Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P08183 (MDR1_HUMAN)

Entry version 221 (08 May 2019)
Sequence version 3 (26 May 2009)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Multidrug resistance protein 1

Gene

ABCB1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Energy-dependent efflux pump responsible for decreased drug accumulation in multidrug-resistant cells.

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

  • ATP + H(2)O + xenobiotic(Side 1) = ADP + phosphate + xenobiotic(Side 2). EC:7.6.2.2

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi427 – 434ATP 1PROSITE-ProRule annotation8
Nucleotide bindingi1070 – 1077ATP 2PROSITE-ProRule annotation8

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

View the complete GO annotation on QuickGO ...

GO - Biological processi

View the complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionTranslocase
Biological processTransport
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...BRENDAi		3.6.3.44 2681

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-2161517 Abacavir transmembrane transport
R-HSA-382556 ABC-family proteins mediated transport

SIGNOR Signaling Network Open Resource

More...SIGNORi		P08183

Protein family/group databases

MoonDB Database of extreme multifunctional and moonlighting proteins

More...MoonDBi		P08183 Curated

MoonProt database of moonlighting proteins

More...MoonProti		P08183

Transport Classification Database

More...TCDBi		3.A.1.201.1 the atp-binding cassette (abc) superfamily

Chemistry databases

SwissLipids knowledge resource for lipid biology

More...SwissLipidsi		SLP:000000385

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Multidrug resistance protein 1 (EC:7.6.2.2)
Alternative name(s):
ATP-binding cassette sub-family B member 1
P-glycoprotein 1
CD_antigen: CD243
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ABCB1
Synonyms:MDR1, PGY1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:40 ABCB1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		171050 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P08183

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 44CytoplasmicBy similarityAdd BLAST44
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei45 – 67HelicalPROSITE-ProRule annotationAdd BLAST23
Topological domaini68 – 116ExtracellularBy similarityAdd BLAST49
Transmembranei117 – 137HelicalPROSITE-ProRule annotationAdd BLAST21
Topological domaini138 – 186CytoplasmicBy similarityAdd BLAST49
Transmembranei187 – 208HelicalPROSITE-ProRule annotationAdd BLAST22
Topological domaini209 – 215ExtracellularBy similarity7
Transmembranei216 – 236HelicalPROSITE-ProRule annotationAdd BLAST21
Topological domaini237 – 292CytoplasmicBy similarityAdd BLAST56
Transmembranei293 – 316HelicalPROSITE-ProRule annotationAdd BLAST24
Topological domaini317 – 330ExtracellularBy similarityAdd BLAST14
Transmembranei331 – 352HelicalPROSITE-ProRule annotationAdd BLAST22
Topological domaini353 – 711CytoplasmicBy similarityAdd BLAST359
Transmembranei712 – 732HelicalPROSITE-ProRule annotationAdd BLAST21
Topological domaini733 – 756ExtracellularBy similarityAdd BLAST24
Transmembranei757 – 777HelicalPROSITE-ProRule annotationAdd BLAST21
Topological domaini778 – 832CytoplasmicBy similarityAdd BLAST55
Transmembranei833 – 853HelicalPROSITE-ProRule annotationAdd BLAST21
Topological domaini854ExtracellularBy similarity1
Transmembranei855 – 874HelicalPROSITE-ProRule annotationAdd BLAST20
Topological domaini875 – 934CytoplasmicBy similarityAdd BLAST60
Transmembranei935 – 957HelicalPROSITE-ProRule annotationAdd BLAST23
Topological domaini958 – 973ExtracellularBy similarityAdd BLAST16
Transmembranei974 – 995HelicalPROSITE-ProRule annotationAdd BLAST22
Topological domaini996 – 1280CytoplasmicBy similarityAdd BLAST285

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Inflammatory bowel disease 13 (IBD13)
Disease susceptibility is associated with variations affecting the gene represented in this entry.
Disease descriptionA chronic, relapsing inflammation of the gastrointestinal tract with a complex etiology. It is subdivided into Crohn disease and ulcerative colitis phenotypes. Crohn disease may affect any part of the gastrointestinal tract from the mouth to the anus, but most frequently it involves the terminal ileum and colon. Bowel inflammation is transmural and discontinuous; it may contain granulomas or be associated with intestinal or perianal fistulas. In contrast, in ulcerative colitis, the inflammation is continuous and limited to rectal and colonic mucosal layers; fistulas and granulomas are not observed. Both diseases include extraintestinal inflammation of the skin, eyes, or joints.
See also OMIM:612244

Organism-specific databases

DisGeNET

More...DisGeNETi		5243

MalaCards human disease database

More...MalaCardsi		ABCB1
MIMi612244 phenotype

Open Targets

More...OpenTargetsi		ENSG00000085563

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		771 NON RARE IN EUROPE: Ulcerative colitis

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA267

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL4302

Drug and drug target database

More...DrugBanki		DB01193 Acebutolol
DB00316 Acetaminophen
DB00945 Acetylsalicylic acid
DB00171 Adenosine triphosphate
DB08916 Afatinib
DB00518 Albendazole
DB04630 Aldosterone
DB11363 Alectinib
DB00802 Alfentanil
DB00523 Alitretinoin
DB00915 Amantadine
DB06403 Ambrisentan
DB00345 Aminohippuric acid
DB01118 Amiodarone
DB00321 Amitriptyline
DB00381 Amlodipine
DB00701 Amprenavir
DB00276 Amsacrine
DB06605 Apixaban
DB01169 Arsenic trioxide
DB00637 Astemizole
DB01072 Atazanavir
DB00335 Atenolol
DB01076 Atorvastatin
DB06626 Axitinib
DB00972 Azelastine
DB00207 Azithromycin
DB01086 Benzocaine
DB01244 Bepridil
DB00443 Betamethasone
DB00810 Biperiden
DB08873 Boceprevir
DB06616 Bosutinib
DB08870 Brentuximab vedotin
DB01200 Bromocriptine
DB00921 Buprenorphine
DB00490 Buspirone
DB06772 Cabazitaxel
DB00201 Caffeine
DB04690 Camptothecin
DB08907 Canagliflozin
DB00796 Candesartan
DB01197 Captopril
DB00564 Carbamazepine
DB08889 Carfilzomib
DB01136 Carvedilol
DB00520 Caspofungin
DB09063 Ceritinib
DB00439 Cerivastatin
DB00608 Chloroquine
DB00477 Chlorpromazine
DB00672 Chlorpropamide
DB01239 Chlorprothixene
DB04540 Cholesterol
DB02659 Cholic Acid
DB01340 Cilazapril
DB00501 Cimetidine
DB00537 Ciprofloxacin
DB00515 Cisplatin
DB00215 Citalopram
DB01211 Clarithromycin
DB00349 Clobazam
DB00845 Clofazimine
DB00882 Clomifene
DB01242 Clomipramine
DB00575 Clonidine
DB00758 Clopidogrel
DB00257 Clotrimazole
DB00363 Clozapine
DB09065 Cobicistat
DB05239 Cobimetinib
DB01394 Colchicine
DB02587 Colforsin
DB00286 Conjugated Equine Estrogens
DB08865 Crizotinib
DB00531 Cyclophosphamide
DB00091 Cyclosporine
DB06695 Dabigatran etexilate
DB08912 Dabrafenib
DB09102 Daclatasvir
DB00970 Dactinomycin
DB06292 Dapagliflozin
DB01254 Dasatinib
DB00694 Daunorubicin
DB04840 Debrisoquin
DB01151 Desipramine
DB00967 Desloratadine
DB01234 Dexamethasone
DB00514 Dextromethorphan
DB00829 Diazepam
DB00586 Diclofenac
DB00255 Diethylstilbestrol
DB01396 Digitoxin
DB00390 Digoxin
DB00320 Dihydroergotamine
DB02901 Dihydrotestosterone
DB00343 Diltiazem
DB00975 Dipyridamole
DB01248 Docetaxel
DB01184 Domperidone
DB00590 Doxazosin
DB01142 Doxepin
DB00997 Doxorubicin
DB00470 Dronabinol
DB04855 Dronedarone
DB09075 Edoxaban
DB04881 Elacridar
DB11574 Elbasvir
DB00216 Eletriptan
DB00584 Enalapril
DB08899 Enzalutamide
DB00751 Epinastine
DB01253 Ergonovine
DB00696 Ergotamine
DB00530 Erlotinib
DB00199 Erythromycin
DB00783 Estradiol
DB01196 Estramustine
DB04573 Estriol
DB00655 Estrone
DB00977 Ethinyl Estradiol
DB00773 Etoposide
DB06414 Etravirine
DB00973 Ezetimibe
DB01023 Felodipine
DB00813 Fentanyl
DB06702 Fesoterodine
DB00950 Fexofenadine
DB08874 Fidaxomicin
DB00196 Fluconazole
DB00472 Fluoxetine
DB00875 Flupentixol
DB00623 Fluphenazine
DB00690 Flurazepam
DB08906 Fluticasone furoate
DB00176 Fluvoxamine
DB05449 FM-VP4
DB00317 Gefitinib
DB00441 Gemcitabine
DB01645 Genistein
DB01016 Glyburide
DB09462 Glycerin
DB04077 Glycerol
DB00027 Gramicidin D
DB11575 Grazoprevir
DB00365 Grepafloxacin
DB00502 Haloperidol
DB00741 Hydrocortisone
DB01050 Ibuprofen
DB09054 Idelalisib
DB00619 Imatinib
DB00458 Imipramine
DB05039 Indacaterol
DB00224 Indinavir
DB00328 Indomethacin
DB00762 Irinotecan
DB06636 Isavuconazonium
DB01167 Itraconazole
DB08820 Ivacaftor
DB00602 Ivermectin
DB01221 Ketamine
DB01587 Ketazolam
DB01026 Ketoconazole
DB00709 Lamivudine
DB00555 Lamotrigine
DB00448 Lansoprazole
DB01259 Lapatinib
DB00480 Lenalidomide
DB09078 Lenvatinib
DB01202 Levetiracetam
DB01137 Levofloxacin
DB08918 Levomilnacipran
DB00451 Levothyroxine
DB00281 Lidocaine
DB08882 Linagliptin
DB00279 Liothyronine
DB01583 Liotrix
DB00722 Lisinopril
DB08827 Lomitapide
DB00836 Loperamide
DB01601 Lopinavir
DB00455 Loratadine
DB00678 Losartan
DB00227 Lovastatin
DB00742 Mannitol
DB00934 Maprotiline
DB00643 Mebendazole
DB00358 Mefloquine
DB00351 Megestrol acetate
DB00371 Meprobamate
DB00333 Methadone
DB00563 Methotrexate
DB00959 Methylprednisolone
DB00264 Metoprolol
DB01388 Mibefradil
DB01110 Miconazole
DB00683 Midazolam
DB00834 Mifepristone
DB08893 Mirabegron
DB00305 Mitomycin
DB01204 Mitoxantrone
DB00295 Morphine
DB00688 Mycophenolate mofetil
DB01203 Nadolol
DB01183 Naloxone
DB00704 Naltrexone
DB03467 Naringenin
DB01149 Nefazodone
DB00220 Nelfinavir
DB01400 Neostigmine
DB00622 Nicardipine
DB01115 Nifedipine
DB04868 Nilotinib
DB09079 Nintedanib
DB00401 Nisoldipine
DB01595 Nitrazepam
DB01054 Nitrendipine
DB00585 Nizatidine
DB00717 Norethisterone
DB00334 Olanzapine
DB09296 Ombitasvir
DB00338 Omeprazole
DB09330 Osimertinib
DB04417 P-Nitrophenol
DB01229 Paclitaxel
DB03796 Palmitic Acid
DB06603 Panobinostat
DB00213 Pantoprazole
DB00715 Paroxetine
DB06589 Pazopanib
DB00790 Perindopril
DB01174 Phenobarbital
DB00252 Phenytoin
DB01100 Pimozide
DB08860 Pitavastatin
DB02261 Platelet Activating Factor
DB08910 Pomalidomide
DB08901 Ponatinib
DB01263 Posaconazole
DB00175 Pravastatin
DB00457 Prazosin
DB00860 Prednisolone
DB00635 Prednisone
DB01032 Probenecid
DB00396 Progesterone
DB01069 Promethazine
DB01182 Propafenone
DB00571 Propranolol
DB00344 Protriptyline
DB04216 Quercetin
DB01224 Quetiapine
DB01103 Quinacrine
DB00908 Quinidine
DB00468 Quinine
DB00863 Ranitidine
DB00234 Reboxetine
DB08896 Regorafenib
DB00206 Reserpine
DB01045 Rifampicin
DB08864 Rilpivirine
DB00734 Risperidone
DB00503 Ritonavir
DB06228 Rivaroxaban
DB09291 Rolapitant
DB06176 Romidepsin
DB00778 Roxithromycin
DB00936 Salicylic acid
DB01232 Saquinavir
DB00747 Scopolamine
DB01037 Selegiline
DB11362 Selexipag
DB01104 Sertraline
DB06207 Silodosin
DB06290 Simeprevir
DB00641 Simvastatin
DB00877 Sirolimus
DB01261 Sitagliptin
DB08934 Sofosbuvir
DB00398 Sorafenib
DB01208 Sparfloxacin
DB03203 Sphingosine
DB00421 Spironolactone
DB01323 St. John's Wort
DB02010 Staurosporine
DB00428 Streptozocin
DB01138 Sulfinpyrazone
DB00669 Sumatriptan
DB01268 Sunitinib
DB00382 Tacrine
DB00864 Tacrolimus
DB00675 Tamoxifen
DB04348 Taurocholic Acid
DB09161 Technetium Tc-99m sestamibi
DB05521 Telaprevir
DB00966 Telmisartan
DB06287 Temsirolimus
DB01162 Terazosin
DB00342 Terfenadine
DB04905 Tesmilifene
DB00624 Testosterone
DB08816 Ticagrelor
DB00373 Timolol
DB06212 Tolvaptan
DB01030 Topotecan
DB00539 Toremifene
DB05773 Trastuzumab emtansine
DB00656 Trazodone
DB00831 Trifluoperazine
DB00508 Triflupromazine
DB00440 Trimethoprim
DB00726 Trimipramine
DB01361 Troleandomycin
DB08867 Ulipristal
DB09076 Umeclidinium
DB01339 Vecuronium
DB11581 Venetoclax
DB00285 Venlafaxine
DB00661 Verapamil
DB00570 Vinblastine
DB00541 Vincristine
DB00361 Vinorelbine
DB08828 Vismodegib
DB04877 Voacamine
DB00495 Zidovudine
DB04832 Zimelidine

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		ABCB1

Domain mapping of disease mutations (DMDM)

More...DMDMi		238054374

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000933321 – 1280Multidrug resistance protein 1Add BLAST1280

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi91N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi94N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi99N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei660PhosphoserineBy similarity1

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		P08183

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P08183

MaxQB - The MaxQuant DataBase

More...MaxQBi		P08183

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P08183

PeptideAtlas

More...PeptideAtlasi		P08183

PRoteomics IDEntifications database

More...PRIDEi		P08183

ProteomicsDB human proteome resource

More...ProteomicsDBi		52080

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P08183

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P08183

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in liver, kidney, small intestine and brain.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000085563 Expressed in 186 organ(s), highest expression level in right adrenal gland

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P08183 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P08183 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		CAB001716
HPA002199

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with PSMB5. Finds in a complex with ABCB1, TFPI2 and PPP2R3C; leading to the dephosphorylation of ABCB1.2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		111262, 17 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		P08183

Protein interaction database and analysis system

More...IntActi		P08183, 7 interactors

Molecular INTeraction database

More...MINTi		P08183

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000478255

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		P08183

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11280
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
6C0Velectron microscopy3.40A1-1280[»]
6FN1electron microscopy3.58A32-1279[»]
6FN4electron microscopy4.14A1-1279[»]
6QEXelectron microscopy3.60A1-1280[»]

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P08183

Database of comparative protein structure models

More...ModBasei		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini51 – 357ABC transmembrane type-1 1PROSITE-ProRule annotationAdd BLAST307
Domaini392 – 628ABC transporter 1PROSITE-ProRule annotationAdd BLAST237
Domaini711 – 1000ABC transmembrane type-1 2PROSITE-ProRule annotationAdd BLAST290
Domaini1035 – 1273ABC transporter 2PROSITE-ProRule annotationAdd BLAST239

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the ABC transporter superfamily. ABCB family. Multidrug resistance exporter (TC 3.A.1.201) subfamily. [View classification]Curated

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0055 Eukaryota
COG1132 LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000155287

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P08183

KEGG Orthology (KO)

More...KOi		K05658

Identification of Orthologs from Complete Genome Data

More...OMAi		VNGWIQM

Database of Orthologous Groups

More...OrthoDBi		186078at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P08183

TreeFam database of animal gene trees

More...TreeFami		TF105193

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.20.1560.10, 2 hits

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR003593 AAA+_ATPase
IPR011527 ABC1_TM_dom
IPR036640 ABC1_TM_sf
IPR003439 ABC_transporter-like
IPR017871 ABC_transporter_CS
IPR030258 MDR1
IPR027417 P-loop_NTPase
IPR039421 Type_I_exporter

The PANTHER Classification System

More...PANTHERi		PTHR24221 PTHR24221, 1 hit
PTHR24221:SF251 PTHR24221:SF251, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00664 ABC_membrane, 2 hits
PF00005 ABC_tran, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00382 AAA, 2 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF52540 SSF52540, 2 hits
SSF90123 SSF90123, 2 hits

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50929 ABC_TM1F, 2 hits
PS00211 ABC_TRANSPORTER_1, 2 hits
PS50893 ABC_TRANSPORTER_2, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: P08183-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDLEGDRNGG AKKKNFFKLN NKSEKDKKEK KPTVSVFSMF RYSNWLDKLY 
        60         70         80         90        100
MVVGTLAAII HGAGLPLMML VFGEMTDIFA NAGNLEDLMS NITNRSDIND 
       110        120        130        140        150
TGFFMNLEED MTRYAYYYSG IGAGVLVAAY IQVSFWCLAA GRQIHKIRKQ 
       160        170        180        190        200
FFHAIMRQEI GWFDVHDVGE LNTRLTDDVS KINEGIGDKI GMFFQSMATF 
       210        220        230        240        250
FTGFIVGFTR GWKLTLVILA ISPVLGLSAA VWAKILSSFT DKELLAYAKA 
       260        270        280        290        300
GAVAEEVLAA IRTVIAFGGQ KKELERYNKN LEEAKRIGIK KAITANISIG 
       310        320        330        340        350
AAFLLIYASY ALAFWYGTTL VLSGEYSIGQ VLTVFFSVLI GAFSVGQASP 
       360        370        380        390        400
SIEAFANARG AAYEIFKIID NKPSIDSYSK SGHKPDNIKG NLEFRNVHFS 
       410        420        430        440        450
YPSRKEVKIL KGLNLKVQSG QTVALVGNSG CGKSTTVQLM QRLYDPTEGM 
       460        470        480        490        500
VSVDGQDIRT INVRFLREII GVVSQEPVLF ATTIAENIRY GRENVTMDEI 
       510        520        530        540        550
EKAVKEANAY DFIMKLPHKF DTLVGERGAQ LSGGQKQRIA IARALVRNPK 
       560        570        580        590        600
ILLLDEATSA LDTESEAVVQ VALDKARKGR TTIVIAHRLS TVRNADVIAG 
       610        620        630        640        650
FDDGVIVEKG NHDELMKEKG IYFKLVTMQT AGNEVELENA ADESKSEIDA 
       660        670        680        690        700
LEMSSNDSRS SLIRKRSTRR SVRGSQAQDR KLSTKEALDE SIPPVSFWRI 
       710        720        730        740        750
MKLNLTEWPY FVVGVFCAII NGGLQPAFAI IFSKIIGVFT RIDDPETKRQ 
       760        770        780        790        800
NSNLFSLLFL ALGIISFITF FLQGFTFGKA GEILTKRLRY MVFRSMLRQD 
       810        820        830        840        850
VSWFDDPKNT TGALTTRLAN DAAQVKGAIG SRLAVITQNI ANLGTGIIIS 
       860        870        880        890        900
FIYGWQLTLL LLAIVPIIAI AGVVEMKMLS GQALKDKKEL EGSGKIATEA 
       910        920        930        940        950
IENFRTVVSL TQEQKFEHMY AQSLQVPYRN SLRKAHIFGI TFSFTQAMMY 
       960        970        980        990       1000
FSYAGCFRFG AYLVAHKLMS FEDVLLVFSA VVFGAMAVGQ VSSFAPDYAK 
      1010       1020       1030       1040       1050
AKISAAHIIM IIEKTPLIDS YSTEGLMPNT LEGNVTFGEV VFNYPTRPDI 
      1060       1070       1080       1090       1100
PVLQGLSLEV KKGQTLALVG SSGCGKSTVV QLLERFYDPL AGKVLLDGKE 
      1110       1120       1130       1140       1150
IKRLNVQWLR AHLGIVSQEP ILFDCSIAEN IAYGDNSRVV SQEEIVRAAK 
      1160       1170       1180       1190       1200
EANIHAFIES LPNKYSTKVG DKGTQLSGGQ KQRIAIARAL VRQPHILLLD 
      1210       1220       1230       1240       1250
EATSALDTES EKVVQEALDK AREGRTCIVI AHRLSTIQNA DLIVVFQNGR 
      1260       1270       1280
VKEHGTHQQL LAQKGIYFSM VSVQAGTKRQ
Length:1,280
Mass (Da):141,479
Last modified:May 26, 2009 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF0230744AB288C73
GO
Isoform 2 (identifier: P08183-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     113-177: RYAYYYSGIGAGVLVAAYIQVSFWCLAAGRQIHKIRKQFFHAIMRQEIGWFDVHDVGELNTRLTD → S

Show »
Length:1,216
Mass (Da):134,032
Checksum:i227233F5F2259A8C
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E7EWT8E7EWT8_HUMAN
Multidrug resistance protein 1
ABCB1
48Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAM49149 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti23S → R in CAA41558 (PubMed:2568832).Curated1
Sequence conflicti336Missing in AAB69423 (PubMed:9038218).Curated1

<p>This subsection of the ‘Sequence’ section provides information on polymorphic variants. If the variant is associated with a disease state, the description of the latter can be found in the <a href="http://www.uniprot.org/manual/involvement_in_disease">'Involvement in disease'</a> subsection.<p><a href='/help/polymorphism' target='_top'>More...</a></p>Polymorphismi

Genetic variation in ABCB1 may play a role in patients who do not respond to drug treatment.3 Publications

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_02227617F → L1 PublicationCorresponds to variant dbSNP:rs28381804Ensembl.1
Natural variantiVAR_01470421N → D5 PublicationsCorresponds to variant dbSNP:rs9282564Ensembl.1
Natural variantiVAR_05542344N → S. Corresponds to variant dbSNP:rs1202183Ensembl.1
Natural variantiVAR_05542480A → E. Corresponds to variant dbSNP:rs9282565Ensembl.1
Natural variantiVAR_015001103F → L Rare polymorphism. 1 Publication1
Natural variantiVAR_018351108E → K1 Publication1
Natural variantiVAR_015002185G → V in a colchicine-selected multidrug-resistant cell line; confers increased resistance to colchicine. 3 PublicationsCorresponds to variant dbSNP:rs1128501EnsemblClinVar.1
Natural variantiVAR_055425261I → V. Corresponds to variant dbSNP:rs36008564Ensembl.1
Natural variantiVAR_015003400S → N3 PublicationsCorresponds to variant dbSNP:rs2229109EnsemblClinVar.1
Natural variantiVAR_022277566E → K1 PublicationCorresponds to variant dbSNP:rs28381902Ensembl.1
Natural variantiVAR_022278593R → C1 PublicationCorresponds to variant dbSNP:rs28381914Ensembl.1
Natural variantiVAR_055426599A → T. Corresponds to variant dbSNP:rs2235036Ensembl.1
Natural variantiVAR_055427669R → C. Corresponds to variant dbSNP:rs35023033Ensembl.1
Natural variantiVAR_055428801V → M. Corresponds to variant dbSNP:rs2235039Ensembl.1
Natural variantiVAR_055429829I → V. Corresponds to variant dbSNP:rs2032581Ensembl.1
Natural variantiVAR_022279836I → V1 PublicationCorresponds to variant dbSNP:rs28381967Ensembl.1
Natural variantiVAR_035737887K → N in a colorectal cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_013361893S → A Common allele; associated with susceptibility to IBD13; has decreased enzyme activity. 8 PublicationsCorresponds to variant dbSNP:rs2032582EnsemblClinVar.1
Natural variantiVAR_013362893S → T Rare allele. 3 PublicationsCorresponds to variant dbSNP:rs2032582EnsemblClinVar.1
Natural variantiVAR_018352986M → V. Corresponds to variant dbSNP:rs926081975Ensembl.1
Natural variantiVAR_015004999A → T1 PublicationCorresponds to variant dbSNP:rs72552784Ensembl.1
Natural variantiVAR_0222801051P → A1 PublicationCorresponds to variant dbSNP:rs28401798Ensembl.1
Natural variantiVAR_0150051107Q → P1 PublicationCorresponds to variant dbSNP:rs55852620Ensembl.1
Natural variantiVAR_0222811141S → T1 PublicationCorresponds to variant dbSNP:rs2229107Ensembl.1
Natural variantiVAR_0183531251V → I2 PublicationsCorresponds to variant dbSNP:rs28364274Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_055769113 – 177RYAYY…TRLTD → S in isoform 2. 1 PublicationAdd BLAST65

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
M14758 mRNA Translation: AAA59575.1
M29447
, M29424, M29425, M29426, M29427, M29428, M29429, M29430, M29431, M29432, M29433, M29434, M29435, M29436, M29437, M29438, M29439, M29440, M29441, M29442, M29443, M29444, M29445, M29446 Genomic DNA Translation: AAA59576.1
AF016535 mRNA Translation: AAB69423.1
EU854148 mRNA Translation: ACF94688.1
AY910577 Genomic DNA Translation: AAW82430.1
AK290159 mRNA Translation: BAF82848.1
AC002457 Genomic DNA Translation: AAM49149.1 Sequence problems.
AC005068 Genomic DNA No translation available.
M37724 Genomic DNA Translation: AAA88047.1
M37725 Genomic DNA Translation: AAA88048.1
X58723 Genomic DNA Translation: CAA41558.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS5608.1 [P08183-1]

Protein sequence database of the Protein Information Resource

More...PIRi		A34914 DVHU1

NCBI Reference Sequences

More...RefSeqi		NP_000918.2, NM_000927.4 [P08183-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000265724; ENSP00000265724; ENSG00000085563 [P08183-1]
ENST00000543898; ENSP00000444095; ENSG00000085563 [P08183-2]
ENST00000622132; ENSP00000478255; ENSG00000085563 [P08183-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		5243

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:5243

UCSC genome browser

More...UCSCi		uc003uiz.3 human [P08183-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology
NIEHS-SNPs
SHMPD

The Singapore human mutation and polymorphism database

Wikipedia

P-glycoprotein entry

ABCMdb

Database for mutations in ABC proteins

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M14758 mRNA Translation: AAA59575.1
M29447
, M29424, M29425, M29426, M29427, M29428, M29429, M29430, M29431, M29432, M29433, M29434, M29435, M29436, M29437, M29438, M29439, M29440, M29441, M29442, M29443, M29444, M29445, M29446 Genomic DNA Translation: AAA59576.1
AF016535 mRNA Translation: AAB69423.1
EU854148 mRNA Translation: ACF94688.1
AY910577 Genomic DNA Translation: AAW82430.1
AK290159 mRNA Translation: BAF82848.1
AC002457 Genomic DNA Translation: AAM49149.1 Sequence problems.
AC005068 Genomic DNA No translation available.
M37724 Genomic DNA Translation: AAA88047.1
M37725 Genomic DNA Translation: AAA88048.1
X58723 Genomic DNA Translation: CAA41558.1
CCDSiCCDS5608.1 [P08183-1]
PIRiA34914 DVHU1
RefSeqiNP_000918.2, NM_000927.4 [P08183-1]

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
6C0Velectron microscopy3.40A1-1280[»]
6FN1electron microscopy3.58A32-1279[»]
6FN4electron microscopy4.14A1-1279[»]
6QEXelectron microscopy3.60A1-1280[»]
SMRiP08183
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111262, 17 interactors
CORUMiP08183
IntActiP08183, 7 interactors
MINTiP08183
STRINGi9606.ENSP00000478255

Chemistry databases

BindingDBiP08183
ChEMBLiCHEMBL4302
DrugBankiDB01193 Acebutolol
DB00316 Acetaminophen
DB00945 Acetylsalicylic acid
DB00171 Adenosine triphosphate
DB08916 Afatinib
DB00518 Albendazole
DB04630 Aldosterone
DB11363 Alectinib
DB00802 Alfentanil
DB00523 Alitretinoin
DB00915 Amantadine
DB06403 Ambrisentan
DB00345 Aminohippuric acid
DB01118 Amiodarone
DB00321 Amitriptyline
DB00381 Amlodipine
DB00701 Amprenavir
DB00276 Amsacrine
DB06605 Apixaban
DB01169 Arsenic trioxide
DB00637 Astemizole
DB01072 Atazanavir
DB00335 Atenolol
DB01076 Atorvastatin
DB06626 Axitinib
DB00972 Azelastine
DB00207 Azithromycin
DB01086 Benzocaine
DB01244 Bepridil
DB00443 Betamethasone
DB00810 Biperiden
DB08873 Boceprevir
DB06616 Bosutinib
DB08870 Brentuximab vedotin
DB01200 Bromocriptine
DB00921 Buprenorphine
DB00490 Buspirone
DB06772 Cabazitaxel
DB00201 Caffeine
DB04690 Camptothecin
DB08907 Canagliflozin
DB00796 Candesartan
DB01197 Captopril
DB00564 Carbamazepine
DB08889 Carfilzomib
DB01136 Carvedilol
DB00520 Caspofungin
DB09063 Ceritinib
DB00439 Cerivastatin
DB00608 Chloroquine
DB00477 Chlorpromazine
DB00672 Chlorpropamide
DB01239 Chlorprothixene
DB04540 Cholesterol
DB02659 Cholic Acid
DB01340 Cilazapril
DB00501 Cimetidine
DB00537 Ciprofloxacin
DB00515 Cisplatin
DB00215 Citalopram
DB01211 Clarithromycin
DB00349 Clobazam
DB00845 Clofazimine
DB00882 Clomifene
DB01242 Clomipramine
DB00575 Clonidine
DB00758 Clopidogrel
DB00257 Clotrimazole
DB00363 Clozapine
DB09065 Cobicistat
DB05239 Cobimetinib
DB01394 Colchicine
DB02587 Colforsin
DB00286 Conjugated Equine Estrogens
DB08865 Crizotinib
DB00531 Cyclophosphamide
DB00091 Cyclosporine
DB06695 Dabigatran etexilate
DB08912 Dabrafenib
DB09102 Daclatasvir
DB00970 Dactinomycin
DB06292 Dapagliflozin
DB01254 Dasatinib
DB00694 Daunorubicin
DB04840 Debrisoquin
DB01151 Desipramine
DB00967 Desloratadine
DB01234 Dexamethasone
DB00514 Dextromethorphan
DB00829 Diazepam
DB00586 Diclofenac
DB00255 Diethylstilbestrol
DB01396 Digitoxin
DB00390 Digoxin
DB00320 Dihydroergotamine
DB02901 Dihydrotestosterone
DB00343 Diltiazem
DB00975 Dipyridamole
DB01248 Docetaxel
DB01184 Domperidone
DB00590 Doxazosin
DB01142 Doxepin
DB00997 Doxorubicin
DB00470 Dronabinol
DB04855 Dronedarone
DB09075 Edoxaban
DB04881 Elacridar
DB11574 Elbasvir
DB00216 Eletriptan
DB00584 Enalapril
DB08899 Enzalutamide
DB00751 Epinastine
DB01253 Ergonovine
DB00696 Ergotamine
DB00530 Erlotinib
DB00199 Erythromycin
DB00783 Estradiol
DB01196 Estramustine
DB04573 Estriol
DB00655 Estrone
DB00977 Ethinyl Estradiol
DB00773 Etoposide
DB06414 Etravirine
DB00973 Ezetimibe
DB01023 Felodipine
DB00813 Fentanyl
DB06702 Fesoterodine
DB00950 Fexofenadine
DB08874 Fidaxomicin
DB00196 Fluconazole
DB00472 Fluoxetine
DB00875 Flupentixol
DB00623 Fluphenazine
DB00690 Flurazepam
DB08906 Fluticasone furoate
DB00176 Fluvoxamine
DB05449 FM-VP4
DB00317 Gefitinib
DB00441 Gemcitabine
DB01645 Genistein
DB01016 Glyburide
DB09462 Glycerin
DB04077 Glycerol
DB00027 Gramicidin D
DB11575 Grazoprevir
DB00365 Grepafloxacin
DB00502 Haloperidol
DB00741 Hydrocortisone
DB01050 Ibuprofen
DB09054 Idelalisib
DB00619 Imatinib
DB00458 Imipramine
DB05039 Indacaterol
DB00224 Indinavir
DB00328 Indomethacin
DB00762 Irinotecan
DB06636 Isavuconazonium
DB01167 Itraconazole
DB08820 Ivacaftor
DB00602 Ivermectin
DB01221 Ketamine
DB01587 Ketazolam
DB01026 Ketoconazole
DB00709 Lamivudine
DB00555 Lamotrigine
DB00448 Lansoprazole
DB01259 Lapatinib
DB00480 Lenalidomide
DB09078 Lenvatinib
DB01202 Levetiracetam
DB01137 Levofloxacin
DB08918 Levomilnacipran
DB00451 Levothyroxine
DB00281 Lidocaine
DB08882 Linagliptin
DB00279 Liothyronine
DB01583 Liotrix
DB00722 Lisinopril
DB08827 Lomitapide
DB00836 Loperamide
DB01601 Lopinavir
DB00455 Loratadine
DB00678 Losartan
DB00227 Lovastatin
DB00742 Mannitol
DB00934 Maprotiline
DB00643 Mebendazole
DB00358 Mefloquine
DB00351 Megestrol acetate
DB00371 Meprobamate
DB00333 Methadone
DB00563 Methotrexate
DB00959 Methylprednisolone
DB00264 Metoprolol
DB01388 Mibefradil
DB01110 Miconazole
DB00683 Midazolam
DB00834 Mifepristone
DB08893 Mirabegron
DB00305 Mitomycin
DB01204 Mitoxantrone
DB00295 Morphine
DB00688 Mycophenolate mofetil
DB01203 Nadolol
DB01183 Naloxone
DB00704 Naltrexone
DB03467 Naringenin
DB01149 Nefazodone
DB00220 Nelfinavir
DB01400 Neostigmine
DB00622 Nicardipine
DB01115 Nifedipine
DB04868 Nilotinib
DB09079 Nintedanib
DB00401 Nisoldipine
DB01595 Nitrazepam
DB01054 Nitrendipine
DB00585 Nizatidine
DB00717 Norethisterone
DB00334 Olanzapine
DB09296 Ombitasvir
DB00338 Omeprazole
DB09330 Osimertinib
DB04417 P-Nitrophenol
DB01229 Paclitaxel
DB03796 Palmitic Acid
DB06603 Panobinostat
DB00213 Pantoprazole
DB00715 Paroxetine
DB06589 Pazopanib
DB00790 Perindopril
DB01174 Phenobarbital
DB00252 Phenytoin
DB01100 Pimozide
DB08860 Pitavastatin
DB02261 Platelet Activating Factor
DB08910 Pomalidomide
DB08901 Ponatinib
DB01263 Posaconazole
DB00175 Pravastatin
DB00457 Prazosin
DB00860 Prednisolone
DB00635 Prednisone
DB01032 Probenecid
DB00396 Progesterone
DB01069 Promethazine
DB01182 Propafenone
DB00571 Propranolol
DB00344 Protriptyline
DB04216 Quercetin
DB01224 Quetiapine
DB01103 Quinacrine
DB00908 Quinidine
DB00468 Quinine
DB00863 Ranitidine
DB00234 Reboxetine
DB08896 Regorafenib
DB00206 Reserpine
DB01045 Rifampicin
DB08864 Rilpivirine
DB00734 Risperidone
DB00503 Ritonavir
DB06228 Rivaroxaban
DB09291 Rolapitant
DB06176 Romidepsin
DB00778 Roxithromycin
DB00936 Salicylic acid
DB01232 Saquinavir
DB00747 Scopolamine
DB01037 Selegiline
DB11362 Selexipag
DB01104 Sertraline
DB06207 Silodosin
DB06290 Simeprevir
DB00641 Simvastatin
DB00877 Sirolimus
DB01261 Sitagliptin
DB08934 Sofosbuvir
DB00398 Sorafenib
DB01208 Sparfloxacin
DB03203 Sphingosine
DB00421 Spironolactone
DB01323 St. John's Wort
DB02010 Staurosporine
DB00428 Streptozocin
DB01138 Sulfinpyrazone
DB00669 Sumatriptan
DB01268 Sunitinib
DB00382 Tacrine
DB00864 Tacrolimus
DB00675 Tamoxifen
DB04348 Taurocholic Acid
DB09161 Technetium Tc-99m sestamibi
DB05521 Telaprevir
DB00966 Telmisartan
DB06287 Temsirolimus
DB01162 Terazosin
DB00342 Terfenadine
DB04905 Tesmilifene
DB00624 Testosterone
DB08816 Ticagrelor
DB00373 Timolol
DB06212 Tolvaptan
DB01030 Topotecan
DB00539 Toremifene
DB05773 Trastuzumab emtansine
DB00656 Trazodone
DB00831 Trifluoperazine
DB00508 Triflupromazine
DB00440 Trimethoprim
DB00726 Trimipramine
DB01361 Troleandomycin
DB08867 Ulipristal
DB09076 Umeclidinium
DB01339 Vecuronium
DB11581 Venetoclax
DB00285 Venlafaxine
DB00661 Verapamil
DB00570 Vinblastine
DB00541 Vincristine
DB00361 Vinorelbine
DB08828 Vismodegib
DB04877 Voacamine
DB00495 Zidovudine
DB04832 Zimelidine
SwissLipidsiSLP:000000385

Protein family/group databases

MoonDBiP08183 Curated
MoonProtiP08183
TCDBi3.A.1.201.1 the atp-binding cassette (abc) superfamily

PTM databases

iPTMnetiP08183
PhosphoSitePlusiP08183

Polymorphism and mutation databases

BioMutaiABCB1
DMDMi238054374

Proteomic databases

EPDiP08183
jPOSTiP08183
MaxQBiP08183
PaxDbiP08183
PeptideAtlasiP08183
PRIDEiP08183
ProteomicsDBi52080

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		5243
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000265724; ENSP00000265724; ENSG00000085563 [P08183-1]
ENST00000543898; ENSP00000444095; ENSG00000085563 [P08183-2]
ENST00000622132; ENSP00000478255; ENSG00000085563 [P08183-1]
GeneIDi5243
KEGGihsa:5243
UCSCiuc003uiz.3 human [P08183-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		5243
DisGeNETi5243

GeneCards: human genes, protein and diseases

More...GeneCardsi		ABCB1

H-Invitational Database, human transcriptome db

More...H-InvDBi		HIX0033521
HGNCiHGNC:40 ABCB1
HPAiCAB001716
HPA002199
MalaCardsiABCB1
MIMi171050 gene
612244 phenotype
neXtProtiNX_P08183
OpenTargetsiENSG00000085563
Orphaneti771 NON RARE IN EUROPE: Ulcerative colitis
PharmGKBiPA267

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0055 Eukaryota
COG1132 LUCA
GeneTreeiENSGT00940000155287
InParanoidiP08183
KOiK05658
OMAiVNGWIQM
OrthoDBi186078at2759
PhylomeDBiP08183
TreeFamiTF105193

Enzyme and pathway databases

BRENDAi3.6.3.44 2681
ReactomeiR-HSA-2161517 Abacavir transmembrane transport
R-HSA-382556 ABC-family proteins mediated transport
SIGNORiP08183

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		ABCB1 human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		P-glycoprotein

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		5243

Protein Ontology

More...PROi		PR:P08183

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000085563 Expressed in 186 organ(s), highest expression level in right adrenal gland
ExpressionAtlasiP08183 baseline and differential
GenevisibleiP08183 HS

Family and domain databases

Gene3Di1.20.1560.10, 2 hits
InterProiView protein in InterPro
IPR003593 AAA+_ATPase
IPR011527 ABC1_TM_dom
IPR036640 ABC1_TM_sf
IPR003439 ABC_transporter-like
IPR017871 ABC_transporter_CS
IPR030258 MDR1
IPR027417 P-loop_NTPase
IPR039421 Type_I_exporter
PANTHERiPTHR24221 PTHR24221, 1 hit
PTHR24221:SF251 PTHR24221:SF251, 1 hit
PfamiView protein in Pfam
PF00664 ABC_membrane, 2 hits
PF00005 ABC_tran, 2 hits
SMARTiView protein in SMART
SM00382 AAA, 2 hits
SUPFAMiSSF52540 SSF52540, 2 hits
SSF90123 SSF90123, 2 hits
PROSITEiView protein in PROSITE
PS50929 ABC_TM1F, 2 hits
PS00211 ABC_TRANSPORTER_1, 2 hits
PS50893 ABC_TRANSPORTER_2, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMDR1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P08183
Secondary accession number(s): A8K294
, B5AK60, Q12755, Q14812
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 1, 1988
Last sequence update: May 26, 2009
Last modified: May 8, 2019
This is version 221 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  6. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  7. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again