Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Neuromedin-B

Gene

NMB

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Stimulates smooth muscle contraction in a manner similar to that of bombesin.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • hormone activity Source: ProtInc
  • neuromedin B receptor binding Source: Ensembl

GO - Biological processi

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-375276 Peptide ligand-binding receptors
R-HSA-416476 G alpha (q) signalling events

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P08949

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Neuromedin-B
Cleaved into the following 2 chains:
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NMB
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 15

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000197696.9

Human Gene Nomenclature Database

More...
HGNCi
HGNC:7842 NMB

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
162340 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P08949

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
4828

Open Targets

More...
OpenTargetsi
ENSG00000197696

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA31654

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
NMB

Domain mapping of disease mutations (DMDM)

More...
DMDMi
281185514

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 24Add BLAST24
<p>This subsection of the ‘PTM / Processing’ section describes the position and length of an active peptide in the mature protein.<p><a href='/help/peptide' target='_top'>More...</a></p>PeptideiPRO_000000301725 – 56Neuromedin-B-32Add BLAST32
PeptideiPRO_000000301847 – 56Neuromedin-B10
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes a propeptide, which is a part of a protein that is cleaved during maturation or activation. Once cleaved, a propeptide generally has no independent biological function.<p><a href='/help/propep' target='_top'>More...</a></p>PropeptideiPRO_000000301960 – 121Add BLAST62

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei56Methionine amide1 Publication1

Keywords - PTMi

Amidation, Cleavage on pair of basic residues

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P08949

PeptideAtlas

More...
PeptideAtlasi
P08949

PRoteomics IDEntifications database

More...
PRIDEi
P08949

ProteomicsDB human proteome resource

More...
ProteomicsDBi
52178
52179 [P08949-2]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
P08949-2 [P08949-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P08949

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P08949

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000197696 Expressed in 172 organ(s), highest expression level in adipose tissue of abdominal region

CleanEx database of gene expression profiles

More...
CleanExi
HS_NMB

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P08949 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB019302

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
BIRC2Q134905EBI-12302085,EBI-514538

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
110892, 17 interactors

Protein interaction database and analysis system

More...
IntActi
P08949, 2 interactors

Molecular INTeraction database

More...
MINTi
P08949

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000378089

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1121
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P08949

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P08949

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P08949

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IX9W Eukaryota
ENOG410Z1WN LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154470

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000063661

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG079570

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P08949

KEGG Orthology (KO)

More...
KOi
K05223

Identification of Orthologs from Complete Genome Data

More...
OMAi
CAHPGKV

Database of Orthologous Groups

More...
OrthoDBi
EOG091G145J

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P08949

TreeFam database of animal gene trees

More...
TreeFami
TF336860

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000874 Bombesin

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02044 Bombesin, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00257 BOMBESIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: P08949-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MARRAGGARM FGSLLLFALL AAGVAPLSWD LPEPRSRASK IRVHSRGNLW
60 70 80 90 100
ATGHFMGKKS LEPSSPSPLG TAPHTSLRDQ RLQLSHDLLG ILLLKKALGV
110 120
SLSRPAPQIQ YRRLLVQILQ K
Length:121
Mass (Da):13,252
Last modified:December 15, 2009 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i10E16BA4886F03FB
GO
Isoform 2 (identifier: P08949-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     111-121: YRRLLVQILQK → EAAGTNTAEMTPIMGQTQQRGLDCAHPGKVLNGTLLMAPSGCKS

Note: No experimental confirmation available.
Show »
Length:154
Mass (Da):16,309
Checksum:i3FFBCF2BB83E2D84
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti68 – 76PLGTAPHTS → HWGQLPTPP in AAA59934 (PubMed:2458345).Curated9

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_06036973P → T1 PublicationCorresponds to variant dbSNP:rs1051168Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_000548111 – 121YRRLLVQILQK → EAAGTNTAEMTPIMGQTQQR GLDCAHPGKVLNGTLLMAPS GCKS in isoform 2. 1 PublicationAdd BLAST11

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
M21551 mRNA Translation: AAA59934.1
AC048382 Genomic DNA No translation available.
BC007407 mRNA Translation: AAH07407.1
BC007431 mRNA Translation: AAH07431.1
BC008603 mRNA Translation: AAH08603.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS10332.1 [P08949-1]
CCDS42076.1 [P08949-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
A28945

NCBI Reference Sequences

More...
RefSeqi
NP_066563.2, NM_021077.3 [P08949-1]
NP_995580.1, NM_205858.1 [P08949-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.386470

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000360476; ENSP00000353664; ENSG00000197696 [P08949-1]
ENST00000394588; ENSP00000378089; ENSG00000197696 [P08949-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
4828

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:4828

UCSC genome browser

More...
UCSCi
uc002bkz.4 human [P08949-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M21551 mRNA Translation: AAA59934.1
AC048382 Genomic DNA No translation available.
BC007407 mRNA Translation: AAH07407.1
BC007431 mRNA Translation: AAH07431.1
BC008603 mRNA Translation: AAH08603.1
CCDSiCCDS10332.1 [P08949-1]
CCDS42076.1 [P08949-2]
PIRiA28945
RefSeqiNP_066563.2, NM_021077.3 [P08949-1]
NP_995580.1, NM_205858.1 [P08949-2]
UniGeneiHs.386470

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1C98NMR-A47-56[»]
1C9ANMR-A47-56[»]
ProteinModelPortaliP08949
SMRiP08949
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110892, 17 interactors
IntActiP08949, 2 interactors
MINTiP08949
STRINGi9606.ENSP00000378089

PTM databases

iPTMnetiP08949
PhosphoSitePlusiP08949

Polymorphism and mutation databases

BioMutaiNMB
DMDMi281185514

Proteomic databases

PaxDbiP08949
PeptideAtlasiP08949
PRIDEiP08949
ProteomicsDBi52178
52179 [P08949-2]
TopDownProteomicsiP08949-2 [P08949-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
4828
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000360476; ENSP00000353664; ENSG00000197696 [P08949-1]
ENST00000394588; ENSP00000378089; ENSG00000197696 [P08949-2]
GeneIDi4828
KEGGihsa:4828
UCSCiuc002bkz.4 human [P08949-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
4828
DisGeNETi4828
EuPathDBiHostDB:ENSG00000197696.9

GeneCards: human genes, protein and diseases

More...
GeneCardsi
NMB

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0202167
HGNCiHGNC:7842 NMB
HPAiCAB019302
MIMi162340 gene
neXtProtiNX_P08949
OpenTargetsiENSG00000197696
PharmGKBiPA31654

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IX9W Eukaryota
ENOG410Z1WN LUCA
GeneTreeiENSGT00940000154470
HOGENOMiHOG000063661
HOVERGENiHBG079570
InParanoidiP08949
KOiK05223
OMAiCAHPGKV
OrthoDBiEOG091G145J
PhylomeDBiP08949
TreeFamiTF336860

Enzyme and pathway databases

ReactomeiR-HSA-375276 Peptide ligand-binding receptors
R-HSA-416476 G alpha (q) signalling events
SIGNORiP08949

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
NMB human
EvolutionaryTraceiP08949

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
4828

Protein Ontology

More...
PROi
PR:P08949

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000197696 Expressed in 172 organ(s), highest expression level in adipose tissue of abdominal region
CleanExiHS_NMB
GenevisibleiP08949 HS

Family and domain databases

InterProiView protein in InterPro
IPR000874 Bombesin
PfamiView protein in Pfam
PF02044 Bombesin, 1 hit
PROSITEiView protein in PROSITE
PS00257 BOMBESIN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNMB_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P08949
Secondary accession number(s): Q96A06, Q96HH5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1988
Last sequence update: December 15, 2009
Last modified: December 5, 2018
This is version 174 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again