternative sequenceiVSP_042540101 – 144RKSVM…GKKKK → HYTLSLTSGS in isoform 2. 1 PublicationAdd BLAST44

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X12791 mRNA Translation: CAA31280.1
BU661702 mRNA No translation available.
AK311803 mRNA Translation: BAG34746.1
AC008536 Genomic DNA No translation available.
AC008575 Genomic DNA No translation available.
CH471086 Genomic DNA Translation: EAW48999.1
CH471086 Genomic DNA Translation: EAW49000.1
BC010947 mRNA Translation: AAH10947.1
BC017830 mRNA Translation: AAH17830.1
CCDSiCCDS4108.1 [P09132-1]
CCDS56375.1 [P09132-2]
CCDS56376.1 [P09132-3]
PIRiS01700
RefSeqiNP_001191122.1, NM_001204193.1 [P09132-2]
NP_001191123.1, NM_001204194.1
NP_001191125.1, NM_001204196.1 [P09132-3]
NP_003126.1, NM_003135.2 [P09132-1]
UniGeneiHs.637001

Genome annotation databases

EnsembliENST00000282999; ENSP00000282999; ENSG00000153037 [P09132-2]
ENST00000505459; ENSP00000424870; ENSG00000153037 [P09132-1]
ENST00000515463; ENSP00000425562; ENSG00000153037 [P09132-3]
GeneIDi6728
KEGGihsa:6728
UCSCiuc003kqb.3 human [P09132-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Web resourcesi

Wikipedia

Signal recognition particle entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X12791 mRNA Translation: CAA31280.1
BU661702 mRNA No translation available.
AK311803 mRNA Translation: BAG34746.1
AC008536 Genomic DNA No translation available.
AC008575 Genomic DNA No translation available.
CH471086 Genomic DNA Translation: EAW48999.1
CH471086 Genomic DNA Translation: EAW49000.1
BC010947 mRNA Translation: AAH10947.1
BC017830 mRNA Translation: AAH17830.1
CCDSiCCDS4108.1 [P09132-1]
CCDS56375.1 [P09132-2]
CCDS56376.1 [P09132-3]
PIRiS01700
RefSeqiNP_001191122.1, NM_001204193.1 [P09132-2]
NP_001191123.1, NM_001204194.1
NP_001191125.1, NM_001204196.1 [P09132-3]
NP_003126.1, NM_003135.2 [P09132-1]
UniGeneiHs.637001

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1JIDX-ray1.80A1-120[»]
1MFQX-ray3.10B14-120[»]
1RY1electron microscopy12.00B14-120[»]
2J37electron microscopy8.00B14-120[»]
3KTVX-ray3.80B/D1-120[»]
4P3EX-ray3.50B1-120[»]
5M73X-ray3.40B/F11-118[»]
DisProtiDP00570
ProteinModelPortaliP09132
SMRiP09132
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112606, 34 interactors
DIPiDIP-41412N
IntActiP09132, 15 interactors
MINTiP09132
STRINGi9606.ENSP00000424870

Protein family/group databases

TCDBi3.A.5.9.1 the general secretory pathway (sec) family

PTM databases

iPTMnetiP09132
PhosphoSitePlusiP09132

Polymorphism and mutation databases

BioMutaiSRP19
DMDMi115502457

Proteomic databases

EPDiP09132
MaxQBiP09132
PaxDbiP09132
PeptideAtlasiP09132
PRIDEiP09132
ProteomicsDBi52203
52204 [P09132-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000282999; ENSP00000282999; ENSG00000153037 [P09132-2]
ENST00000505459; ENSP00000424870; ENSG00000153037 [P09132-1]
ENST00000515463; ENSP00000425562; ENSG00000153037 [P09132-3]
GeneIDi6728
KEGGihsa:6728
UCSCiuc003kqb.3 human [P09132-1]

Organism-specific databases

CTDi6728
DisGeNETi6728
EuPathDBiHostDB:ENSG00000153037.13
GeneCardsiSRP19
HGNCiHGNC:11300 SRP19
HPAiHPA029272
MIMi182175 gene
neXtProtiNX_P09132
OpenTargetsiENSG00000153037
PharmGKBiPA36124
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3198 Eukaryota
COG1400 LUCA
GeneTreeiENSGT00390000004950
HOGENOMiHOG000237221
HOVERGENiHBG059463
InParanoidiP09132
KOiK03105
OMAiCVENPTH
OrthoDBiEOG091G0VWO
PhylomeDBiP09132
TreeFamiTF106248

Enzyme and pathway databases

ReactomeiR-HSA-1799339 SRP-dependent cotranslational protein targeting to membrane

Miscellaneous databases

ChiTaRSiSRP19 human
EvolutionaryTraceiP09132
GenomeRNAii6728
PROiPR:P09132
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000153037 Expressed in 87 organ(s), highest expression level in adenohypophysis
CleanExiHS_SRP19
ExpressionAtlasiP09132 baseline and differential
GenevisibleiP09132 HS

Family and domain databases

Gene3Di3.30.56.30, 1 hit
InterProiView protein in InterPro
IPR002778 Signal_recog_particle_SRP19
IPR036521 SRP19-like_sf
PANTHERiPTHR17453 PTHR17453, 1 hit
PfamiView protein in Pfam
PF01922 SRP19, 1 hit
SUPFAMiSSF69695 SSF69695, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiSRP19_HUMAN
AccessioniPrimary (citable) accession number: P09132
Secondary accession number(s): B2R4E9
, D6RCQ5, Q05D77, Q96FG6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 1, 1989
Last sequence update: October 3, 2006
Last modified: November 7, 2018
This is version 188 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again