Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P08934 (KNG1_RAT)

Entry version 149 (02 Jun 2021)
Sequence version 1 (01 Nov 1988)
Previous versions | rss
Add a publicationFeedback
Protein

Kininogen-1

Gene

Kng1

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

1 Kininogens are inhibitors of thiol proteases; (2) HMW-kininogen plays an important role in blood coagulation by helping to position optimally prekallikrein and factor XI next to factor XII; (3) HMW-kininogen inhibits the thrombin- and plasmin-induced aggregation of thrombocytes; (4) the active peptide bradykinin that is released from HMW-kininogen shows a variety of physiological effects: (4A) influence in smooth muscle contraction, (4B) induction of hypotension, (4C) natriuresis and diuresis, (4D) decrease in blood glucose level, (4E) it is a mediator of inflammation and causes (4E1) increase in vascular permeability, (4E2) stimulation of nociceptors (4E3) release of other mediators of inflammation (e.g. prostaglandins), (4F) it has a cardioprotective effect (directly via bradykinin action, indirectly via endothelium-derived relaxing factor action); (5) LMW-kininogen inhibits the aggregation of thrombocytes; (6) LMW-kininogen is in contrast to HMW-kininogen not involved in blood clotting.

Miscellaneous

Rats express four types of kininogens: the classical HMW/LMW kininogens and two additional LMW-like kininogens: T-I and T-II.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionProtease inhibitor, Thiol protease inhibitor, Vasoactive, Vasodilator
Biological processBlood coagulation, Hemostasis, Inflammatory response

Protein family/group databases

MEROPS protease database

More...MEROPSi		I25.018

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Kininogen-1
Cleaved into the following 3 chains:
Kininogen-1 heavy chain
Bradykinin
Kininogen-1 light chain
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Kng1
Synonyms:Kng
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiRattus norvegicus (Rat)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10116 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Rattus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000002494 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Unplaced

Organism-specific databases

Rat genome database

More...RGDi		2980, Kng1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Secreted

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 18Add BLAST18
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000000669519 – 639Kininogen-1Add BLAST621
ChainiPRO_000000669619 – 380Kininogen-1 heavy chainAdd BLAST362
<p>This subsection of the 'PTM / Processing' section describes the position and length of an active peptide in the mature protein.<p><a href='/help/peptide' target='_top'>More...</a></p>PeptideiPRO_0000006697381 – 389Bradykinin9
ChainiPRO_0000006698390 – 639Kininogen-1 light chainAdd BLAST250

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi28 ↔ 609Interchain (between heavy and light chains)PROSITE-ProRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi82N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi83 ↔ 94PROSITE-ProRule annotation
Disulfide bondi107 ↔ 126PROSITE-ProRule annotation
Disulfide bondi142 ↔ 145PROSITE-ProRule annotation
Glycosylationi169N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi205N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi206 ↔ 218PROSITE-ProRule annotation
Disulfide bondi229 ↔ 248PROSITE-ProRule annotation
Disulfide bondi264 ↔ 267PROSITE-ProRule annotation
Glycosylationi294N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi328 ↔ 340PROSITE-ProRule annotation
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei332PhosphoserineBy similarity1
Disulfide bondi351 ↔ 370PROSITE-ProRule annotation
Glycosylationi529N-linked (GlcNAc...) asparagineSequence analysis1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Bradykinin is released from kininogen by plasma kallikrein.
Phosphorylated by FAM20C in the extracellular medium.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P08934

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P08934

PRoteomics IDEntifications database

More...PRIDEi		P08934

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		P08934, 5 sites

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P08934

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Plasma.

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

Protein interaction database and analysis system

More...IntActi		P08934, 1 interactor

STRING: functional protein association networks

More...STRINGi		10116.ENSRNOP00000065146

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P08934

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini28 – 132Cystatin kininogen-type 1PROSITE-ProRule annotationAdd BLAST105
Domaini151 – 254Cystatin kininogen-type 2PROSITE-ProRule annotationAdd BLAST104
Domaini273 – 376Cystatin kininogen-type 3PROSITE-ProRule annotationAdd BLAST104

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni438 – 462DisorderedSequence analysisAdd BLAST25
Regioni476 – 547DisorderedSequence analysisAdd BLAST72

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi438 – 459Basic residuesSequence analysisAdd BLAST22
Compositional biasi484 – 500Basic residuesSequence analysisAdd BLAST17
Compositional biasi501 – 516Basic and acidic residuesSequence analysisAdd BLAST16
Compositional biasi517 – 543Polar residuesSequence analysisAdd BLAST27

Keywords - Domaini

Repeat, Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502RYAC, Eukaryota

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P08934

Identification of Orthologs from Complete Genome Data

More...OMAi		DQGHGHQ

Family and domain databases

Conserved Domains Database

More...CDDi		cd00042, CY, 3 hits

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR000010, Cystatin_dom
IPR002395, Kininogen
IPR027358, Kininogen-type_cystatin_dom
IPR018073, Prot_inh_cystat_CS

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00031, Cystatin, 3 hits

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00334, KININOGEN

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00043, CY, 3 hits

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00287, CYSTATIN, 2 hits
PS51647, CYSTATIN_KININOGEN, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform HMW (identifier: P08934-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKLITILLLC SRLLPSLAQE EDAQEMDCND ESLFQAVDTA LKKYNAGLKS 
        60         70         80         90        100
GNQFVLYQVT EGTKKDGSKT FYSFKYQIKE GNCSVQSGFA WQDCDFKDAE 
       110        120        130        140        150
EAATGECTAT LEKRRNNKFS IATQICNITP GKGPIVTNEY HCLGCMHPIS 
       160        170        180        190        200
VDSPELGPVL KHAVEHFNNN TKHTHLFALG EVKSADRQVV AGMNYQIIYS 
       210        220        230        240        250
IVQTNCSKED FPSLHEDCVP LPSGDDGECK GNAFVDIHKT IAGFSDSCEF 
       260        270        280        290        300
YPGDDLFELL PEDCPGCPRN IPVDSPELKE ALGHSIAQLN AENNHTFYFK 
       310        320        330        340        350
IDTVKKATSQ VVAGTKYVIE FIARETKCSK ESNAELTADC ETKRLGQSLN 
       360        370        380        390        400
CNANVYMRPW ENKVVPTVKC KVLDMTSVIR RPPGFSPFRA PRVKKPKEST 
       410        420        430        440        450
TVSPSYIARV QEERDPGNEQ GPIHGHGWLH AKQIKNKNHQ GHKHGHGIGH 
       460        470        480        490        500
GHQKPHGLGH GHQLKLDDLK QQREDGYDHR HPVGHGHGQR HGHGHGHGHG 
       510        520        530        540        550
RDKHTNKDKN NVKHTDQRRA PLTSSSEDNT TSTQIQGRTE GFTLNPPLAQ 
       560        570        580        590        600
PAVISRGFQD SGFTEGVIAT TSPYDTETHD DLIPDIHVQP DSLSFKLISD 
       610        620        630 
FPEATSHKCP GRPWKPVSRK DPTIETTEFS DFDLLDALS
Length:639
Mass (Da):70,933
Last modified:November 1, 1988 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD3172DF94FF56AF5
GO
Isoform LMW (identifier: P08934-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     402-433: VSPSYIARVQEERDPGNEQGPIHGHGWLHAKQ → RLLNSCEYKGRLLKAGAGPAPERQAEASTVTP
     434-639: Missing.

Show »
Length:433
Mass (Da):47,891
Checksum:i6D584348595166ED
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti61E → K (PubMed:2413018).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_001265402 – 433VSPSY…LHAKQ → RLLNSCEYKGRLLKAGAGPA PERQAEASTVTP in isoform LMW. 2 PublicationsAdd BLAST32
Alternative sequenceiVSP_001266434 – 639Missing in isoform LMW. 2 PublicationsAdd BLAST206

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
L29428 mRNA Translation: AAA41486.1
M11884 mRNA Translation: AAA41487.1
M14369 Genomic DNA Translation: AAA41484.1
M14369 Genomic DNA Translation: AAA41485.1 Sequence problems.
M16455 Genomic DNA Translation: AAA41482.1

Protein sequence database of the Protein Information Resource

More...PIRi		A25486
A28055
C25486

NCBI Reference Sequences

More...RefSeqi		NP_036873.1, NM_012741.1 [P08934-1]

Genome annotation databases

Database of genes from NCBI RefSeq genomes

More...GeneIDi		25087

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		rno:25087

UCSC genome browser

More...UCSCi		RGD:2980, rat [P08934-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L29428 mRNA Translation: AAA41486.1
M11884 mRNA Translation: AAA41487.1
M14369 Genomic DNA Translation: AAA41484.1
M14369 Genomic DNA Translation: AAA41485.1 Sequence problems.
M16455 Genomic DNA Translation: AAA41482.1
PIRiA25486
A28055
C25486
RefSeqiNP_036873.1, NM_012741.1 [P08934-1]

3D structure databases

SMRiP08934
ModBaseiSearch...

Protein-protein interaction databases

IntActiP08934, 1 interactor
STRINGi10116.ENSRNOP00000065146

Protein family/group databases

MEROPSiI25.018

PTM databases

GlyGeniP08934, 5 sites
PhosphoSitePlusiP08934

Proteomic databases

jPOSTiP08934
PaxDbiP08934
PRIDEiP08934

Genome annotation databases

GeneIDi25087
KEGGirno:25087
UCSCiRGD:2980, rat [P08934-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		25087
RGDi2980, Kng1

Phylogenomic databases

eggNOGiENOG502RYAC, Eukaryota
InParanoidiP08934
OMAiDQGHGHQ

Miscellaneous databases

Protein Ontology

More...PROi		PR:P08934

Family and domain databases

CDDicd00042, CY, 3 hits
InterProiView protein in InterPro
IPR000010, Cystatin_dom
IPR002395, Kininogen
IPR027358, Kininogen-type_cystatin_dom
IPR018073, Prot_inh_cystat_CS
PfamiView protein in Pfam
PF00031, Cystatin, 3 hits
PRINTSiPR00334, KININOGEN
SMARTiView protein in SMART
SM00043, CY, 3 hits
PROSITEiView protein in PROSITE
PS00287, CYSTATIN, 2 hits
PS51647, CYSTATIN_KININOGEN, 3 hits

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiKNG1_RAT
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P08934
Secondary accession number(s): P08933
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1988
Last sequence update: November 1, 1988
Last modified: June 2, 2021
This is version 149 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again