Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Multidrug resistance protein 1

Gene

ABCB1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Energy-dependent efflux pump responsible for decreased drug accumulation in multidrug-resistant cells.

Catalytic activityi

ATP + H2O + xenobiotic(In) = ADP + phosphate + xenobiotic(Out).

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi427 – 434ATP 1PROSITE-ProRule annotation8
Nucleotide bindingi1070 – 1077ATP 2PROSITE-ProRule annotation8

GO - Molecular functioni

  • ATPase activity, coupled to transmembrane movement of substances Source: ProtInc
  • ATP binding Source: ProtInc
  • ceramide-translocating ATPase activity Source: BHF-UCL
  • phosphatidylcholine-translocating ATPase activity Source: BHF-UCL
  • phosphatidylethanolamine-translocating ATPase activity Source: BHF-UCL
  • transporter activity Source: ProtInc
  • xenobiotic transmembrane transporting ATPase activity Source: Reactome

GO - Biological processi

  • ceramide translocation Source: BHF-UCL
  • G2/M transition of mitotic cell cycle Source: DFLAT
  • phospholipid translocation Source: BHF-UCL
  • positive regulation of anion channel activity Source: CAFA
  • regulation of chloride transport Source: CAFA
  • regulation of response to osmotic stress Source: CAFA
  • response to drug Source: ProtInc
  • stem cell proliferation Source: DFLAT
  • transmembrane transport Source: Reactome

Keywordsi

Molecular functionHydrolase
Biological processTransport
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDAi3.6.3.44 2681
ReactomeiR-HSA-2161517 Abacavir transmembrane transport
R-HSA-382556 ABC-family proteins mediated transport
SIGNORiP08183

Protein family/group databases

MoonDBiP08183 Curated
MoonProtiP08183
TCDBi3.A.1.201.1 the atp-binding cassette (abc) superfamily

Chemistry databases

SwissLipidsiSLP:000000385

Names & Taxonomyi

Protein namesi
Recommended name:
Multidrug resistance protein 1 (EC:3.6.3.44)
Alternative name(s):
ATP-binding cassette sub-family B member 1
P-glycoprotein 1
CD_antigen: CD243
Gene namesi
Name:ABCB1
Synonyms:MDR1, PGY1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

EuPathDBiHostDB:ENSG00000085563.14
HGNCiHGNC:40 ABCB1
MIMi171050 gene
neXtProtiNX_P08183

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 44CytoplasmicBy similarityAdd BLAST44
Transmembranei45 – 67HelicalPROSITE-ProRule annotationAdd BLAST23
Topological domaini68 – 116ExtracellularBy similarityAdd BLAST49
Transmembranei117 – 137HelicalPROSITE-ProRule annotationAdd BLAST21
Topological domaini138 – 186CytoplasmicBy similarityAdd BLAST49
Transmembranei187 – 208HelicalPROSITE-ProRule annotationAdd BLAST22
Topological domaini209 – 215ExtracellularBy similarity7
Transmembranei216 – 236HelicalPROSITE-ProRule annotationAdd BLAST21
Topological domaini237 – 292CytoplasmicBy similarityAdd BLAST56
Transmembranei293 – 316HelicalPROSITE-ProRule annotationAdd BLAST24
Topological domaini317 – 330ExtracellularBy similarityAdd BLAST14
Transmembranei331 – 352HelicalPROSITE-ProRule annotationAdd BLAST22
Topological domaini353 – 711CytoplasmicBy similarityAdd BLAST359
Transmembranei712 – 732HelicalPROSITE-ProRule annotationAdd BLAST21
Topological domaini733 – 756ExtracellularBy similarityAdd BLAST24
Transmembranei757 – 777HelicalPROSITE-ProRule annotationAdd BLAST21
Topological domaini778 – 832CytoplasmicBy similarityAdd BLAST55
Transmembranei833 – 853HelicalPROSITE-ProRule annotationAdd BLAST21
Topological domaini854ExtracellularBy similarity1
Transmembranei855 – 874HelicalPROSITE-ProRule annotationAdd BLAST20
Topological domaini875 – 934CytoplasmicBy similarityAdd BLAST60
Transmembranei935 – 957HelicalPROSITE-ProRule annotationAdd BLAST23
Topological domaini958 – 973ExtracellularBy similarityAdd BLAST16
Transmembranei974 – 995HelicalPROSITE-ProRule annotationAdd BLAST22
Topological domaini996 – 1280CytoplasmicBy similarityAdd BLAST285

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Involvement in diseasei

Inflammatory bowel disease 13 (IBD13)
Disease susceptibility is associated with variations affecting the gene represented in this entry.
Disease descriptionA chronic, relapsing inflammation of the gastrointestinal tract with a complex etiology. It is subdivided into Crohn disease and ulcerative colitis phenotypes. Crohn disease may affect any part of the gastrointestinal tract from the mouth to the anus, but most frequently it involves the terminal ileum and colon. Bowel inflammation is transmural and discontinuous; it may contain granulomas or be associated with intestinal or perianal fistulas. In contrast, in ulcerative colitis, the inflammation is continuous and limited to rectal and colonic mucosal layers; fistulas and granulomas are not observed. Both diseases include extraintestinal inflammation of the skin, eyes, or joints.
See also OMIM:612244

Organism-specific databases

DisGeNETi5243
MalaCardsiABCB1
MIMi612244 phenotype
OpenTargetsiENSG00000085563
Orphaneti771 Ulcerative colitis
PharmGKBiPA267

Chemistry databases

ChEMBLiCHEMBL4302
DrugBankiDB01193 Acebutolol
DB00316 Acetaminophen
DB00945 Acetylsalicylic acid
DB00171 Adenosine triphosphate
DB08916 Afatinib
DB00518 Albendazole
DB04630 Aldosterone
DB11363 Alectinib
DB00802 Alfentanil
DB00523 Alitretinoin
DB00915 Amantadine
DB06403 Ambrisentan
DB00345 Aminohippuric acid
DB01118 Amiodarone
DB00321 Amitriptyline
DB00381 Amlodipine
DB00701 Amprenavir
DB00276 Amsacrine
DB06605 Apixaban
DB01169 Arsenic trioxide
DB00637 Astemizole
DB01072 Atazanavir
DB00335 Atenolol
DB01076 Atorvastatin
DB06626 Axitinib
DB00972 Azelastine
DB00207 Azithromycin
DB01086 Benzocaine
DB01244 Bepridil
DB00443 Betamethasone
DB00810 Biperiden
DB08873 Boceprevir
DB06616 Bosutinib
DB08870 Brentuximab vedotin
DB01200 Bromocriptine
DB00921 Buprenorphine
DB00490 Buspirone
DB06772 Cabazitaxel
DB00201 Caffeine
DB04690 Camptothecin
DB08907 Canagliflozin
DB00796 Candesartan
DB01197 Captopril
DB00564 Carbamazepine
DB08889 Carfilzomib
DB01136 Carvedilol
DB00520 Caspofungin
DB09063 Ceritinib
DB00439 Cerivastatin
DB00608 Chloroquine
DB00477 Chlorpromazine
DB00672 Chlorpropamide
DB01239 Chlorprothixene
DB04540 Cholesterol
DB02659 Cholic Acid
DB01340 Cilazapril
DB00501 Cimetidine
DB00537 Ciprofloxacin
DB00515 Cisplatin
DB00215 Citalopram
DB01211 Clarithromycin
DB00349 Clobazam
DB00845 Clofazimine
DB00882 Clomifene
DB01242 Clomipramine
DB00575 Clonidine
DB00758 Clopidogrel
DB00257 Clotrimazole
DB00363 Clozapine
DB09065 Cobicistat
DB05239 Cobimetinib
DB01394 Colchicine
DB02587 Colforsin
DB00286 Conjugated Equine Estrogens
DB08865 Crizotinib
DB00531 Cyclophosphamide
DB00091 Cyclosporine
DB06695 Dabigatran etexilate
DB08912 Dabrafenib
DB09102 Daclatasvir
DB00970 Dactinomycin
DB06292 Dapagliflozin
DB01254 Dasatinib
DB00694 Daunorubicin
DB04840 Debrisoquin
DB01151 Desipramine
DB00967 Desloratadine
DB01234 Dexamethasone
DB00514 Dextromethorphan
DB00829 Diazepam
DB00586 Diclofenac
DB00255 Diethylstilbestrol
DB01396 Digitoxin
DB00390 Digoxin
DB00320 Dihydroergotamine
DB02901 Dihydrotestosterone
DB00343 Diltiazem
DB00975 Dipyridamole
DB01248 Docetaxel
DB01184 Domperidone
DB00590 Doxazosin
DB01142 Doxepin
DB00997 Doxorubicin
DB00470 Dronabinol
DB04855 Dronedarone
DB09075 Edoxaban
DB04881 Elacridar
DB11574 Elbasvir
DB00216 Eletriptan
DB00584 Enalapril
DB08899 Enzalutamide
DB00751 Epinastine
DB01253 Ergonovine
DB00696 Ergotamine
DB00530 Erlotinib
DB00199 Erythromycin
DB00783 Estradiol
DB01196 Estramustine
DB04573 Estriol
DB00655 Estrone
DB00977 Ethinyl Estradiol
DB00773 Etoposide
DB06414 Etravirine
DB00973 Ezetimibe
DB01023 Felodipine
DB00813 Fentanyl
DB06702 Fesoterodine
DB00950 Fexofenadine
DB08874 Fidaxomicin
DB00196 Fluconazole
DB00472 Fluoxetine
DB00875 Flupentixol
DB00623 Fluphenazine
DB00690 Flurazepam
DB08906 Fluticasone furoate
DB00176 Fluvoxamine
DB05449 FM-VP4
DB00317 Gefitinib
DB00441 Gemcitabine
DB01645 Genistein
DB01016 Glyburide
DB09462 Glycerin
DB04077 Glycerol
DB00027 Gramicidin D
DB11575 Grazoprevir
DB00365 Grepafloxacin
DB00502 Haloperidol
DB00741 Hydrocortisone
DB01050 Ibuprofen
DB09054 Idelalisib
DB00619 Imatinib
DB00458 Imipramine
DB05039 Indacaterol
DB00224 Indinavir
DB00328 Indomethacin
DB00762 Irinotecan
DB06636 Isavuconazonium
DB01167 Itraconazole
DB08820 Ivacaftor
DB00602 Ivermectin
DB01221 Ketamine
DB01587 Ketazolam
DB01026 Ketoconazole
DB00709 Lamivudine
DB00555 Lamotrigine
DB00448 Lansoprazole
DB01259 Lapatinib
DB00480 Lenalidomide
DB09078 Lenvatinib
DB01202 Levetiracetam
DB01137 Levofloxacin
DB08918 Levomilnacipran
DB00451 Levothyroxine
DB00281 Lidocaine
DB08882 Linagliptin
DB00279 Liothyronine
DB01583 Liotrix
DB00722 Lisinopril
DB08827 Lomitapide
DB00836 Loperamide
DB01601 Lopinavir
DB00455 Loratadine
DB00678 Losartan
DB00227 Lovastatin
DB00742 Mannitol
DB00934 Maprotiline
DB00643 Mebendazole
DB00358 Mefloquine
DB00351 Megestrol acetate
DB00371 Meprobamate
DB00333 Methadone
DB00563 Methotrexate
DB00959 Methylprednisolone
DB00264 Metoprolol
DB01388 Mibefradil
DB01110 Miconazole
DB00683 Midazolam
DB00834 Mifepristone
DB08893 Mirabegron
DB00305 Mitomycin
DB01204 Mitoxantrone
DB00295 Morphine
DB00688 Mycophenolate mofetil
DB01203 Nadolol
DB01183 Naloxone
DB00704 Naltrexone
DB03467 Naringenin
DB01149 Nefazodone
DB00220 Nelfinavir
DB01400 Neostigmine
DB00622 Nicardipine
DB01115 Nifedipine
DB04868 Nilotinib
DB09079 Nintedanib
DB00401 Nisoldipine
DB01595 Nitrazepam
DB01054 Nitrendipine
DB00585 Nizatidine
DB00717 Norethisterone
DB00334 Olanzapine
DB09296 Ombitasvir
DB00338 Omeprazole
DB09330 Osimertinib
DB04417 P-Nitrophenol
DB01229 Paclitaxel
DB03796 Palmitic Acid
DB06603 Panobinostat
DB00213 Pantoprazole
DB00715 Paroxetine
DB06589 Pazopanib
DB00790 Perindopril
DB01174 Phenobarbital
DB00252 Phenytoin
DB01100 Pimozide
DB08860 Pitavastatin
DB02261 Platelet Activating Factor
DB08910 Pomalidomide
DB08901 Ponatinib
DB01263 Posaconazole
DB00175 Pravastatin
DB00457 Prazosin
DB00860 Prednisolone
DB00635 Prednisone
DB01032 Probenecid
DB00396 Progesterone
DB01069 Promethazine
DB01182 Propafenone
DB00571 Propranolol
DB00344 Protriptyline
DB04216 Quercetin
DB01224 Quetiapine
DB01103 Quinacrine
DB00908 Quinidine
DB00468 Quinine
DB00863 Ranitidine
DB00234 Reboxetine
DB08896 Regorafenib
DB00206 Reserpine
DB01045 Rifampicin
DB08864 Rilpivirine
DB00734 Risperidone
DB00503 Ritonavir
DB06228 Rivaroxaban
DB09291 Rolapitant
DB06176 Romidepsin
DB00778 Roxithromycin
DB00936 Salicylic acid
DB01232 Saquinavir
DB00747 Scopolamine
DB01037 Selegiline
DB11362 Selexipag
DB01104 Sertraline
DB06207 Silodosin
DB06290 Simeprevir
DB00641 Simvastatin
DB00877 Sirolimus
DB01261 Sitagliptin
DB08934 Sofosbuvir
DB00398 Sorafenib
DB01208 Sparfloxacin
DB03203 Sphingosine
DB00421 Spironolactone
DB01323 St. John's Wort
DB02010 Staurosporine
DB00428 Streptozocin
DB01138 Sulfinpyrazone
DB00669 Sumatriptan
DB01268 Sunitinib
DB00382 Tacrine
DB00864 Tacrolimus
DB00675 Tamoxifen
DB04348 Taurocholic Acid
DB09161 Technetium Tc-99m sestamibi
DB05521 Telaprevir
DB00966 Telmisartan
DB06287 Temsirolimus
DB01162 Terazosin
DB00342 Terfenadine
DB04905 Tesmilifene
DB00624 Testosterone
DB08816 Ticagrelor
DB00373 Timolol
DB06212 Tolvaptan
DB01030 Topotecan
DB00539 Toremifene
DB05773 Trastuzumab emtansine
DB00656 Trazodone
DB00831 Trifluoperazine
DB00508 Triflupromazine
DB00440 Trimethoprim
DB00726 Trimipramine
DB01361 Troleandomycin
DB08867 Ulipristal
DB09076 Umeclidinium
DB01339 Vecuronium
DB11581 Venetoclax
DB00285 Venlafaxine
DB00661 Verapamil
DB00570 Vinblastine
DB00541 Vincristine
DB00361 Vinorelbine
DB08828 Vismodegib
DB04877 Voacamine
DB00495 Zidovudine
DB04832 Zimelidine

Polymorphism and mutation databases

BioMutaiABCB1
DMDMi238054374

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000933321 – 1280Multidrug resistance protein 1Add BLAST1280

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi91N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi94N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi99N-linked (GlcNAc...) asparagineSequence analysis1
Modified residuei660PhosphoserineBy similarity1

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

EPDiP08183
MaxQBiP08183
PaxDbiP08183
PeptideAtlasiP08183
PRIDEiP08183
ProteomicsDBi52080

PTM databases

iPTMnetiP08183
PhosphoSitePlusiP08183

Expressioni

Tissue specificityi

Expressed in liver, kidney, small intestine and brain.

Gene expression databases

BgeeiENSG00000085563
CleanExiHS_ABCB1
ExpressionAtlasiP08183 baseline and differential
GenevisibleiP08183 HS

Organism-specific databases

HPAiCAB001716
HPA002199

Interactioni

Subunit structurei

Interacts with PSMB5. Finds in a complex with ABCB1, TFPI2 and PPP2R3C; leading to the dephosphorylation of ABCB1.2 Publications

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi111262, 17 interactors
IntActiP08183, 8 interactors
MINTiP08183
STRINGi9606.ENSP00000265724

Chemistry databases

BindingDBiP08183

Structurei

Secondary structure

11280
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi45 – 67Combined sources23
Helixi70 – 78Combined sources9
Helixi106 – 156Combined sources51
Helixi160 – 165Combined sources6
Helixi168 – 170Combined sources3
Helixi171 – 185Combined sources15
Helixi188 – 210Combined sources23
Helixi214 – 219Combined sources6
Helixi222 – 259Combined sources38
Helixi261 – 267Combined sources7
Helixi270 – 318Combined sources49
Helixi320 – 323Combined sources4
Helixi328 – 361Combined sources34
Helixi363 – 370Combined sources8
Beta strandi391 – 396Combined sources6
Beta strandi410 – 412Combined sources3
Beta strandi414 – 420Combined sources7
Beta strandi422 – 426Combined sources5
Helixi433 – 440Combined sources8
Beta strandi447 – 449Combined sources3
Turni458 – 460Combined sources3
Helixi463 – 467Combined sources5
Beta strandi470 – 473Combined sources4
Beta strandi481 – 483Combined sources3
Helixi484 – 489Combined sources6
Helixi497 – 507Combined sources11
Helixi511 – 515Combined sources5
Beta strandi516 – 518Combined sources3
Helixi533 – 547Combined sources15
Beta strandi550 – 556Combined sources7
Beta strandi559 – 561Combined sources3
Helixi563 – 575Combined sources13
Beta strandi580 – 585Combined sources6
Helixi590 – 593Combined sources4
Beta strandi596 – 602Combined sources7
Beta strandi605 – 610Combined sources6
Helixi612 – 617Combined sources6
Helixi621 – 629Combined sources9
Helixi697 – 703Combined sources7
Helixi708 – 722Combined sources15
Helixi724 – 739Combined sources16
Beta strandi741 – 743Combined sources3
Helixi748 – 796Combined sources49
Helixi801 – 804Combined sources4
Beta strandi806 – 808Combined sources3
Helixi811 – 829Combined sources19
Helixi831 – 852Combined sources22
Helixi858 – 862Combined sources5
Helixi865 – 902Combined sources38
Helixi904 – 910Combined sources7
Helixi914 – 923Combined sources10
Helixi925 – 965Combined sources41
Helixi971 – 981Combined sources11
Helixi984 – 992Combined sources9
Helixi995 – 1013Combined sources19
Beta strandi1035 – 1042Combined sources8
Beta strandi1045 – 1047Combined sources3
Beta strandi1052 – 1060Combined sources9
Beta strandi1065 – 1069Combined sources5
Beta strandi1074 – 1076Combined sources3
Helixi1077 – 1083Combined sources7
Beta strandi1090 – 1100Combined sources11
Turni1101 – 1103Combined sources3
Helixi1106 – 1112Combined sources7
Beta strandi1114 – 1116Combined sources3
Beta strandi1124 – 1126Combined sources3
Helixi1127 – 1132Combined sources6
Helixi1142 – 1152Combined sources11
Helixi1155 – 1160Combined sources6
Helixi1164 – 1166Combined sources3
Helixi1178 – 1190Combined sources13
Beta strandi1195 – 1201Combined sources7
Helixi1208 – 1220Combined sources13
Beta strandi1225 – 1230Combined sources6
Helixi1234 – 1239Combined sources6
Beta strandi1240 – 1247Combined sources8
Beta strandi1250 – 1255Combined sources6
Helixi1257 – 1262Combined sources6
Helixi1266 – 1272Combined sources7

3D structure databases

ProteinModelPortaliP08183
SMRiP08183
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini51 – 357ABC transmembrane type-1 1PROSITE-ProRule annotationAdd BLAST307
Domaini392 – 628ABC transporter 1PROSITE-ProRule annotationAdd BLAST237
Domaini711 – 1000ABC transmembrane type-1 2PROSITE-ProRule annotationAdd BLAST290
Domaini1035 – 1273ABC transporter 2PROSITE-ProRule annotationAdd BLAST239

Sequence similaritiesi

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG0055 Eukaryota
COG1132 LUCA
GeneTreeiENSGT00530000062896
HOVERGENiHBG080809
InParanoidiP08183
KOiK05658
OMAiMQTRGNE
OrthoDBiEOG091G0HVA
PhylomeDBiP08183
TreeFamiTF105193

Family and domain databases

Gene3Di1.20.1560.10, 2 hits
InterProiView protein in InterPro
IPR003593 AAA+_ATPase
IPR011527 ABC1_TM_dom
IPR036640 ABC1_TM_sf
IPR003439 ABC_transporter-like
IPR017871 ABC_transporter_CS
IPR030258 MDR1
IPR027417 P-loop_NTPase
PANTHERiPTHR24221:SF251 PTHR24221:SF251, 1 hit
PfamiView protein in Pfam
PF00664 ABC_membrane, 2 hits
PF00005 ABC_tran, 2 hits
SMARTiView protein in SMART
SM00382 AAA, 2 hits
SUPFAMiSSF52540 SSF52540, 2 hits
SSF90123 SSF90123, 2 hits
PROSITEiView protein in PROSITE
PS50929 ABC_TM1F, 2 hits
PS00211 ABC_TRANSPORTER_1, 2 hits
PS50893 ABC_TRANSPORTER_2, 2 hits

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P08183-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDLEGDRNGG AKKKNFFKLN NKSEKDKKEK KPTVSVFSMF RYSNWLDKLY
60 70 80 90 100
MVVGTLAAII HGAGLPLMML VFGEMTDIFA NAGNLEDLMS NITNRSDIND
110 120 130 140 150
TGFFMNLEED MTRYAYYYSG IGAGVLVAAY IQVSFWCLAA GRQIHKIRKQ
160 170 180 190 200
FFHAIMRQEI GWFDVHDVGE LNTRLTDDVS KINEGIGDKI GMFFQSMATF
210 220 230 240 250
FTGFIVGFTR GWKLTLVILA ISPVLGLSAA VWAKILSSFT DKELLAYAKA
260 270 280 290 300
GAVAEEVLAA IRTVIAFGGQ KKELERYNKN LEEAKRIGIK KAITANISIG
310 320 330 340 350
AAFLLIYASY ALAFWYGTTL VLSGEYSIGQ VLTVFFSVLI GAFSVGQASP
360 370 380 390 400
SIEAFANARG AAYEIFKIID NKPSIDSYSK SGHKPDNIKG NLEFRNVHFS
410 420 430 440 450
YPSRKEVKIL KGLNLKVQSG QTVALVGNSG CGKSTTVQLM QRLYDPTEGM
460 470 480 490 500
VSVDGQDIRT INVRFLREII GVVSQEPVLF ATTIAENIRY GRENVTMDEI
510 520 530 540 550
EKAVKEANAY DFIMKLPHKF DTLVGERGAQ LSGGQKQRIA IARALVRNPK
560 570 580 590 600
ILLLDEATSA LDTESEAVVQ VALDKARKGR TTIVIAHRLS TVRNADVIAG
610 620 630 640 650
FDDGVIVEKG NHDELMKEKG IYFKLVTMQT AGNEVELENA ADESKSEIDA
660 670 680 690 700
LEMSSNDSRS SLIRKRSTRR SVRGSQAQDR KLSTKEALDE SIPPVSFWRI
710 720 730 740 750
MKLNLTEWPY FVVGVFCAII NGGLQPAFAI IFSKIIGVFT RIDDPETKRQ
760 770 780 790 800
NSNLFSLLFL ALGIISFITF FLQGFTFGKA GEILTKRLRY MVFRSMLRQD
810 820 830 840 850
VSWFDDPKNT TGALTTRLAN DAAQVKGAIG SRLAVITQNI ANLGTGIIIS
860 870 880 890 900
FIYGWQLTLL LLAIVPIIAI AGVVEMKMLS GQALKDKKEL EGSGKIATEA
910 920 930 940 950
IENFRTVVSL TQEQKFEHMY AQSLQVPYRN SLRKAHIFGI TFSFTQAMMY
960 970 980 990 1000
FSYAGCFRFG AYLVAHKLMS FEDVLLVFSA VVFGAMAVGQ VSSFAPDYAK
1010 1020 1030 1040 1050
AKISAAHIIM IIEKTPLIDS YSTEGLMPNT LEGNVTFGEV VFNYPTRPDI
1060 1070 1080 1090 1100
PVLQGLSLEV KKGQTLALVG SSGCGKSTVV QLLERFYDPL AGKVLLDGKE
1110 1120 1130 1140 1150
IKRLNVQWLR AHLGIVSQEP ILFDCSIAEN IAYGDNSRVV SQEEIVRAAK
1160 1170 1180 1190 1200
EANIHAFIES LPNKYSTKVG DKGTQLSGGQ KQRIAIARAL VRQPHILLLD
1210 1220 1230 1240 1250
EATSALDTES EKVVQEALDK AREGRTCIVI AHRLSTIQNA DLIVVFQNGR
1260 1270 1280
VKEHGTHQQL LAQKGIYFSM VSVQAGTKRQ
Length:1,280
Mass (Da):141,479
Last modified:May 26, 2009 - v3
Checksum:iF0230744AB288C73
GO
Isoform 2 (identifier: P08183-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     113-177: RYAYYYSGIGAGVLVAAYIQVSFWCLAAGRQIHKIRKQFFHAIMRQEIGWFDVHDVGELNTRLTD → S

Show »
Length:1,216
Mass (Da):134,032
Checksum:i227233F5F2259A8C
GO

Sequence cautioni

The sequence AAM49149 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti23S → R in CAA41558 (PubMed:2568832).Curated1
Sequence conflicti336Missing in AAB69423 (PubMed:9038218).Curated1

Polymorphismi

Genetic variation in ABCB1 may play a role in patients who do not respond to drug treatment.3 Publications

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02227617F → L1 PublicationCorresponds to variant dbSNP:rs28381804Ensembl.1
Natural variantiVAR_01470421N → D5 PublicationsCorresponds to variant dbSNP:rs9282564Ensembl.1
Natural variantiVAR_05542344N → S. Corresponds to variant dbSNP:rs1202183Ensembl.1
Natural variantiVAR_05542480A → E. Corresponds to variant dbSNP:rs9282565Ensembl.1
Natural variantiVAR_015001103F → L Rare polymorphism. 1 Publication1
Natural variantiVAR_018351108E → K1 Publication1
Natural variantiVAR_015002185G → V in a colchicine-selected multidrug-resistant cell line; confers increased resistance to colchicine. 3 PublicationsCorresponds to variant dbSNP:rs1128501EnsemblClinVar.1
Natural variantiVAR_055425261I → V. Corresponds to variant dbSNP:rs36008564Ensembl.1
Natural variantiVAR_015003400S → N3 PublicationsCorresponds to variant dbSNP:rs2229109EnsemblClinVar.1
Natural variantiVAR_022277566E → K1 PublicationCorresponds to variant dbSNP:rs28381902Ensembl.1
Natural variantiVAR_022278593R → C1 PublicationCorresponds to variant dbSNP:rs28381914Ensembl.1
Natural variantiVAR_055426599A → T. Corresponds to variant dbSNP:rs2235036Ensembl.1
Natural variantiVAR_055427669R → C. Corresponds to variant dbSNP:rs35023033Ensembl.1
Natural variantiVAR_055428801V → M. Corresponds to variant dbSNP:rs2235039Ensembl.1
Natural variantiVAR_055429829I → V. Corresponds to variant dbSNP:rs2032581Ensembl.1
Natural variantiVAR_022279836I → V1 PublicationCorresponds to variant dbSNP:rs28381967Ensembl.1
Natural variantiVAR_035737887K → N in a colorectal cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_013361893S → A Common allele; associated with susceptibility to IBD13; has decreased enzyme activity. 8 PublicationsCorresponds to variant dbSNP:rs2032582EnsemblClinVar.1
Natural variantiVAR_013362893S → T Rare allele. 3 PublicationsCorresponds to variant dbSNP:rs2032582EnsemblClinVar.1
Natural variantiVAR_018352986M → V. Corresponds to variant dbSNP:rs926081975Ensembl.1
Natural variantiVAR_015004999A → T1 PublicationCorresponds to variant dbSNP:rs72552784Ensembl.1
Natural variantiVAR_0222801051P → A1 PublicationCorresponds to variant dbSNP:rs28401798Ensembl.1
Natural variantiVAR_0150051107Q → P1 PublicationCorresponds to variant dbSNP:rs55852620Ensembl.1
Natural variantiVAR_0222811141S → T1 PublicationCorresponds to variant dbSNP:rs2229107Ensembl.1
Natural variantiVAR_0183531251V → I2 PublicationsCorresponds to variant dbSNP:rs28364274Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_055769113 – 177RYAYY…TRLTD → S in isoform 2. 1 PublicationAdd BLAST65

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M14758 mRNA Translation: AAA59575.1
M29447
, M29424, M29425, M29426, M29427, M29428, M29429, M29430, M29431, M29432, M29433, M29434, M29435, M29436, M29437, M29438, M29439, M29440, M29441, M29442, M29443, M29444, M29445, M29446 Genomic DNA Translation: AAA59576.1
AF016535 mRNA Translation: AAB69423.1
EU854148 mRNA Translation: ACF94688.1
AY910577 Genomic DNA Translation: AAW82430.1
AK290159 mRNA Translation: BAF82848.1
AC002457 Genomic DNA Translation: AAM49149.1 Sequence problems.
AC005068 Genomic DNA No translation available.
M37724 Genomic DNA Translation: AAA88047.1
M37725 Genomic DNA Translation: AAA88048.1
X58723 Genomic DNA Translation: CAA41558.1
CCDSiCCDS5608.1 [P08183-1]
PIRiA34914 DVHU1
RefSeqiNP_000918.2, NM_000927.4 [P08183-1]
UniGeneiHs.489033
Hs.689936
Hs.737655

Genome annotation databases

EnsembliENST00000265724; ENSP00000265724; ENSG00000085563 [P08183-1]
ENST00000543898; ENSP00000444095; ENSG00000085563 [P08183-2]
ENST00000622132; ENSP00000478255; ENSG00000085563 [P08183-1]
GeneIDi5243
KEGGihsa:5243
UCSCiuc003uiz.3 human [P08183-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiMDR1_HUMAN
AccessioniPrimary (citable) accession number: P08183
Secondary accession number(s): A8K294
, B5AK60, Q12755, Q14812
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 1, 1988
Last sequence update: May 26, 2009
Last modified: July 18, 2018
This is version 214 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health