UniProtKB - P08684 (CP3A4_HUMAN)
Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the 'basket' to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>
Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)
>sp|P08684|CP3A4_HUMAN Cytochrome P450 3A4 OS=Homo sapiens OX=9606 GN=CYP3A4 PE=1 SV=4 MALIPDLAMETWLLLAVSLVLLYLYGTHSHGLFKKLGIPGPTPLPFLGNILSYHKGFCMF DMECHKKYGKVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKSAISI AEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFGAYS MDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSITVFPFLIPILEVLNICV FPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSI IFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVV NETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFS KKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLG GLLQPEKPVVLKVESRDGTVSGACommunity curation ()Add a publicationFeedback
Cytochrome P450 3A4
CYP3A4
Annotation score:5 out of 5
<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>Select a section on the left to see content.
<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni
A cytochrome P450 monooxygenase involved in the metabolism of sterols, steroid hormones, retinoids and fatty acids (PubMed:10681376, PubMed:11093772, PubMed:11555828, PubMed:14559847, PubMed:12865317, PubMed:15373842, PubMed:15764715, PubMed:20702771, PubMed:19965576, PubMed:21490593, PubMed:21576599).
Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (NADPH--hemoprotein reductase). Catalyzes the hydroxylation of carbon-hydrogen bonds (PubMed:2732228, PubMed:14559847, PubMed:12865317, PubMed:15373842, PubMed:15764715, PubMed:21576599, PubMed:21490593).
Exhibits high catalytic activity for the formation of hydroxyestrogens from estrone (E1) and 17beta-estradiol (E2), namely 2-hydroxy E1 and E2, as well as D-ring hydroxylated E1 and E2 at the C-16 position (PubMed:11555828, PubMed:14559847, PubMed:12865317).
Plays a role in the metabolism of androgens, particularly in oxidative deactivation of testosterone (PubMed:2732228, PubMed:15373842, PubMed:15764715, PubMed:22773874).
Metabolizes testosterone to less biologically active 2beta- and 6beta-hydroxytestosterones (PubMed:2732228, PubMed:15373842, PubMed:15764715).
Contributes to the formation of hydroxycholesterols (oxysterols), particularly A-ring hydroxylated cholesterol at the C-4beta position, and side chain hydroxylated cholesterol at the C-25 position, likely contributing to cholesterol degradation and bile acid biosynthesis (PubMed:21576599).
Catalyzes bisallylic hydroxylation of polyunsaturated fatty acids (PUFA) (PubMed:9435160).
Catalyzes the epoxidation of double bonds of PUFA with a preference for the last double bond (PubMed:19965576).
Metabolizes endocannabinoid arachidonoylethanolamide (anandamide) to 8,9-, 11,12-, and 14,15-epoxyeicosatrienoic acid ethanolamides (EpETrE-EAs), potentially modulating endocannabinoid system signaling (PubMed:20702771).
Plays a role in the metabolism of retinoids. Displays high catalytic activity for oxidation of all-trans-retinol to all-trans-retinal, a rate-limiting step for the biosynthesis of all-trans-retinoic acid (atRA) (PubMed:10681376).
Further metabolizes atRA toward 4-hydroxyretinoate and may play a role in hepatic atRA clearance (PubMed:11093772).
Responsible for oxidative metabolism of xenobiotics. Acts as a 2-exo-monooxygenase for plant lipid 1,8-cineole (eucalyptol) (PubMed:11159812).
Metabolizes the majority of the administered drugs. Catalyzes sulfoxidation of the anthelmintics albendazole and fenbendazole (PubMed:10759686).
Hydroxylates antimalarial drug quinine (PubMed:8968357).
Acts as a 1,4-cineole 2-exo-monooxygenase (PubMed:11695850).
Also involved in vitamin D catabolism and calcium homeostasis. Catalyzes the inactivation of the active hormone calcitriol (1-alpha,25-dihydroxyvitamin D3) (PubMed:29461981).
19 Publications<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.12"Cytochrome P-450 hPCN3, a novel cytochrome P-450 IIIA gene product that is differentially expressed in adult human liver. cDNA and deduced amino acid sequence and distinct specificities of cDNA-expressed hPCN1 and hPCN3 for the metabolism of steroid hormones and cyclosporine."
Aoyama T., Yamano S., Waxman D.J., Lapenson D.P., Meyer U.A., Fischer V., Tyndale R., Inaba T., Kalow W., Gelboin H.V., Gonzalez F.J.
J. Biol. Chem. 264:10388-10395(1989) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, TISSUE SPECIFICITY. - Ref.15"Identification of human cytochrome P450 isoforms involved in the 3-hydroxylation of quinine by human live microsomes and nine recombinant human cytochromes P450."
Zhao X.J., Yokoyama H., Chiba K., Wanwimolruk S., Ishizaki T.
J. Pharmacol. Exp. Ther. 279:1327-1334(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES. - Ref.16"Cytochromes P450 with bisallylic hydroxylation activity on arachidonic and linoleic acids studied with human recombinant enzymes and with human and rat liver microsomes."
Bylund J., Kunz T., Valmsen K., Oliw E.H.
J. Pharmacol. Exp. Ther. 284:51-60(1998) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.17"Relative contribution of cytochromes P-450 and flavin-containing monooxygenases to the metabolism of albendazole by human liver microsomes."
Rawden H.C., Kokwaro G.O., Ward S.A., Edwards G.
Br. J. Clin. Pharmacol. 49:313-322(2000) [PubMed] [Europe PMC] [Abstract]Cited for: CATALYTIC ACTIVITY, FUNCTION AS ALBENDAZOLE SULFOXIDASE. - Ref.18"Biosynthesis of all-trans-retinoic acid from all-trans-retinol: catalysis of all-trans-retinol oxidation by human P-450 cytochromes."
Chen H., Howald W.N., Juchau M.R.
Drug Metab. Dispos. 28:315-322(2000) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PATHWAY. - Ref.19"Identification of human cytochrome P450s involved in the formation of all-trans-retinoic acid principal metabolites."
Marill J., Cresteil T., Lanotte M., Chabot G.G.
Mol. Pharmacol. 58:1341-1348(2000) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES. - Ref.20"Oxidation of 1,8-cineole, the monoterpene cyclic ether originated from eucalyptus polybractea, by cytochrome P450 3A enzymes in rat and human liver microsomes."
Miyazawa M., Shindo M., Shimada T.
Drug Metab. Dispos. 29:200-205(2001) [PubMed] [Europe PMC] [Abstract]Cited for: CATALYTIC ACTIVITY, FUNCTION AS 1,8-CINEOLE 2-EXO-MONOOXYGENASE. - Ref.21"Role of human cytochrome P450 1A1, 1A2, 1B1, and 3A4 in the 2-, 4-, and 16alpha-hydroxylation of 17beta-estradiol."
Badawi A.F., Cavalieri E.L., Rogan E.G.
Metabolism 50:1001-1003(2001) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY. - Ref.22"Roles of cytochrome P450 3A enzymes in the 2-hydroxylation of 1,4-cineole, a monoterpene cyclic ether, by rat and human liver microsomes."
Miyazawa M., Shindo M., Shimada T.
Xenobiotica 31:713-723(2001) [PubMed] [Europe PMC] [Abstract]Cited for: CATALYTIC ACTIVITY, FUNCTION AS 1,4-CINEOLE 2-EXO-MONOOXYGENASE, BIOPHYSICOCHEMICAL PROPERTIES. - Ref.24"Human cytochrome P450 3A7 has a distinct high catalytic activity for the 16alpha-hydroxylation of estrone but not 17beta-estradiol."
Lee A.J., Conney A.H., Zhu B.T.
Cancer Res. 63:6532-6536(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, ACTIVITY REGULATION. - Ref.25"Characterization of the oxidative metabolites of 17beta-estradiol and estrone formed by 15 selectively expressed human cytochrome p450 isoforms."
Lee A.J., Cai M.X., Thomas P.E., Conney A.H., Zhu B.T.
Endocrinology 144:3382-3398(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, ACTIVITY REGULATION, PATHWAY. - Ref.26"Testosterone 1 beta-hydroxylation by human cytochrome P450 3A4."
Krauser J.A., Voehler M., Tseng L.H., Schefer A.B., Godejohann M., Guengerich F.P.
Eur. J. Biochem. 271:3962-3969(2004) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES. - Ref.27"Characterization of testosterone 11 beta-hydroxylation catalyzed by human liver microsomal cytochromes P450."
Choi M.H., Skipper P.L., Wishnok J.S., Tannenbaum S.R.
Drug Metab. Dispos. 33:714-718(2005) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.32"Effects of a commonly occurring genetic polymorphism of human CYP3A4 (I118V) on the metabolism of anandamide."
Pratt-Hyatt M., Zhang H., Snider N.T., Hollenberg P.F.
Drug Metab. Dispos. 38:2075-2082(2010) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, CHARACTERIZATION OF VARIANT VAL-118. - Ref.33"Stereoselective epoxidation of the last double bond of polyunsaturated fatty acids by human cytochromes P450."
Lucas D., Goulitquer S., Marienhagen J., Fer M., Dreano Y., Schwaneberg U., Amet Y., Corcos L.
J. Lipid Res. 51:1125-1133(2010) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY. - Ref.34"Evaluation of 6beta-hydroxycortisol, 6beta-hydroxycortisone, and a combination of the two as endogenous probes for inhibition of CYP3A4 in vivo."
Peng C.C., Templeton I., Thummel K.E., Davis C., Kunze K.L., Isoherranen N.
Clin. Pharmacol. Ther. 89:888-895(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES. - Ref.35"Cholesterol 25-hydroxylation activity of CYP3A."
Honda A., Miyazaki T., Ikegami T., Iwamoto J., Maeda T., Hirayama T., Saito Y., Teramoto T., Matsuzaki Y.
J. Lipid Res. 52:1509-1516(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, SUBCELLULAR LOCATION, PATHWAY. - Ref.36"Oxidation of dihydrotestosterone by human cytochromes P450 19A1 and 3A4."
Cheng Q., Sohl C.D., Yoshimoto F.K., Guengerich F.P.
J. Biol. Chem. 287:29554-29567(2012) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.46"CYP3A4 mutation causes vitamin D-dependent rickets type 3."
Roizen J.D., Li D., O'Lear L., Javaid M.K., Shaw N.J., Ebeling P.R., Nguyen H.H., Rodda C.P., Thummel K.E., Thacher T.D., Hakonarson H., Levine M.A.
J. Clin. Invest. 128:1913-1918(2018) [PubMed] [Europe PMC] [Abstract]Cited for: VARIANT VDDR3 THR-301, CHARACTERIZATION OF VARIANT VDDR3 THR-301.
Miscellaneous
<p>Manually curated information which has been inferred by a curator based on his/her scientific knowledge or on the scientific content of an article.</p> <p><a href="/manual/evidences#ECO:0000305">More...</a></p> Manual assertion inferred by curator fromi
- Ref.23"Intergenic mRNA molecules resulting from trans-splicing."
Finta C., Zaphiropoulos P.G.
J. Biol. Chem. 277:5882-5890(2002) [PubMed] [Europe PMC] [Abstract]Cited for: TRANS-SPLICING.
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi
- an organic moleculeEC:1.14.14.1
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.12"Cytochrome P-450 hPCN3, a novel cytochrome P-450 IIIA gene product that is differentially expressed in adult human liver. cDNA and deduced amino acid sequence and distinct specificities of cDNA-expressed hPCN1 and hPCN3 for the metabolism of steroid hormones and cyclosporine."
Aoyama T., Yamano S., Waxman D.J., Lapenson D.P., Meyer U.A., Fischer V., Tyndale R., Inaba T., Kalow W., Gelboin H.V., Gonzalez F.J.
J. Biol. Chem. 264:10388-10395(1989) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, TISSUE SPECIFICITY. - Ref.16"Cytochromes P450 with bisallylic hydroxylation activity on arachidonic and linoleic acids studied with human recombinant enzymes and with human and rat liver microsomes."
Bylund J., Kunz T., Valmsen K., Oliw E.H.
J. Pharmacol. Exp. Ther. 284:51-60(1998) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.21"Role of human cytochrome P450 1A1, 1A2, 1B1, and 3A4 in the 2-, 4-, and 16alpha-hydroxylation of 17beta-estradiol."
Badawi A.F., Cavalieri E.L., Rogan E.G.
Metabolism 50:1001-1003(2001) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY. - Ref.25"Characterization of the oxidative metabolites of 17beta-estradiol and estrone formed by 15 selectively expressed human cytochrome p450 isoforms."
Lee A.J., Cai M.X., Thomas P.E., Conney A.H., Zhu B.T.
Endocrinology 144:3382-3398(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, ACTIVITY REGULATION, PATHWAY.
- Search proteins in UniProtKB for this EC number.
- See the description of this EC number in ENZYME.
- Search reactions for this EC number in Rhea.
Manual assertion based on experiment ini
- Ref.12"Cytochrome P-450 hPCN3, a novel cytochrome P-450 IIIA gene product that is differentially expressed in adult human liver. cDNA and deduced amino acid sequence and distinct specificities of cDNA-expressed hPCN1 and hPCN3 for the metabolism of steroid hormones and cyclosporine."
Aoyama T., Yamano S., Waxman D.J., Lapenson D.P., Meyer U.A., Fischer V., Tyndale R., Inaba T., Kalow W., Gelboin H.V., Gonzalez F.J.
J. Biol. Chem. 264:10388-10395(1989) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, TISSUE SPECIFICITY. - Ref.16"Cytochromes P450 with bisallylic hydroxylation activity on arachidonic and linoleic acids studied with human recombinant enzymes and with human and rat liver microsomes."
Bylund J., Kunz T., Valmsen K., Oliw E.H.
J. Pharmacol. Exp. Ther. 284:51-60(1998) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.21"Role of human cytochrome P450 1A1, 1A2, 1B1, and 3A4 in the 2-, 4-, and 16alpha-hydroxylation of 17beta-estradiol."
Badawi A.F., Cavalieri E.L., Rogan E.G.
Metabolism 50:1001-1003(2001) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY. - Ref.25"Characterization of the oxidative metabolites of 17beta-estradiol and estrone formed by 15 selectively expressed human cytochrome p450 isoforms."
Lee A.J., Cai M.X., Thomas P.E., Conney A.H., Zhu B.T.
Endocrinology 144:3382-3398(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, ACTIVITY REGULATION, PATHWAY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.12"Cytochrome P-450 hPCN3, a novel cytochrome P-450 IIIA gene product that is differentially expressed in adult human liver. cDNA and deduced amino acid sequence and distinct specificities of cDNA-expressed hPCN1 and hPCN3 for the metabolism of steroid hormones and cyclosporine."
Aoyama T., Yamano S., Waxman D.J., Lapenson D.P., Meyer U.A., Fischer V., Tyndale R., Inaba T., Kalow W., Gelboin H.V., Gonzalez F.J.
J. Biol. Chem. 264:10388-10395(1989) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, TISSUE SPECIFICITY. - Ref.16"Cytochromes P450 with bisallylic hydroxylation activity on arachidonic and linoleic acids studied with human recombinant enzymes and with human and rat liver microsomes."
Bylund J., Kunz T., Valmsen K., Oliw E.H.
J. Pharmacol. Exp. Ther. 284:51-60(1998) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.21"Role of human cytochrome P450 1A1, 1A2, 1B1, and 3A4 in the 2-, 4-, and 16alpha-hydroxylation of 17beta-estradiol."
Badawi A.F., Cavalieri E.L., Rogan E.G.
Metabolism 50:1001-1003(2001) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY. - Ref.25"Characterization of the oxidative metabolites of 17beta-estradiol and estrone formed by 15 selectively expressed human cytochrome p450 isoforms."
Lee A.J., Cai M.X., Thomas P.E., Conney A.H., Zhu B.T.
Endocrinology 144:3382-3398(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, ACTIVITY REGULATION, PATHWAY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
an organic molecule- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+O2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+reduced [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMNH2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=an alcohol- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+oxidized [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMN- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- 17β-estradiol
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.21"Role of human cytochrome P450 1A1, 1A2, 1B1, and 3A4 in the 2-, 4-, and 16alpha-hydroxylation of 17beta-estradiol."
Badawi A.F., Cavalieri E.L., Rogan E.G.
Metabolism 50:1001-1003(2001) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY. - Ref.25"Characterization of the oxidative metabolites of 17beta-estradiol and estrone formed by 15 selectively expressed human cytochrome p450 isoforms."
Lee A.J., Cai M.X., Thomas P.E., Conney A.H., Zhu B.T.
Endocrinology 144:3382-3398(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, ACTIVITY REGULATION, PATHWAY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.21"Role of human cytochrome P450 1A1, 1A2, 1B1, and 3A4 in the 2-, 4-, and 16alpha-hydroxylation of 17beta-estradiol."
Badawi A.F., Cavalieri E.L., Rogan E.G.
Metabolism 50:1001-1003(2001) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY. - Ref.25"Characterization of the oxidative metabolites of 17beta-estradiol and estrone formed by 15 selectively expressed human cytochrome p450 isoforms."
Lee A.J., Cai M.X., Thomas P.E., Conney A.H., Zhu B.T.
Endocrinology 144:3382-3398(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, ACTIVITY REGULATION, PATHWAY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
17β-estradiol- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+O2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+reduced [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMNH2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=2-hydroxy-17β-estradiol- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+oxidized [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMN- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- 17β-estradiol
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.25"Characterization of the oxidative metabolites of 17beta-estradiol and estrone formed by 15 selectively expressed human cytochrome p450 isoforms."
Lee A.J., Cai M.X., Thomas P.E., Conney A.H., Zhu B.T.
Endocrinology 144:3382-3398(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, ACTIVITY REGULATION, PATHWAY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.25"Characterization of the oxidative metabolites of 17beta-estradiol and estrone formed by 15 selectively expressed human cytochrome p450 isoforms."
Lee A.J., Cai M.X., Thomas P.E., Conney A.H., Zhu B.T.
Endocrinology 144:3382-3398(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, ACTIVITY REGULATION, PATHWAY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
17β-estradiol- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+O2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+reduced [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMNH2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=4-hydroxy-17β-estradiol- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+oxidized [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMN- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- 17β-estradiol
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.24"Human cytochrome P450 3A7 has a distinct high catalytic activity for the 16alpha-hydroxylation of estrone but not 17beta-estradiol."
Lee A.J., Conney A.H., Zhu B.T.
Cancer Res. 63:6532-6536(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, ACTIVITY REGULATION. - Ref.25"Characterization of the oxidative metabolites of 17beta-estradiol and estrone formed by 15 selectively expressed human cytochrome p450 isoforms."
Lee A.J., Cai M.X., Thomas P.E., Conney A.H., Zhu B.T.
Endocrinology 144:3382-3398(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, ACTIVITY REGULATION, PATHWAY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.24"Human cytochrome P450 3A7 has a distinct high catalytic activity for the 16alpha-hydroxylation of estrone but not 17beta-estradiol."
Lee A.J., Conney A.H., Zhu B.T.
Cancer Res. 63:6532-6536(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, ACTIVITY REGULATION. - Ref.25"Characterization of the oxidative metabolites of 17beta-estradiol and estrone formed by 15 selectively expressed human cytochrome p450 isoforms."
Lee A.J., Cai M.X., Thomas P.E., Conney A.H., Zhu B.T.
Endocrinology 144:3382-3398(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, ACTIVITY REGULATION, PATHWAY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
17β-estradiol- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+O2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+reduced [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMNH2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=16α,17β-estriol- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+oxidized [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMN- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- 17β-estradiol
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.25"Characterization of the oxidative metabolites of 17beta-estradiol and estrone formed by 15 selectively expressed human cytochrome p450 isoforms."
Lee A.J., Cai M.X., Thomas P.E., Conney A.H., Zhu B.T.
Endocrinology 144:3382-3398(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, ACTIVITY REGULATION, PATHWAY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.25"Characterization of the oxidative metabolites of 17beta-estradiol and estrone formed by 15 selectively expressed human cytochrome p450 isoforms."
Lee A.J., Cai M.X., Thomas P.E., Conney A.H., Zhu B.T.
Endocrinology 144:3382-3398(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, ACTIVITY REGULATION, PATHWAY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
17β-estradiol- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+O2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+reduced [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMNH2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=16β,17β-estriol- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+oxidized [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMN- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- estrone
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.25"Characterization of the oxidative metabolites of 17beta-estradiol and estrone formed by 15 selectively expressed human cytochrome p450 isoforms."
Lee A.J., Cai M.X., Thomas P.E., Conney A.H., Zhu B.T.
Endocrinology 144:3382-3398(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, ACTIVITY REGULATION, PATHWAY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.25"Characterization of the oxidative metabolites of 17beta-estradiol and estrone formed by 15 selectively expressed human cytochrome p450 isoforms."
Lee A.J., Cai M.X., Thomas P.E., Conney A.H., Zhu B.T.
Endocrinology 144:3382-3398(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, ACTIVITY REGULATION, PATHWAY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
estrone- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+O2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+reduced [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMNH2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=2-hydroxyestrone- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+oxidized [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMN- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- estrone
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.25"Characterization of the oxidative metabolites of 17beta-estradiol and estrone formed by 15 selectively expressed human cytochrome p450 isoforms."
Lee A.J., Cai M.X., Thomas P.E., Conney A.H., Zhu B.T.
Endocrinology 144:3382-3398(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, ACTIVITY REGULATION, PATHWAY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.25"Characterization of the oxidative metabolites of 17beta-estradiol and estrone formed by 15 selectively expressed human cytochrome p450 isoforms."
Lee A.J., Cai M.X., Thomas P.E., Conney A.H., Zhu B.T.
Endocrinology 144:3382-3398(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, ACTIVITY REGULATION, PATHWAY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
estrone- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+O2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+reduced [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMNH2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=4-hydroxyestrone- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+oxidized [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMN- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- estrone
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.24"Human cytochrome P450 3A7 has a distinct high catalytic activity for the 16alpha-hydroxylation of estrone but not 17beta-estradiol."
Lee A.J., Conney A.H., Zhu B.T.
Cancer Res. 63:6532-6536(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, ACTIVITY REGULATION. - Ref.25"Characterization of the oxidative metabolites of 17beta-estradiol and estrone formed by 15 selectively expressed human cytochrome p450 isoforms."
Lee A.J., Cai M.X., Thomas P.E., Conney A.H., Zhu B.T.
Endocrinology 144:3382-3398(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, ACTIVITY REGULATION, PATHWAY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.24"Human cytochrome P450 3A7 has a distinct high catalytic activity for the 16alpha-hydroxylation of estrone but not 17beta-estradiol."
Lee A.J., Conney A.H., Zhu B.T.
Cancer Res. 63:6532-6536(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, ACTIVITY REGULATION. - Ref.25"Characterization of the oxidative metabolites of 17beta-estradiol and estrone formed by 15 selectively expressed human cytochrome p450 isoforms."
Lee A.J., Cai M.X., Thomas P.E., Conney A.H., Zhu B.T.
Endocrinology 144:3382-3398(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, ACTIVITY REGULATION, PATHWAY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
estrone- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+O2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+reduced [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMNH2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=16α-hydroxyestrone- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+oxidized [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMN- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- O2
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.26"Testosterone 1 beta-hydroxylation by human cytochrome P450 3A4."
Krauser J.A., Voehler M., Tseng L.H., Schefer A.B., Godejohann M., Guengerich F.P.
Eur. J. Biochem. 271:3962-3969(2004) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.26"Testosterone 1 beta-hydroxylation by human cytochrome P450 3A4."
Krauser J.A., Voehler M., Tseng L.H., Schefer A.B., Godejohann M., Guengerich F.P.
Eur. J. Biochem. 271:3962-3969(2004) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
O2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+reduced [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMNH2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+testosterone- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
=1β-hydroxytestosterone- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+oxidized [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMN- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- O2
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.26"Testosterone 1 beta-hydroxylation by human cytochrome P450 3A4."
Krauser J.A., Voehler M., Tseng L.H., Schefer A.B., Godejohann M., Guengerich F.P.
Eur. J. Biochem. 271:3962-3969(2004) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.26"Testosterone 1 beta-hydroxylation by human cytochrome P450 3A4."
Krauser J.A., Voehler M., Tseng L.H., Schefer A.B., Godejohann M., Guengerich F.P.
Eur. J. Biochem. 271:3962-3969(2004) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
O2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+reduced [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMNH2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+testosterone- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
=2β-hydroxytestosterone- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+oxidized [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMN- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- O2
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.12"Cytochrome P-450 hPCN3, a novel cytochrome P-450 IIIA gene product that is differentially expressed in adult human liver. cDNA and deduced amino acid sequence and distinct specificities of cDNA-expressed hPCN1 and hPCN3 for the metabolism of steroid hormones and cyclosporine."
Aoyama T., Yamano S., Waxman D.J., Lapenson D.P., Meyer U.A., Fischer V., Tyndale R., Inaba T., Kalow W., Gelboin H.V., Gonzalez F.J.
J. Biol. Chem. 264:10388-10395(1989) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, TISSUE SPECIFICITY. - Ref.27"Characterization of testosterone 11 beta-hydroxylation catalyzed by human liver microsomal cytochromes P450."
Choi M.H., Skipper P.L., Wishnok J.S., Tannenbaum S.R.
Drug Metab. Dispos. 33:714-718(2005) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.32"Effects of a commonly occurring genetic polymorphism of human CYP3A4 (I118V) on the metabolism of anandamide."
Pratt-Hyatt M., Zhang H., Snider N.T., Hollenberg P.F.
Drug Metab. Dispos. 38:2075-2082(2010) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, CHARACTERIZATION OF VARIANT VAL-118.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.12"Cytochrome P-450 hPCN3, a novel cytochrome P-450 IIIA gene product that is differentially expressed in adult human liver. cDNA and deduced amino acid sequence and distinct specificities of cDNA-expressed hPCN1 and hPCN3 for the metabolism of steroid hormones and cyclosporine."
Aoyama T., Yamano S., Waxman D.J., Lapenson D.P., Meyer U.A., Fischer V., Tyndale R., Inaba T., Kalow W., Gelboin H.V., Gonzalez F.J.
J. Biol. Chem. 264:10388-10395(1989) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, TISSUE SPECIFICITY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
O2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+reduced [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMNH2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+testosterone- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
=6β,17β-dihydroxyandrost-4-en-3-one- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+oxidized [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMN- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- O2
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.27"Characterization of testosterone 11 beta-hydroxylation catalyzed by human liver microsomal cytochromes P450."
Choi M.H., Skipper P.L., Wishnok J.S., Tannenbaum S.R.
Drug Metab. Dispos. 33:714-718(2005) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.27"Characterization of testosterone 11 beta-hydroxylation catalyzed by human liver microsomal cytochromes P450."
Choi M.H., Skipper P.L., Wishnok J.S., Tannenbaum S.R.
Drug Metab. Dispos. 33:714-718(2005) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
O2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+reduced [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMNH2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+testosterone- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
=11β,17β-dihydroxyandrost-4-ene-3-one- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+oxidized [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMN- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- 17β-hydroxy-5α-androstan-3-one
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.36"Oxidation of dihydrotestosterone by human cytochromes P450 19A1 and 3A4."
Cheng Q., Sohl C.D., Yoshimoto F.K., Guengerich F.P.
J. Biol. Chem. 287:29554-29567(2012) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.36"Oxidation of dihydrotestosterone by human cytochromes P450 19A1 and 3A4."
Cheng Q., Sohl C.D., Yoshimoto F.K., Guengerich F.P.
J. Biol. Chem. 287:29554-29567(2012) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
17β-hydroxy-5α-androstan-3-one- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+O2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+reduced [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMNH2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=17β,18-dihydroxy-3-oxo-5α-androstanone- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+oxidized [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMN- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- 17β-hydroxy-5α-androstan-3-one
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.36"Oxidation of dihydrotestosterone by human cytochromes P450 19A1 and 3A4."
Cheng Q., Sohl C.D., Yoshimoto F.K., Guengerich F.P.
J. Biol. Chem. 287:29554-29567(2012) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.36"Oxidation of dihydrotestosterone by human cytochromes P450 19A1 and 3A4."
Cheng Q., Sohl C.D., Yoshimoto F.K., Guengerich F.P.
J. Biol. Chem. 287:29554-29567(2012) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
17β-hydroxy-5α-androstan-3-one- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+O2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+reduced [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMNH2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=17β,19-dihydroxy-3-oxo-5α-androstanone- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+oxidized [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMN- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- androst-4-ene-3,17-dione
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.12"Cytochrome P-450 hPCN3, a novel cytochrome P-450 IIIA gene product that is differentially expressed in adult human liver. cDNA and deduced amino acid sequence and distinct specificities of cDNA-expressed hPCN1 and hPCN3 for the metabolism of steroid hormones and cyclosporine."
Aoyama T., Yamano S., Waxman D.J., Lapenson D.P., Meyer U.A., Fischer V., Tyndale R., Inaba T., Kalow W., Gelboin H.V., Gonzalez F.J.
J. Biol. Chem. 264:10388-10395(1989) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, TISSUE SPECIFICITY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.12"Cytochrome P-450 hPCN3, a novel cytochrome P-450 IIIA gene product that is differentially expressed in adult human liver. cDNA and deduced amino acid sequence and distinct specificities of cDNA-expressed hPCN1 and hPCN3 for the metabolism of steroid hormones and cyclosporine."
Aoyama T., Yamano S., Waxman D.J., Lapenson D.P., Meyer U.A., Fischer V., Tyndale R., Inaba T., Kalow W., Gelboin H.V., Gonzalez F.J.
J. Biol. Chem. 264:10388-10395(1989) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, TISSUE SPECIFICITY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
androst-4-ene-3,17-dione- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+O2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+reduced [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMNH2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=6β-hydroxyandrost-4-ene-3,17-dione- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+oxidized [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMN- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- O2
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.12"Cytochrome P-450 hPCN3, a novel cytochrome P-450 IIIA gene product that is differentially expressed in adult human liver. cDNA and deduced amino acid sequence and distinct specificities of cDNA-expressed hPCN1 and hPCN3 for the metabolism of steroid hormones and cyclosporine."
Aoyama T., Yamano S., Waxman D.J., Lapenson D.P., Meyer U.A., Fischer V., Tyndale R., Inaba T., Kalow W., Gelboin H.V., Gonzalez F.J.
J. Biol. Chem. 264:10388-10395(1989) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, TISSUE SPECIFICITY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.12"Cytochrome P-450 hPCN3, a novel cytochrome P-450 IIIA gene product that is differentially expressed in adult human liver. cDNA and deduced amino acid sequence and distinct specificities of cDNA-expressed hPCN1 and hPCN3 for the metabolism of steroid hormones and cyclosporine."
Aoyama T., Yamano S., Waxman D.J., Lapenson D.P., Meyer U.A., Fischer V., Tyndale R., Inaba T., Kalow W., Gelboin H.V., Gonzalez F.J.
J. Biol. Chem. 264:10388-10395(1989) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, TISSUE SPECIFICITY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
O2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+progesterone- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+reduced [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMNH2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=6β-hydroxyprogesterone- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+oxidized [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMN- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- O2
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.12"Cytochrome P-450 hPCN3, a novel cytochrome P-450 IIIA gene product that is differentially expressed in adult human liver. cDNA and deduced amino acid sequence and distinct specificities of cDNA-expressed hPCN1 and hPCN3 for the metabolism of steroid hormones and cyclosporine."
Aoyama T., Yamano S., Waxman D.J., Lapenson D.P., Meyer U.A., Fischer V., Tyndale R., Inaba T., Kalow W., Gelboin H.V., Gonzalez F.J.
J. Biol. Chem. 264:10388-10395(1989) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, TISSUE SPECIFICITY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.12"Cytochrome P-450 hPCN3, a novel cytochrome P-450 IIIA gene product that is differentially expressed in adult human liver. cDNA and deduced amino acid sequence and distinct specificities of cDNA-expressed hPCN1 and hPCN3 for the metabolism of steroid hormones and cyclosporine."
Aoyama T., Yamano S., Waxman D.J., Lapenson D.P., Meyer U.A., Fischer V., Tyndale R., Inaba T., Kalow W., Gelboin H.V., Gonzalez F.J.
J. Biol. Chem. 264:10388-10395(1989) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, TISSUE SPECIFICITY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
O2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+progesterone- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+reduced [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMNH2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=16α-hydroxyprogesterone- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+oxidized [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMN- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- cortisone
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.34"Evaluation of 6beta-hydroxycortisol, 6beta-hydroxycortisone, and a combination of the two as endogenous probes for inhibition of CYP3A4 in vivo."
Peng C.C., Templeton I., Thummel K.E., Davis C., Kunze K.L., Isoherranen N.
Clin. Pharmacol. Ther. 89:888-895(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.34"Evaluation of 6beta-hydroxycortisol, 6beta-hydroxycortisone, and a combination of the two as endogenous probes for inhibition of CYP3A4 in vivo."
Peng C.C., Templeton I., Thummel K.E., Davis C., Kunze K.L., Isoherranen N.
Clin. Pharmacol. Ther. 89:888-895(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
cortisone- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+O2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+reduced [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMNH2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=6β-hydroxycortisone- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+oxidized [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMN- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- cortisol
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.34"Evaluation of 6beta-hydroxycortisol, 6beta-hydroxycortisone, and a combination of the two as endogenous probes for inhibition of CYP3A4 in vivo."
Peng C.C., Templeton I., Thummel K.E., Davis C., Kunze K.L., Isoherranen N.
Clin. Pharmacol. Ther. 89:888-895(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.34"Evaluation of 6beta-hydroxycortisol, 6beta-hydroxycortisone, and a combination of the two as endogenous probes for inhibition of CYP3A4 in vivo."
Peng C.C., Templeton I., Thummel K.E., Davis C., Kunze K.L., Isoherranen N.
Clin. Pharmacol. Ther. 89:888-895(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
cortisol- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+O2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+reduced [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMNH2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=6β-hydroxycortisol- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+oxidized [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMN- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- cholesterol
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.35"Cholesterol 25-hydroxylation activity of CYP3A."
Honda A., Miyazaki T., Ikegami T., Iwamoto J., Maeda T., Hirayama T., Saito Y., Teramoto T., Matsuzaki Y.
J. Lipid Res. 52:1509-1516(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, SUBCELLULAR LOCATION, PATHWAY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.35"Cholesterol 25-hydroxylation activity of CYP3A."
Honda A., Miyazaki T., Ikegami T., Iwamoto J., Maeda T., Hirayama T., Saito Y., Teramoto T., Matsuzaki Y.
J. Lipid Res. 52:1509-1516(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, SUBCELLULAR LOCATION, PATHWAY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
cholesterol- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+O2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+reduced [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMNH2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=25-hydroxycholesterol- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+oxidized [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMN- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- cholesterol
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.35"Cholesterol 25-hydroxylation activity of CYP3A."
Honda A., Miyazaki T., Ikegami T., Iwamoto J., Maeda T., Hirayama T., Saito Y., Teramoto T., Matsuzaki Y.
J. Lipid Res. 52:1509-1516(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, SUBCELLULAR LOCATION, PATHWAY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.35"Cholesterol 25-hydroxylation activity of CYP3A."
Honda A., Miyazaki T., Ikegami T., Iwamoto J., Maeda T., Hirayama T., Saito Y., Teramoto T., Matsuzaki Y.
J. Lipid Res. 52:1509-1516(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, SUBCELLULAR LOCATION, PATHWAY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
cholesterol- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+O2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+reduced [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMNH2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=4β-hydroxycholesterol- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+oxidized [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMN- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- cholesterol
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.35"Cholesterol 25-hydroxylation activity of CYP3A."
Honda A., Miyazaki T., Ikegami T., Iwamoto J., Maeda T., Hirayama T., Saito Y., Teramoto T., Matsuzaki Y.
J. Lipid Res. 52:1509-1516(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, SUBCELLULAR LOCATION, PATHWAY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.35"Cholesterol 25-hydroxylation activity of CYP3A."
Honda A., Miyazaki T., Ikegami T., Iwamoto J., Maeda T., Hirayama T., Saito Y., Teramoto T., Matsuzaki Y.
J. Lipid Res. 52:1509-1516(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, SUBCELLULAR LOCATION, PATHWAY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
cholesterol- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+O2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+reduced [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMNH2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=22R-hydroxycholesterol- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+oxidized [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMN- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- cholesterol
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.35"Cholesterol 25-hydroxylation activity of CYP3A."
Honda A., Miyazaki T., Ikegami T., Iwamoto J., Maeda T., Hirayama T., Saito Y., Teramoto T., Matsuzaki Y.
J. Lipid Res. 52:1509-1516(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, SUBCELLULAR LOCATION, PATHWAY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.35"Cholesterol 25-hydroxylation activity of CYP3A."
Honda A., Miyazaki T., Ikegami T., Iwamoto J., Maeda T., Hirayama T., Saito Y., Teramoto T., Matsuzaki Y.
J. Lipid Res. 52:1509-1516(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, SUBCELLULAR LOCATION, PATHWAY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
cholesterol- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+O2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+reduced [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMNH2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=(24R)-hydroxycholesterol- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+oxidized [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMN- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- cholesterol
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.35"Cholesterol 25-hydroxylation activity of CYP3A."
Honda A., Miyazaki T., Ikegami T., Iwamoto J., Maeda T., Hirayama T., Saito Y., Teramoto T., Matsuzaki Y.
J. Lipid Res. 52:1509-1516(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, SUBCELLULAR LOCATION, PATHWAY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.35"Cholesterol 25-hydroxylation activity of CYP3A."
Honda A., Miyazaki T., Ikegami T., Iwamoto J., Maeda T., Hirayama T., Saito Y., Teramoto T., Matsuzaki Y.
J. Lipid Res. 52:1509-1516(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, SUBCELLULAR LOCATION, PATHWAY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
cholesterol- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+O2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+reduced [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMNH2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=26-hydroxycholesterol- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+oxidized [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMN- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- (9Z,12Z)-octadecadienoate
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.16"Cytochromes P450 with bisallylic hydroxylation activity on arachidonic and linoleic acids studied with human recombinant enzymes and with human and rat liver microsomes."
Bylund J., Kunz T., Valmsen K., Oliw E.H.
J. Pharmacol. Exp. Ther. 284:51-60(1998) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.16"Cytochromes P450 with bisallylic hydroxylation activity on arachidonic and linoleic acids studied with human recombinant enzymes and with human and rat liver microsomes."
Bylund J., Kunz T., Valmsen K., Oliw E.H.
J. Pharmacol. Exp. Ther. 284:51-60(1998) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
(9Z,12Z)-octadecadienoate- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+O2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+reduced [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMNH2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=11-hydroxy-(9Z,12Z)-octadecadienoate- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+oxidized [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMN- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- (5Z,8Z,11Z,14Z)-eicosatetraenoate
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.16"Cytochromes P450 with bisallylic hydroxylation activity on arachidonic and linoleic acids studied with human recombinant enzymes and with human and rat liver microsomes."
Bylund J., Kunz T., Valmsen K., Oliw E.H.
J. Pharmacol. Exp. Ther. 284:51-60(1998) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.16"Cytochromes P450 with bisallylic hydroxylation activity on arachidonic and linoleic acids studied with human recombinant enzymes and with human and rat liver microsomes."
Bylund J., Kunz T., Valmsen K., Oliw E.H.
J. Pharmacol. Exp. Ther. 284:51-60(1998) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
(5Z,8Z,11Z,14Z)-eicosatetraenoate- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+O2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+reduced [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMNH2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=7-hydroxy-(5Z,8Z,11Z,14Z)-eicosatetraenoate- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+oxidized [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMN- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- (5Z,8Z,11Z,14Z)-eicosatetraenoate
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.16"Cytochromes P450 with bisallylic hydroxylation activity on arachidonic and linoleic acids studied with human recombinant enzymes and with human and rat liver microsomes."
Bylund J., Kunz T., Valmsen K., Oliw E.H.
J. Pharmacol. Exp. Ther. 284:51-60(1998) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.16"Cytochromes P450 with bisallylic hydroxylation activity on arachidonic and linoleic acids studied with human recombinant enzymes and with human and rat liver microsomes."
Bylund J., Kunz T., Valmsen K., Oliw E.H.
J. Pharmacol. Exp. Ther. 284:51-60(1998) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
(5Z,8Z,11Z,14Z)-eicosatetraenoate- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+O2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+reduced [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMNH2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=10-hydroxy-(5Z,8Z,11Z,14Z)-eicosatetraenoate- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+oxidized [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMN- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- (5Z,8Z,11Z,14Z)-eicosatetraenoate
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.16"Cytochromes P450 with bisallylic hydroxylation activity on arachidonic and linoleic acids studied with human recombinant enzymes and with human and rat liver microsomes."
Bylund J., Kunz T., Valmsen K., Oliw E.H.
J. Pharmacol. Exp. Ther. 284:51-60(1998) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.16"Cytochromes P450 with bisallylic hydroxylation activity on arachidonic and linoleic acids studied with human recombinant enzymes and with human and rat liver microsomes."
Bylund J., Kunz T., Valmsen K., Oliw E.H.
J. Pharmacol. Exp. Ther. 284:51-60(1998) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
(5Z,8Z,11Z,14Z)-eicosatetraenoate- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+O2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+reduced [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMNH2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=13-hydroxy-(5Z,8Z,11Z,14Z)-eicosatetraenoate- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+oxidized [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMN- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- (5Z,8Z,11Z,14Z)-eicosatetraenoate
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.33"Stereoselective epoxidation of the last double bond of polyunsaturated fatty acids by human cytochromes P450."
Lucas D., Goulitquer S., Marienhagen J., Fer M., Dreano Y., Schwaneberg U., Amet Y., Corcos L.
J. Lipid Res. 51:1125-1133(2010) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.33"Stereoselective epoxidation of the last double bond of polyunsaturated fatty acids by human cytochromes P450."
Lucas D., Goulitquer S., Marienhagen J., Fer M., Dreano Y., Schwaneberg U., Amet Y., Corcos L.
J. Lipid Res. 51:1125-1133(2010) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
(5Z,8Z,11Z,14Z)-eicosatetraenoate- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+O2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+reduced [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMNH2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=(14R,15S)-epoxy-(5Z,8Z,11Z)-eicosatrienoate- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+oxidized [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMN- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- (5Z,8Z,11Z,14Z)-eicosatetraenoate
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.33"Stereoselective epoxidation of the last double bond of polyunsaturated fatty acids by human cytochromes P450."
Lucas D., Goulitquer S., Marienhagen J., Fer M., Dreano Y., Schwaneberg U., Amet Y., Corcos L.
J. Lipid Res. 51:1125-1133(2010) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.33"Stereoselective epoxidation of the last double bond of polyunsaturated fatty acids by human cytochromes P450."
Lucas D., Goulitquer S., Marienhagen J., Fer M., Dreano Y., Schwaneberg U., Amet Y., Corcos L.
J. Lipid Res. 51:1125-1133(2010) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
(5Z,8Z,11Z,14Z)-eicosatetraenoate- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+O2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+reduced [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMNH2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=(14S,15R)-epoxy-(5Z,8Z,11Z)-eicosatrienoate- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+oxidized [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMN- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- (5Z,8Z,11Z,14Z,17Z)-eicosapentaenoate
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.33"Stereoselective epoxidation of the last double bond of polyunsaturated fatty acids by human cytochromes P450."
Lucas D., Goulitquer S., Marienhagen J., Fer M., Dreano Y., Schwaneberg U., Amet Y., Corcos L.
J. Lipid Res. 51:1125-1133(2010) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.33"Stereoselective epoxidation of the last double bond of polyunsaturated fatty acids by human cytochromes P450."
Lucas D., Goulitquer S., Marienhagen J., Fer M., Dreano Y., Schwaneberg U., Amet Y., Corcos L.
J. Lipid Res. 51:1125-1133(2010) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
(5Z,8Z,11Z,14Z,17Z)-eicosapentaenoate- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+O2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+reduced [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMNH2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=(17R,18S)-epoxy-(5Z,8Z,11Z,14Z)-eicosatetraenoate- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+oxidized [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMN- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- (4Z,7Z,10Z,13Z,16Z,19Z)-docosahexaenoate
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.33"Stereoselective epoxidation of the last double bond of polyunsaturated fatty acids by human cytochromes P450."
Lucas D., Goulitquer S., Marienhagen J., Fer M., Dreano Y., Schwaneberg U., Amet Y., Corcos L.
J. Lipid Res. 51:1125-1133(2010) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.33"Stereoselective epoxidation of the last double bond of polyunsaturated fatty acids by human cytochromes P450."
Lucas D., Goulitquer S., Marienhagen J., Fer M., Dreano Y., Schwaneberg U., Amet Y., Corcos L.
J. Lipid Res. 51:1125-1133(2010) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
(4Z,7Z,10Z,13Z,16Z,19Z)-docosahexaenoate- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+O2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+reduced [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMNH2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=(19R,20S)-epoxy-(4Z,7Z,10Z,13Z,16Z)-docosapentaenoate- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+oxidized [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMN- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- (4Z,7Z,10Z,13Z,16Z,19Z)-docosahexaenoate
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.33"Stereoselective epoxidation of the last double bond of polyunsaturated fatty acids by human cytochromes P450."
Lucas D., Goulitquer S., Marienhagen J., Fer M., Dreano Y., Schwaneberg U., Amet Y., Corcos L.
J. Lipid Res. 51:1125-1133(2010) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.33"Stereoselective epoxidation of the last double bond of polyunsaturated fatty acids by human cytochromes P450."
Lucas D., Goulitquer S., Marienhagen J., Fer M., Dreano Y., Schwaneberg U., Amet Y., Corcos L.
J. Lipid Res. 51:1125-1133(2010) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
(4Z,7Z,10Z,13Z,16Z,19Z)-docosahexaenoate- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+O2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+reduced [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMNH2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=(19S,20R)-epoxy-(4Z,7Z,10Z,13Z,16Z)-docosapentaenoate- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+oxidized [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMN- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- N-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-ethanolamine
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.32"Effects of a commonly occurring genetic polymorphism of human CYP3A4 (I118V) on the metabolism of anandamide."
Pratt-Hyatt M., Zhang H., Snider N.T., Hollenberg P.F.
Drug Metab. Dispos. 38:2075-2082(2010) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, CHARACTERIZATION OF VARIANT VAL-118.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.32"Effects of a commonly occurring genetic polymorphism of human CYP3A4 (I118V) on the metabolism of anandamide."
Pratt-Hyatt M., Zhang H., Snider N.T., Hollenberg P.F.
Drug Metab. Dispos. 38:2075-2082(2010) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, CHARACTERIZATION OF VARIANT VAL-118.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
N-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-ethanolamine- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+O2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+reduced [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMNH2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+N-(8,9-epoxy-5Z,11Z,14Z-eicosatrienoyl)-ethanolamine- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+oxidized [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMN- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- N-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-ethanolamine
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.32"Effects of a commonly occurring genetic polymorphism of human CYP3A4 (I118V) on the metabolism of anandamide."
Pratt-Hyatt M., Zhang H., Snider N.T., Hollenberg P.F.
Drug Metab. Dispos. 38:2075-2082(2010) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, CHARACTERIZATION OF VARIANT VAL-118.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.32"Effects of a commonly occurring genetic polymorphism of human CYP3A4 (I118V) on the metabolism of anandamide."
Pratt-Hyatt M., Zhang H., Snider N.T., Hollenberg P.F.
Drug Metab. Dispos. 38:2075-2082(2010) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, CHARACTERIZATION OF VARIANT VAL-118.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
N-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-ethanolamine- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+O2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+reduced [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMNH2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+N-(11,12-epoxy-5Z,8Z,14Z-eicosatrienoyl)-ethanolamine- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+oxidized [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMN- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- N-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-ethanolamine
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.32"Effects of a commonly occurring genetic polymorphism of human CYP3A4 (I118V) on the metabolism of anandamide."
Pratt-Hyatt M., Zhang H., Snider N.T., Hollenberg P.F.
Drug Metab. Dispos. 38:2075-2082(2010) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, CHARACTERIZATION OF VARIANT VAL-118.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.32"Effects of a commonly occurring genetic polymorphism of human CYP3A4 (I118V) on the metabolism of anandamide."
Pratt-Hyatt M., Zhang H., Snider N.T., Hollenberg P.F.
Drug Metab. Dispos. 38:2075-2082(2010) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, CHARACTERIZATION OF VARIANT VAL-118.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
N-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-ethanolamine- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+O2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+reduced [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMNH2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+N-(14,15-epoxy-5Z,8Z,11Z-eicosatrienoyl)-ethanolamine- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+oxidized [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMN- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- all-trans-retinol
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.18"Biosynthesis of all-trans-retinoic acid from all-trans-retinol: catalysis of all-trans-retinol oxidation by human P-450 cytochromes."
Chen H., Howald W.N., Juchau M.R.
Drug Metab. Dispos. 28:315-322(2000) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PATHWAY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.18"Biosynthesis of all-trans-retinoic acid from all-trans-retinol: catalysis of all-trans-retinol oxidation by human P-450 cytochromes."
Chen H., Howald W.N., Juchau M.R.
Drug Metab. Dispos. 28:315-322(2000) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PATHWAY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
all-trans-retinol- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+O2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+reduced [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMNH2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=all-trans-retinal- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+2H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+oxidized [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMN- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- all-trans-retinoate
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.19"Identification of human cytochrome P450s involved in the formation of all-trans-retinoic acid principal metabolites."
Marill J., Cresteil T., Lanotte M., Chabot G.G.
Mol. Pharmacol. 58:1341-1348(2000) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.19"Identification of human cytochrome P450s involved in the formation of all-trans-retinoic acid principal metabolites."
Marill J., Cresteil T., Lanotte M., Chabot G.G.
Mol. Pharmacol. 58:1341-1348(2000) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
all-trans-retinoate- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+O2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+reduced [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMNH2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=all-trans-4-hydroxyretinoate- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+oxidized [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMN- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- O2EC:1.14.14.55
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.15"Identification of human cytochrome P450 isoforms involved in the 3-hydroxylation of quinine by human live microsomes and nine recombinant human cytochromes P450."
Zhao X.J., Yokoyama H., Chiba K., Wanwimolruk S., Ishizaki T.
J. Pharmacol. Exp. Ther. 279:1327-1334(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES.
- Search proteins in UniProtKB for this EC number.
- See the description of this EC number in ENZYME.
- Search reactions for this EC number in Rhea.
Manual assertion based on experiment ini
- Ref.15"Identification of human cytochrome P450 isoforms involved in the 3-hydroxylation of quinine by human live microsomes and nine recombinant human cytochromes P450."
Zhao X.J., Yokoyama H., Chiba K., Wanwimolruk S., Ishizaki T.
J. Pharmacol. Exp. Ther. 279:1327-1334(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
O2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+quinine- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+reduced [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMNH2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=3-hydroxyquinine- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+oxidized [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMN- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- fenbendazoleEC:1.14.14.73
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.17"Relative contribution of cytochromes P-450 and flavin-containing monooxygenases to the metabolism of albendazole by human liver microsomes."
Rawden H.C., Kokwaro G.O., Ward S.A., Edwards G.
Br. J. Clin. Pharmacol. 49:313-322(2000) [PubMed] [Europe PMC] [Abstract]Cited for: CATALYTIC ACTIVITY, FUNCTION AS ALBENDAZOLE SULFOXIDASE.
- Search proteins in UniProtKB for this EC number.
- See the description of this EC number in ENZYME.
- Search reactions for this EC number in Rhea.
Manual assertion based on experiment ini
- Ref.17"Relative contribution of cytochromes P-450 and flavin-containing monooxygenases to the metabolism of albendazole by human liver microsomes."
Rawden H.C., Kokwaro G.O., Ward S.A., Edwards G.
Br. J. Clin. Pharmacol. 49:313-322(2000) [PubMed] [Europe PMC] [Abstract]Cited for: CATALYTIC ACTIVITY, FUNCTION AS ALBENDAZOLE SULFOXIDASE.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
fenbendazole- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+O2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+reduced [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMNH2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=fenbendazole S-oxide- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+oxidized [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMN- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- albendazoleEC:1.14.14.73
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.17"Relative contribution of cytochromes P-450 and flavin-containing monooxygenases to the metabolism of albendazole by human liver microsomes."
Rawden H.C., Kokwaro G.O., Ward S.A., Edwards G.
Br. J. Clin. Pharmacol. 49:313-322(2000) [PubMed] [Europe PMC] [Abstract]Cited for: CATALYTIC ACTIVITY, FUNCTION AS ALBENDAZOLE SULFOXIDASE.
- Search proteins in UniProtKB for this EC number.
- See the description of this EC number in ENZYME.
- Search reactions for this EC number in Rhea.
Manual assertion based on experiment ini
- Ref.17"Relative contribution of cytochromes P-450 and flavin-containing monooxygenases to the metabolism of albendazole by human liver microsomes."
Rawden H.C., Kokwaro G.O., Ward S.A., Edwards G.
Br. J. Clin. Pharmacol. 49:313-322(2000) [PubMed] [Europe PMC] [Abstract]Cited for: CATALYTIC ACTIVITY, FUNCTION AS ALBENDAZOLE SULFOXIDASE.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
albendazole- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+O2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+reduced [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMNH2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=albendazole S-oxide- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+oxidized [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMN- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- 1,8-cineoleEC:1.14.14.56
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.20"Oxidation of 1,8-cineole, the monoterpene cyclic ether originated from eucalyptus polybractea, by cytochrome P450 3A enzymes in rat and human liver microsomes."
Miyazawa M., Shindo M., Shimada T.
Drug Metab. Dispos. 29:200-205(2001) [PubMed] [Europe PMC] [Abstract]Cited for: CATALYTIC ACTIVITY, FUNCTION AS 1,8-CINEOLE 2-EXO-MONOOXYGENASE.
- Search proteins in UniProtKB for this EC number.
- See the description of this EC number in ENZYME.
- Search reactions for this EC number in Rhea.
Manual assertion based on experiment ini
- Ref.20"Oxidation of 1,8-cineole, the monoterpene cyclic ether originated from eucalyptus polybractea, by cytochrome P450 3A enzymes in rat and human liver microsomes."
Miyazawa M., Shindo M., Shimada T.
Drug Metab. Dispos. 29:200-205(2001) [PubMed] [Europe PMC] [Abstract]Cited for: CATALYTIC ACTIVITY, FUNCTION AS 1,8-CINEOLE 2-EXO-MONOOXYGENASE.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
1,8-cineole- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+O2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+reduced [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMNH2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=2-exo-hydroxy-1,8-cineole- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+oxidized [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMN- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- 1,4-cineole
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.22"Roles of cytochrome P450 3A enzymes in the 2-hydroxylation of 1,4-cineole, a monoterpene cyclic ether, by rat and human liver microsomes."
Miyazawa M., Shindo M., Shimada T.
Xenobiotica 31:713-723(2001) [PubMed] [Europe PMC] [Abstract]Cited for: CATALYTIC ACTIVITY, FUNCTION AS 1,4-CINEOLE 2-EXO-MONOOXYGENASE, BIOPHYSICOCHEMICAL PROPERTIES.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
1,4-cineole- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+O2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+reduced [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMNH2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=2-exo-hydroxy-1,4-cineole- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+oxidized [NADPH—hemoprotein reductase]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
FMN- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.39"The structure of human microsomal cytochrome P450 3A4 determined by X-ray crystallography to 2.05-A resolution."
Yano J.K., Wester M.R., Schoch G.A., Griffin K.J., Stout C.D., Johnson E.F.
J. Biol. Chem. 279:38091-38094(2004) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.05 ANGSTROMS) OF 22-503 IN COMPLEX WITH HEME. - Ref.40"Crystal structures of human cytochrome P450 3A4 bound to metyrapone and progesterone."
Williams P.A., Cosme J., Vinkovic D.M., Ward A., Angove H.C., Day P.J., Vonrhein C., Tickle I.J., Jhoti H.
Science 305:683-686(2004) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.65 ANGSTROMS) OF 25-503 IN COMPLEX WITH HEME AND PROGESTERONE.
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi
Manual assertion based on experiment ini
- Ref.24"Human cytochrome P450 3A7 has a distinct high catalytic activity for the 16alpha-hydroxylation of estrone but not 17beta-estradiol."
Lee A.J., Conney A.H., Zhu B.T.
Cancer Res. 63:6532-6536(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, ACTIVITY REGULATION. - Ref.25"Characterization of the oxidative metabolites of 17beta-estradiol and estrone formed by 15 selectively expressed human cytochrome p450 isoforms."
Lee A.J., Cai M.X., Thomas P.E., Conney A.H., Zhu B.T.
Endocrinology 144:3382-3398(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, ACTIVITY REGULATION, PATHWAY.
<p>This subsection of the 'Function' section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi
- KM=52.16 µM for 17beta-estradiol (2-hydroxylation)1 Publication
Manual assertion based on experiment ini
- Ref.25"Characterization of the oxidative metabolites of 17beta-estradiol and estrone formed by 15 selectively expressed human cytochrome p450 isoforms."
Lee A.J., Cai M.X., Thomas P.E., Conney A.H., Zhu B.T.
Endocrinology 144:3382-3398(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, ACTIVITY REGULATION, PATHWAY.
- KM=53.88 µM for 17beta-estradiol (4-hydroxylation)1 Publication
Manual assertion based on experiment ini
- Ref.25"Characterization of the oxidative metabolites of 17beta-estradiol and estrone formed by 15 selectively expressed human cytochrome p450 isoforms."
Lee A.J., Cai M.X., Thomas P.E., Conney A.H., Zhu B.T.
Endocrinology 144:3382-3398(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, ACTIVITY REGULATION, PATHWAY.
- KM=7.69 µM for estrone (2-hydroxylation)1 Publication
Manual assertion based on experiment ini
- Ref.25"Characterization of the oxidative metabolites of 17beta-estradiol and estrone formed by 15 selectively expressed human cytochrome p450 isoforms."
Lee A.J., Cai M.X., Thomas P.E., Conney A.H., Zhu B.T.
Endocrinology 144:3382-3398(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, ACTIVITY REGULATION, PATHWAY.
- KM=7.18 µM for estrone (4-hydroxylation)1 Publication
Manual assertion based on experiment ini
- Ref.25"Characterization of the oxidative metabolites of 17beta-estradiol and estrone formed by 15 selectively expressed human cytochrome p450 isoforms."
Lee A.J., Cai M.X., Thomas P.E., Conney A.H., Zhu B.T.
Endocrinology 144:3382-3398(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, ACTIVITY REGULATION, PATHWAY.
- KM=17 µM for testosterone (1beta-hydroxylation)1 Publication
Manual assertion based on experiment ini
- Ref.26"Testosterone 1 beta-hydroxylation by human cytochrome P450 3A4."
Krauser J.A., Voehler M., Tseng L.H., Schefer A.B., Godejohann M., Guengerich F.P.
Eur. J. Biochem. 271:3962-3969(2004) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES.
- KM=44 µM for testosterone (2beta-hydroxylation)1 Publication
Manual assertion based on experiment ini
- Ref.26"Testosterone 1 beta-hydroxylation by human cytochrome P450 3A4."
Krauser J.A., Voehler M., Tseng L.H., Schefer A.B., Godejohann M., Guengerich F.P.
Eur. J. Biochem. 271:3962-3969(2004) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES.
- KM=23 µM for testosterone (6beta-hydroxylation)1 Publication
Manual assertion based on experiment ini
- Ref.26"Testosterone 1 beta-hydroxylation by human cytochrome P450 3A4."
Krauser J.A., Voehler M., Tseng L.H., Schefer A.B., Godejohann M., Guengerich F.P.
Eur. J. Biochem. 271:3962-3969(2004) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES.
- KM=32 µM for testosterone (15beta-hydroxylation)1 Publication
Manual assertion based on experiment ini
- Ref.26"Testosterone 1 beta-hydroxylation by human cytochrome P450 3A4."
Krauser J.A., Voehler M., Tseng L.H., Schefer A.B., Godejohann M., Guengerich F.P.
Eur. J. Biochem. 271:3962-3969(2004) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES.
- KM=182 µM for cholesterol (25-hydroxylation)1 Publication
Manual assertion based on experiment ini
- Ref.35"Cholesterol 25-hydroxylation activity of CYP3A."
Honda A., Miyazaki T., Ikegami T., Iwamoto J., Maeda T., Hirayama T., Saito Y., Teramoto T., Matsuzaki Y.
J. Lipid Res. 52:1509-1516(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, SUBCELLULAR LOCATION, PATHWAY.
- KM=62 µM for cholesterol (4beta-hydroxylation)1 Publication
Manual assertion based on experiment ini
- Ref.35"Cholesterol 25-hydroxylation activity of CYP3A."
Honda A., Miyazaki T., Ikegami T., Iwamoto J., Maeda T., Hirayama T., Saito Y., Teramoto T., Matsuzaki Y.
J. Lipid Res. 52:1509-1516(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, SUBCELLULAR LOCATION, PATHWAY.
- KM=37 µM for cholesterol (22R-hydroxylation)1 Publication
Manual assertion based on experiment ini
- Ref.35"Cholesterol 25-hydroxylation activity of CYP3A."
Honda A., Miyazaki T., Ikegami T., Iwamoto J., Maeda T., Hirayama T., Saito Y., Teramoto T., Matsuzaki Y.
J. Lipid Res. 52:1509-1516(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, SUBCELLULAR LOCATION, PATHWAY.
- KM=161 µM for cholesterol (24R-hydroxylation)1 Publication
Manual assertion based on experiment ini
- Ref.35"Cholesterol 25-hydroxylation activity of CYP3A."
Honda A., Miyazaki T., Ikegami T., Iwamoto J., Maeda T., Hirayama T., Saito Y., Teramoto T., Matsuzaki Y.
J. Lipid Res. 52:1509-1516(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, SUBCELLULAR LOCATION, PATHWAY.
- KM=15 µM for cholesterol (24S-hydroxylation)1 Publication
Manual assertion based on experiment ini
- Ref.35"Cholesterol 25-hydroxylation activity of CYP3A."
Honda A., Miyazaki T., Ikegami T., Iwamoto J., Maeda T., Hirayama T., Saito Y., Teramoto T., Matsuzaki Y.
J. Lipid Res. 52:1509-1516(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, SUBCELLULAR LOCATION, PATHWAY.
- KM=80 µM for cholesterol (26-hydroxylation)1 Publication
Manual assertion based on experiment ini
- Ref.35"Cholesterol 25-hydroxylation activity of CYP3A."
Honda A., Miyazaki T., Ikegami T., Iwamoto J., Maeda T., Hirayama T., Saito Y., Teramoto T., Matsuzaki Y.
J. Lipid Res. 52:1509-1516(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, SUBCELLULAR LOCATION, PATHWAY.
- KM=118 µM for anandamide (epoxidation across positions 5 and 6)1 Publication
Manual assertion based on experiment ini
- Ref.32"Effects of a commonly occurring genetic polymorphism of human CYP3A4 (I118V) on the metabolism of anandamide."
Pratt-Hyatt M., Zhang H., Snider N.T., Hollenberg P.F.
Drug Metab. Dispos. 38:2075-2082(2010) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, CHARACTERIZATION OF VARIANT VAL-118.
- KM=48 µM for anandamide (epoxidation across positions 8 and 9)1 Publication
Manual assertion based on experiment ini
- Ref.32"Effects of a commonly occurring genetic polymorphism of human CYP3A4 (I118V) on the metabolism of anandamide."
Pratt-Hyatt M., Zhang H., Snider N.T., Hollenberg P.F.
Drug Metab. Dispos. 38:2075-2082(2010) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, CHARACTERIZATION OF VARIANT VAL-118.
- KM=118 µM for anandamide (epoxidation across positions 11 and 12)1 Publication
Manual assertion based on experiment ini
- Ref.32"Effects of a commonly occurring genetic polymorphism of human CYP3A4 (I118V) on the metabolism of anandamide."
Pratt-Hyatt M., Zhang H., Snider N.T., Hollenberg P.F.
Drug Metab. Dispos. 38:2075-2082(2010) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, CHARACTERIZATION OF VARIANT VAL-118.
- KM=80 µM for anandamide (epoxidation across positions 14 and 15)1 Publication
Manual assertion based on experiment ini
- Ref.32"Effects of a commonly occurring genetic polymorphism of human CYP3A4 (I118V) on the metabolism of anandamide."
Pratt-Hyatt M., Zhang H., Snider N.T., Hollenberg P.F.
Drug Metab. Dispos. 38:2075-2082(2010) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, CHARACTERIZATION OF VARIANT VAL-118.
- KM=25 µM for all-trans retinol1 Publication
Manual assertion based on experiment ini
- Ref.18"Biosynthesis of all-trans-retinoic acid from all-trans-retinol: catalysis of all-trans-retinol oxidation by human P-450 cytochromes."
Chen H., Howald W.N., Juchau M.R.
Drug Metab. Dispos. 28:315-322(2000) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PATHWAY.
- KM=34 µM for all-trans-retinoate (4-hydroxylation)1 Publication
Manual assertion based on experiment ini
- Ref.19"Identification of human cytochrome P450s involved in the formation of all-trans-retinoic acid principal metabolites."
Marill J., Cresteil T., Lanotte M., Chabot G.G.
Mol. Pharmacol. 58:1341-1348(2000) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES.
- KM=89 µM for cortisone (6beta-hydroxylation)1 Publication
Manual assertion based on experiment ini
- Ref.34"Evaluation of 6beta-hydroxycortisol, 6beta-hydroxycortisone, and a combination of the two as endogenous probes for inhibition of CYP3A4 in vivo."
Peng C.C., Templeton I., Thummel K.E., Davis C., Kunze K.L., Isoherranen N.
Clin. Pharmacol. Ther. 89:888-895(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES.
- KM=148 µM for cortisol (6beta-hydroxylation)1 Publication
Manual assertion based on experiment ini
- Ref.34"Evaluation of 6beta-hydroxycortisol, 6beta-hydroxycortisone, and a combination of the two as endogenous probes for inhibition of CYP3A4 in vivo."
Peng C.C., Templeton I., Thummel K.E., Davis C., Kunze K.L., Isoherranen N.
Clin. Pharmacol. Ther. 89:888-895(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES.
- KM=114.4 µM for quinine1 Publication
Manual assertion based on experiment ini
- Ref.15"Identification of human cytochrome P450 isoforms involved in the 3-hydroxylation of quinine by human live microsomes and nine recombinant human cytochromes P450."
Zhao X.J., Yokoyama H., Chiba K., Wanwimolruk S., Ishizaki T.
J. Pharmacol. Exp. Ther. 279:1327-1334(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES.
- KM=450 µM for 1,4-cineole1 Publication
Manual assertion based on experiment ini
- Ref.22"Roles of cytochrome P450 3A enzymes in the 2-hydroxylation of 1,4-cineole, a monoterpene cyclic ether, by rat and human liver microsomes."
Miyazawa M., Shindo M., Shimada T.
Xenobiotica 31:713-723(2001) [PubMed] [Europe PMC] [Abstract]Cited for: CATALYTIC ACTIVITY, FUNCTION AS 1,4-CINEOLE 2-EXO-MONOOXYGENASE, BIOPHYSICOCHEMICAL PROPERTIES.
- Vmax=1020 pmol/min/nmol enzyme toward 17beta-estradiol (2-hydroxylation)1 Publication
Manual assertion based on experiment ini
- Ref.25"Characterization of the oxidative metabolites of 17beta-estradiol and estrone formed by 15 selectively expressed human cytochrome p450 isoforms."
Lee A.J., Cai M.X., Thomas P.E., Conney A.H., Zhu B.T.
Endocrinology 144:3382-3398(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, ACTIVITY REGULATION, PATHWAY.
- Vmax=448.5 pmol/min/nmol enzyme toward 17beta-estradiol (4-hydroxylation)1 Publication
Manual assertion based on experiment ini
- Ref.25"Characterization of the oxidative metabolites of 17beta-estradiol and estrone formed by 15 selectively expressed human cytochrome p450 isoforms."
Lee A.J., Cai M.X., Thomas P.E., Conney A.H., Zhu B.T.
Endocrinology 144:3382-3398(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, ACTIVITY REGULATION, PATHWAY.
- Vmax=167.5 pmol/min/nmol enzyme toward estrone (2-hydroxylation)1 Publication
Manual assertion based on experiment ini
- Ref.25"Characterization of the oxidative metabolites of 17beta-estradiol and estrone formed by 15 selectively expressed human cytochrome p450 isoforms."
Lee A.J., Cai M.X., Thomas P.E., Conney A.H., Zhu B.T.
Endocrinology 144:3382-3398(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, ACTIVITY REGULATION, PATHWAY.
- Vmax=79.5 pmol/min/nmol enzyme toward estrone (4-hydroxylation)1 Publication
Manual assertion based on experiment ini
- Ref.25"Characterization of the oxidative metabolites of 17beta-estradiol and estrone formed by 15 selectively expressed human cytochrome p450 isoforms."
Lee A.J., Cai M.X., Thomas P.E., Conney A.H., Zhu B.T.
Endocrinology 144:3382-3398(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, ACTIVITY REGULATION, PATHWAY.
- Vmax=42 pmol/min/nmol enzyme toward cholesterol (25-hydroxylation)1 Publication
Manual assertion based on experiment ini
- Ref.35"Cholesterol 25-hydroxylation activity of CYP3A."
Honda A., Miyazaki T., Ikegami T., Iwamoto J., Maeda T., Hirayama T., Saito Y., Teramoto T., Matsuzaki Y.
J. Lipid Res. 52:1509-1516(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, SUBCELLULAR LOCATION, PATHWAY.
- Vmax=12 pmol/min/nmol enzyme toward cholesterol (4beta-hydroxylation)1 Publication
Manual assertion based on experiment ini
- Ref.35"Cholesterol 25-hydroxylation activity of CYP3A."
Honda A., Miyazaki T., Ikegami T., Iwamoto J., Maeda T., Hirayama T., Saito Y., Teramoto T., Matsuzaki Y.
J. Lipid Res. 52:1509-1516(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, SUBCELLULAR LOCATION, PATHWAY.
- Vmax=3.42 pmol/min/nmol enzyme toward cholesterol (22R-hydroxylation)1 Publication
Manual assertion based on experiment ini
- Ref.35"Cholesterol 25-hydroxylation activity of CYP3A."
Honda A., Miyazaki T., Ikegami T., Iwamoto J., Maeda T., Hirayama T., Saito Y., Teramoto T., Matsuzaki Y.
J. Lipid Res. 52:1509-1516(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, SUBCELLULAR LOCATION, PATHWAY.
- Vmax=3.48 pmol/min/nmol enzyme toward cholesterol (24R-hydroxylation)1 Publication
Manual assertion based on experiment ini
- Ref.35"Cholesterol 25-hydroxylation activity of CYP3A."
Honda A., Miyazaki T., Ikegami T., Iwamoto J., Maeda T., Hirayama T., Saito Y., Teramoto T., Matsuzaki Y.
J. Lipid Res. 52:1509-1516(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, SUBCELLULAR LOCATION, PATHWAY.
- Vmax=0.2 pmol/min/nmol enzyme toward cholesterol (24S-hydroxylation)1 Publication
Manual assertion based on experiment ini
- Ref.35"Cholesterol 25-hydroxylation activity of CYP3A."
Honda A., Miyazaki T., Ikegami T., Iwamoto J., Maeda T., Hirayama T., Saito Y., Teramoto T., Matsuzaki Y.
J. Lipid Res. 52:1509-1516(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, SUBCELLULAR LOCATION, PATHWAY.
- Vmax=3.18 pmol/min/nmol enzyme toward cholesterol (26-hydroxylation)1 Publication
Manual assertion based on experiment ini
- Ref.35"Cholesterol 25-hydroxylation activity of CYP3A."
Honda A., Miyazaki T., Ikegami T., Iwamoto J., Maeda T., Hirayama T., Saito Y., Teramoto T., Matsuzaki Y.
J. Lipid Res. 52:1509-1516(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, SUBCELLULAR LOCATION, PATHWAY.
- Vmax=225 pmol/min/nmol enzyme toward all-trans retinol1 Publication
Manual assertion based on experiment ini
- Ref.18"Biosynthesis of all-trans-retinoic acid from all-trans-retinol: catalysis of all-trans-retinol oxidation by human P-450 cytochromes."
Chen H., Howald W.N., Juchau M.R.
Drug Metab. Dispos. 28:315-322(2000) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PATHWAY.
- Vmax=195 pmol/min/nmol enzyme toward all-trans-retinoate (4-hydroxylation)1 Publication
Manual assertion based on experiment ini
- Ref.19"Identification of human cytochrome P450s involved in the formation of all-trans-retinoic acid principal metabolites."
Marill J., Cresteil T., Lanotte M., Chabot G.G.
Mol. Pharmacol. 58:1341-1348(2000) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES.
- Vmax=15 pmol/min/pmol enzyme toward cortisone (6beta-hydroxylation)1 Publication
Manual assertion based on experiment ini
- Ref.34"Evaluation of 6beta-hydroxycortisol, 6beta-hydroxycortisone, and a combination of the two as endogenous probes for inhibition of CYP3A4 in vivo."
Peng C.C., Templeton I., Thummel K.E., Davis C., Kunze K.L., Isoherranen N.
Clin. Pharmacol. Ther. 89:888-895(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES.
- Vmax=27 pmol/min/pmol enzyme toward cortisol (6beta-hydroxylation)1 Publication
Manual assertion based on experiment ini
- Ref.34"Evaluation of 6beta-hydroxycortisol, 6beta-hydroxycortisone, and a combination of the two as endogenous probes for inhibition of CYP3A4 in vivo."
Peng C.C., Templeton I., Thummel K.E., Davis C., Kunze K.L., Isoherranen N.
Clin. Pharmacol. Ther. 89:888-895(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES.
- Vmax=7.49 pmol/min/pmol enzyme toward quinine1 Publication
Manual assertion based on experiment ini
- Ref.15"Identification of human cytochrome P450 isoforms involved in the 3-hydroxylation of quinine by human live microsomes and nine recombinant human cytochromes P450."
Zhao X.J., Yokoyama H., Chiba K., Wanwimolruk S., Ishizaki T.
J. Pharmacol. Exp. Ther. 279:1327-1334(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES.
- Vmax=7.5 nmol/min/nmol enzyme toward 1,4-cineole1 Publication
Manual assertion based on experiment ini
- Ref.22"Roles of cytochrome P450 3A enzymes in the 2-hydroxylation of 1,4-cineole, a monoterpene cyclic ether, by rat and human liver microsomes."
Miyazawa M., Shindo M., Shimada T.
Xenobiotica 31:713-723(2001) [PubMed] [Europe PMC] [Abstract]Cited for: CATALYTIC ACTIVITY, FUNCTION AS 1,4-CINEOLE 2-EXO-MONOOXYGENASE, BIOPHYSICOCHEMICAL PROPERTIES.
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: Steroid hormone biosynthesis
This protein is involved in Steroid hormone biosynthesis.2 PublicationsManual assertion based on experiment ini
- Ref.21"Role of human cytochrome P450 1A1, 1A2, 1B1, and 3A4 in the 2-, 4-, and 16alpha-hydroxylation of 17beta-estradiol."
Badawi A.F., Cavalieri E.L., Rogan E.G.
Metabolism 50:1001-1003(2001) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY. - Ref.25"Characterization of the oxidative metabolites of 17beta-estradiol and estrone formed by 15 selectively expressed human cytochrome p450 isoforms."
Lee A.J., Cai M.X., Thomas P.E., Conney A.H., Zhu B.T.
Endocrinology 144:3382-3398(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, ACTIVITY REGULATION, PATHWAY.
View all proteins of this organism that are known to be involved in Steroid hormone biosynthesis.
Pathwayi: retinol metabolism
This protein is involved in the pathway retinol metabolism, which is part of Cofactor metabolism.1 PublicationManual assertion based on experiment ini
- Ref.18"Biosynthesis of all-trans-retinoic acid from all-trans-retinol: catalysis of all-trans-retinol oxidation by human P-450 cytochromes."
Chen H., Howald W.N., Juchau M.R.
Drug Metab. Dispos. 28:315-322(2000) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PATHWAY.
View all proteins of this organism that are known to be involved in the pathway retinol metabolism and in Cofactor metabolism.
Pathwayi: cholesterol metabolism
This protein is involved in the pathway cholesterol metabolism, which is part of Steroid metabolism.1 PublicationManual assertion based on experiment ini
- Ref.35"Cholesterol 25-hydroxylation activity of CYP3A."
Honda A., Miyazaki T., Ikegami T., Iwamoto J., Maeda T., Hirayama T., Saito Y., Teramoto T., Matsuzaki Y.
J. Lipid Res. 52:1509-1516(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, SUBCELLULAR LOCATION, PATHWAY.
View all proteins of this organism that are known to be involved in the pathway cholesterol metabolism and in Steroid metabolism.
Pathwayi: fatty acid metabolism
This protein is involved in the pathway fatty acid metabolism, which is part of Lipid metabolism.1 PublicationManual assertion based on experiment ini
- Ref.33"Stereoselective epoxidation of the last double bond of polyunsaturated fatty acids by human cytochromes P450."
Lucas D., Goulitquer S., Marienhagen J., Fer M., Dreano Y., Schwaneberg U., Amet Y., Corcos L.
J. Lipid Res. 51:1125-1133(2010) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY.
View all proteins of this organism that are known to be involved in the pathway fatty acid metabolism and in Lipid metabolism.
Sites
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi | 442 | Iron (heme axial ligand)Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0007744">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 1 |
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni
- 1,8-cineole 2-exo-monooxygenase activity Source: UniProtKB-EC
- 1-alpha,25-dihydroxyvitamin D3 23-hydroxylase activity Source: UniProtKB
<p>Inferred from Direct Assay</p>
<p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p>
<p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p>
Inferred from direct assayi
- Ref.46"CYP3A4 mutation causes vitamin D-dependent rickets type 3."
Roizen J.D., Li D., O'Lear L., Javaid M.K., Shaw N.J., Ebeling P.R., Nguyen H.H., Rodda C.P., Thummel K.E., Thacher T.D., Hakonarson H., Levine M.A.
J. Clin. Invest. 128:1913-1918(2018) [PubMed] [Europe PMC] [Abstract]Cited for: VARIANT VDDR3 THR-301, CHARACTERIZATION OF VARIANT VDDR3 THR-301.
- anandamide 11,12 epoxidase activity Source: RHEA
- anandamide 14,15 epoxidase activity Source: RHEA
- anandamide 8,9 epoxidase activity Source: RHEA
- aromatase activity Source: UniProtKB-EC
- caffeine oxidase activity Source: BHF-UCLInferred from direct assayi
- "The relative contribution of human cytochrome P450 isoforms to the four caffeine oxidation pathways: an in vitro comparative study with cDNA-expressed P450s including CYP2C isoforms."
Kot M., Daniel W.A.
Biochem Pharmacol 76:543-551(2008) [PubMed] [Europe PMC] [Abstract]
- enzyme binding Source: BHF-UCL
<p>Inferred from Physical Interaction</p>
<p>Covers physical interactions between the gene product of interest and another molecule (or ion, or complex).</p>
<p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ipi">GO evidence code guide</a></p>
Inferred from physical interactioni
- "Interactions of mammalian cytochrome P450, NADPH-cytochrome P450 reductase, and cytochrome b(5) enzymes."
Shimada T., Mernaugh R.L., Guengerich F.P.
Arch Biochem Biophys 435:207-216(2005) [PubMed] [Europe PMC] [Abstract]
- estrogen 16-alpha-hydroxylase activity Source: UniProtKBInferred from direct assayi
- Ref.21"Role of human cytochrome P450 1A1, 1A2, 1B1, and 3A4 in the 2-, 4-, and 16alpha-hydroxylation of 17beta-estradiol."
Badawi A.F., Cavalieri E.L., Rogan E.G.
Metabolism 50:1001-1003(2001) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY.
- estrogen 2-hydroxylase activity Source: UniProtKBInferred from direct assayi
- Ref.25"Characterization of the oxidative metabolites of 17beta-estradiol and estrone formed by 15 selectively expressed human cytochrome p450 isoforms."
Lee A.J., Cai M.X., Thomas P.E., Conney A.H., Zhu B.T.
Endocrinology 144:3382-3398(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, ACTIVITY REGULATION, PATHWAY.
- heme binding Source: InterPro
- iron ion binding Source: BHF-UCLInferred from direct assayi
- Ref.40"Crystal structures of human cytochrome P450 3A4 bound to metyrapone and progesterone."
Williams P.A., Cosme J., Vinkovic D.M., Ward A., Angove H.C., Day P.J., Vonrhein C., Tickle I.J., Jhoti H.
Science 305:683-686(2004) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.65 ANGSTROMS) OF 25-503 IN COMPLEX WITH HEME AND PROGESTERONE.
- monooxygenase activity Source: BHF-UCLInferred from direct assayi
- "Characterization of human cytochrome P450 enzymes catalyzing domperidone N-dealkylation and hydroxylation in vitro."
Ward B.A., Morocho A., Kandil A., Galinsky R.E., Flockhart D.A., Desta Z.
Br J Clin Pharmacol 58:277-287(2004) [PubMed] [Europe PMC] [Abstract]
- oxidoreductase activity Source: BHF-UCLInferred from direct assayi
- "Quantitative contribution of CYP2D6 and CYP3A to oxycodone metabolism in human liver and intestinal microsomes."
Lalovic B., Phillips B., Risler L.L., Howald W., Shen D.D.
Drug Metab Dispos 32:447-454(2004) [PubMed] [Europe PMC] [Abstract] - "Radical intermediates in the catalytic oxidation of hydrocarbons by bacterial and human cytochrome P450 enzymes."
Jiang Y., He X., Ortiz de Montellano P.R.
Biochemistry 45:533-542(2006) [PubMed] [Europe PMC] [Abstract] - "Acetaminophen bioactivation by human cytochrome P450 enzymes and animal microsomes."
Laine J.E., Auriola S., Pasanen M., Juvonen R.O.
Xenobiotica 39:11-21(2009) [PubMed] [Europe PMC] [Abstract]
- oxygen binding Source: ProtInc
<p>Traceable Author Statement</p>
<p>Used for information from review articles where the original experiments are traceable through that article and also for information from text books or dictionaries.</p>
<p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#tas">GO evidence code guide</a></p>
Traceable author statementi
- "Evidence for cytochrome P-450NF, the nifedipine oxidase, being the principal enzyme involved in the bioactivation of aflatoxins in human liver."
Shimada T., Guengerich F.P.
Proc Natl Acad Sci U S A 86:462-465(1989) [PubMed] [Europe PMC] [Abstract] - Ref.1"Complete cDNA sequence of a cytochrome P-450 inducible by glucocorticoids in human liver."
Molowa D.T., Schuetz E.G., Wrighton S.A., Watkins P.B., Kremers P., Mendez-Picon G., Parker G.A., Guzelian P.S.
Proc. Natl. Acad. Sci. U.S.A. 83:5311-5315(1986) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], VARIANT ALA-252.
- quinine 3-monooxygenase activity Source: UniProtKB-EC
- retinoic acid 4-hydroxylase activity Source: UniProtKBInferred from direct assayi
- Ref.19"Identification of human cytochrome P450s involved in the formation of all-trans-retinoic acid principal metabolites."
Marill J., Cresteil T., Lanotte M., Chabot G.G.
Mol. Pharmacol. 58:1341-1348(2000) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES.
- steroid binding Source: BHF-UCLInferred from direct assayi
- Ref.40"Crystal structures of human cytochrome P450 3A4 bound to metyrapone and progesterone."
Williams P.A., Cosme J., Vinkovic D.M., Ward A., Angove H.C., Day P.J., Vonrhein C., Tickle I.J., Jhoti H.
Science 305:683-686(2004) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.65 ANGSTROMS) OF 25-503 IN COMPLEX WITH HEME AND PROGESTERONE.
- steroid hydroxylase activity Source: BHF-UCL
<p>Inferred from Mutant Phenotype</p>
<p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p>
<p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p>
Inferred from mutant phenotypei
- "Identification of the human cytochrome P450 enzymes involved in the in vitro biotransformation of lynestrenol and norethindrone."
Korhonen T., Turpeinen M., Tolonen A., Laine K., Pelkonen O.
J Steroid Biochem Mol Biol 110:56-66(2008) [PubMed] [Europe PMC] [Abstract]
- testosterone 6-beta-hydroxylase activity Source: BHF-UCLInferred from mutant phenotypei
- "Human liver microsomal steroid metabolism: identification of the major microsomal steroid hormone 6 beta-hydroxylase cytochrome P-450 enzyme."
Waxman D.J., Attisano C., Guengerich F.P., Lapenson D.P.
Arch Biochem Biophys 263:424-436(1988) [PubMed] [Europe PMC] [Abstract]
- vitamin D 24-hydroxylase activity Source: BHF-UCLInferred from direct assayi
- "CYP3A4 is a vitamin D-24- and 25-hydroxylase: analysis of structure function by site-directed mutagenesis."
Gupta R.P., He Y.A., Patrick K.S., Halpert J.R., Bell N.H.
J Clin Endocrinol Metab 90:1210-1219(2005) [PubMed] [Europe PMC] [Abstract]
- vitamin D3 25-hydroxylase activity Source: BHF-UCLInferred from direct assayi
- "CYP3A4 is a vitamin D-24- and 25-hydroxylase: analysis of structure function by site-directed mutagenesis."
Gupta R.P., He Y.A., Patrick K.S., Halpert J.R., Bell N.H.
J Clin Endocrinol Metab 90:1210-1219(2005) [PubMed] [Europe PMC] [Abstract]
GO - Biological processi
- aflatoxin metabolic process Source: Reactome
- alkaloid catabolic process Source: BHF-UCLInferred from direct assayi
- "Quantitative contribution of CYP2D6 and CYP3A to oxycodone metabolism in human liver and intestinal microsomes."
Lalovic B., Phillips B., Risler L.L., Howald W., Shen D.D.
Drug Metab Dispos 32:447-454(2004) [PubMed] [Europe PMC] [Abstract]
- androgen metabolic process Source: BHF-UCLTraceable author statementi
- "Hepatic cytochrome P450 enzyme alterations in humans with progressive stages of nonalcoholic fatty liver disease."
Fisher C.D., Lickteig A.J., Augustine L.M., Ranger-Moore J., Jackson J.P., Ferguson S.S., Cherrington N.J.
Drug Metab Dispos 37:2087-2094(2009) [PubMed] [Europe PMC] [Abstract]
- cholesterol metabolic process Source: UniProtKB-UniPathway
- estrogen metabolic process Source: UniProtKBInferred from direct assayi
- Ref.21"Role of human cytochrome P450 1A1, 1A2, 1B1, and 3A4 in the 2-, 4-, and 16alpha-hydroxylation of 17beta-estradiol."
Badawi A.F., Cavalieri E.L., Rogan E.G.
Metabolism 50:1001-1003(2001) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY. - Ref.25"Characterization of the oxidative metabolites of 17beta-estradiol and estrone formed by 15 selectively expressed human cytochrome p450 isoforms."
Lee A.J., Cai M.X., Thomas P.E., Conney A.H., Zhu B.T.
Endocrinology 144:3382-3398(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, ACTIVITY REGULATION, PATHWAY. - Ref.24"Human cytochrome P450 3A7 has a distinct high catalytic activity for the 16alpha-hydroxylation of estrone but not 17beta-estradiol."
Lee A.J., Conney A.H., Zhu B.T.
Cancer Res. 63:6532-6536(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, ACTIVITY REGULATION.
- heterocycle metabolic process Source: BHF-UCLInferred from direct assayi
- "Characterization of human cytochrome P450 enzymes catalyzing domperidone N-dealkylation and hydroxylation in vitro."
Ward B.A., Morocho A., Kandil A., Galinsky R.E., Flockhart D.A., Desta Z.
Br J Clin Pharmacol 58:277-287(2004) [PubMed] [Europe PMC] [Abstract]
- lipid hydroxylation Source: BHF-UCLInferred from direct assayi
- Ref.24"Human cytochrome P450 3A7 has a distinct high catalytic activity for the 16alpha-hydroxylation of estrone but not 17beta-estradiol."
Lee A.J., Conney A.H., Zhu B.T.
Cancer Res. 63:6532-6536(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, ACTIVITY REGULATION.
- lipid metabolic process Source: ProtIncTraceable author statementi
- "Evidence for cytochrome P-450NF, the nifedipine oxidase, being the principal enzyme involved in the bioactivation of aflatoxins in human liver."
Shimada T., Guengerich F.P.
Proc Natl Acad Sci U S A 86:462-465(1989) [PubMed] [Europe PMC] [Abstract]
- long-chain fatty acid biosynthetic process Source: Reactome
- monoterpenoid metabolic process Source: BHF-UCLInferred from direct assayi
- "Radical intermediates in the catalytic oxidation of hydrocarbons by bacterial and human cytochrome P450 enzymes."
Jiang Y., He X., Ortiz de Montellano P.R.
Biochemistry 45:533-542(2006) [PubMed] [Europe PMC] [Abstract]
- oxidative demethylation Source: BHF-UCLInferred from direct assayi
- "Quantitative contribution of CYP2D6 and CYP3A to oxycodone metabolism in human liver and intestinal microsomes."
Lalovic B., Phillips B., Risler L.L., Howald W., Shen D.D.
Drug Metab Dispos 32:447-454(2004) [PubMed] [Europe PMC] [Abstract] - "The relative contribution of human cytochrome P450 isoforms to the four caffeine oxidation pathways: an in vitro comparative study with cDNA-expressed P450s including CYP2C isoforms."
Kot M., Daniel W.A.
Biochem Pharmacol 76:543-551(2008) [PubMed] [Europe PMC] [Abstract]
- retinoic acid metabolic process Source: UniProtKBInferred from direct assayi
- Ref.19"Identification of human cytochrome P450s involved in the formation of all-trans-retinoic acid principal metabolites."
Marill J., Cresteil T., Lanotte M., Chabot G.G.
Mol. Pharmacol. 58:1341-1348(2000) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES.
- retinol metabolic process Source: UniProtKBInferred from direct assayi
- Ref.18"Biosynthesis of all-trans-retinoic acid from all-trans-retinol: catalysis of all-trans-retinol oxidation by human P-450 cytochromes."
Chen H., Howald W.N., Juchau M.R.
Drug Metab. Dispos. 28:315-322(2000) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PATHWAY.
- steroid catabolic process Source: BHF-UCLInferred from mutant phenotypei
- "Identification of the human cytochrome P450 enzymes involved in the in vitro biotransformation of lynestrenol and norethindrone."
Korhonen T., Turpeinen M., Tolonen A., Laine K., Pelkonen O.
J Steroid Biochem Mol Biol 110:56-66(2008) [PubMed] [Europe PMC] [Abstract]
- steroid metabolic process Source: BHF-UCLInferred from direct assayi
- Ref.24"Human cytochrome P450 3A7 has a distinct high catalytic activity for the 16alpha-hydroxylation of estrone but not 17beta-estradiol."
Lee A.J., Conney A.H., Zhu B.T.
Cancer Res. 63:6532-6536(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, ACTIVITY REGULATION.
- vitamin D catabolic process Source: UniProtKBInferred from direct assayi
- Ref.46"CYP3A4 mutation causes vitamin D-dependent rickets type 3."
Roizen J.D., Li D., O'Lear L., Javaid M.K., Shaw N.J., Ebeling P.R., Nguyen H.H., Rodda C.P., Thummel K.E., Thacher T.D., Hakonarson H., Levine M.A.
J. Clin. Invest. 128:1913-1918(2018) [PubMed] [Europe PMC] [Abstract]Cited for: VARIANT VDDR3 THR-301, CHARACTERIZATION OF VARIANT VDDR3 THR-301.
- vitamin D metabolic process Source: BHF-UCL
<p>Inferred by Curator</p>
<p>Used for cases where an annotation is not supported by any evidence but can be reasonably inferred by a curator from other GO annotations for which evidence<br />is available.</p>
<p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ic">GO evidence code guide</a></p>
Inferred by curatori
- "CYP3A4 is a vitamin D-24- and 25-hydroxylase: analysis of structure function by site-directed mutagenesis."
Gupta R.P., He Y.A., Patrick K.S., Halpert J.R., Bell N.H.
J Clin Endocrinol Metab 90:1210-1219(2005) [PubMed] [Europe PMC] [Abstract]
- xenobiotic catabolic process Source: BHF-UCLInferred from direct assayi
- "Quantitative contribution of CYP2D6 and CYP3A to oxycodone metabolism in human liver and intestinal microsomes."
Lalovic B., Phillips B., Risler L.L., Howald W., Shen D.D.
Drug Metab Dispos 32:447-454(2004) [PubMed] [Europe PMC] [Abstract] - "The relative contribution of human cytochrome P450 isoforms to the four caffeine oxidation pathways: an in vitro comparative study with cDNA-expressed P450s including CYP2C isoforms."
Kot M., Daniel W.A.
Biochem Pharmacol 76:543-551(2008) [PubMed] [Europe PMC] [Abstract]
- xenobiotic metabolic process Source: BHF-UCLInferred from direct assayi
- "Characterization of human cytochrome P450 enzymes catalyzing domperidone N-dealkylation and hydroxylation in vitro."
Ward B.A., Morocho A., Kandil A., Galinsky R.E., Flockhart D.A., Desta Z.
Br J Clin Pharmacol 58:277-287(2004) [PubMed] [Europe PMC] [Abstract] - "Acetaminophen bioactivation by human cytochrome P450 enzymes and animal microsomes."
Laine J.E., Auriola S., Pasanen M., Juvonen R.O.
Xenobiotica 39:11-21(2009) [PubMed] [Europe PMC] [Abstract]
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi
Molecular function | Monooxygenase, Oxidoreductase |
Biological process | Fatty acid metabolism, Lipid biosynthesis, Lipid metabolism, Steroid biosynthesis, Steroid metabolism, Sterol metabolism |
Ligand | Heme, Iron, Metal-binding |
Enzyme and pathway databases
BRENDA Comprehensive Enzyme Information System More...BRENDAi | 1.14.14.55, 2681 1.14.14.73, 2681 1.14.99.38, 2681 |
Pathway Commons web resource for biological pathway data More...PathwayCommonsi | P08684 |
Reactome - a knowledgebase of biological pathways and processes More...Reactomei | R-HSA-211981, Xenobiotics R-HSA-5423646, Aflatoxin activation and detoxification R-HSA-9027307, Biosynthesis of maresin-like SPMs |
SABIO-RK: Biochemical Reaction Kinetics Database More...SABIO-RKi | P08684 |
SignaLink: a signaling pathway resource with multi-layered regulatory networks More...SignaLinki | P08684 |
SIGNOR Signaling Network Open Resource More...SIGNORi | P08684 |
UniPathway: a resource for the exploration and annotation of metabolic pathways More...UniPathwayi | UPA00199 UPA00296 UPA00912 |
Chemistry databases
SwissLipids knowledge resource for lipid biology More...SwissLipidsi | SLP:000001201 |
<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi | Recommended name: Cytochrome P450 3A41 Publication<p>Manually curated information that is based on statements in scientific articles for which there is no experimental support.</p> <p><a href="/manual/evidences#ECO:0000303">More...</a></p> Manual assertion based on opinion ini
Manual assertion based on experiment ini
Alternative name(s): 1,4-cineole 2-exo-monooxygenase1 Publication Manual assertion based on opinion ini
1,8-cineole 2-exo-monooxygenase (EC:1.14.14.56
Manual assertion based on experiment ini
Albendazole monooxygenase (sulfoxide-forming) (EC:1.14.14.73
Manual assertion based on experiment ini
Albendazole sulfoxidase CYPIIIA3 CYPIIIA4 Cholesterol 25-hydroxylase1 Publication Manual assertion inferred by curator fromi
|