Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Low affinity immunoglobulin gamma Fc region receptor II

Gene

Fcgr2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of antigen-antibody complexes from the circulation and modulation of antibody production by B-cells. Isoform IIB1 and isoform IIB1' form caps but fail to mediate endocytosis or phagocytosis. Isoform IIB2 can mediate the endocytosis of soluble immune complexes via clathrin-coated pits. Isoform IIB1 and isoform IIB2 can down-regulate B-cell, T-cell, and mast cell activation when coaggregated to B-cell receptors for AG (BCR), T-cell receptors for AG (TCR), and Fc receptors, respectively.

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionIgG-binding protein, Receptor

Protein family/group databases

MEROPSiI43.001

Names & Taxonomyi

Protein namesi
Recommended name:
Low affinity immunoglobulin gamma Fc region receptor II
Alternative name(s):
Fc gamma receptor IIB
Short name:
Fc-gamma RII
Short name:
Fc-gamma-RIIB
Short name:
FcRII
IgG Fc receptor II beta
Lymphocyte antigen 17
Short name:
Ly-17
CD_antigen: CD32
Gene namesi
Name:Fcgr2
Synonyms:Fcgr2b, Ly-17
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Unplaced

Organism-specific databases

MGIiMGI:95499 Fcgr2b

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini30 – 210ExtracellularSequence analysisAdd BLAST181
Transmembranei211 – 231HelicalSequence analysisAdd BLAST21
Topological domaini232 – 330CytoplasmicSequence analysisAdd BLAST99

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Cytoskeleton, Membrane, Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 29Add BLAST29
ChainiPRO_000001514330 – 330Low affinity immunoglobulin gamma Fc region receptor IIAdd BLAST301

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi57 ↔ 99PROSITE-ProRule annotation
Glycosylationi65N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi92N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi138 ↔ 182PROSITE-ProRule annotation
Glycosylationi166N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi173N-linked (GlcNAc...) asparagineSequence analysis1
Modified residuei290Phosphotyrosine1 Publication1
Modified residuei309Phosphotyrosine; by SRC-type Tyr-kinasesBy similarity1
Modified residuei326Phosphotyrosine1 Publication1

Post-translational modificationi

Glycosylated.
When coaggregated to BCR, isoform IIB1 and isoform IIB1' become tyrosine phosphorylated and bind to the SH2 domains of the protein tyrosine phosphatase PTPC1. Phosphorylated by SRC-type Tyr-kinases such as LYN, BLK, FYN and SYK (By similarity).By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiP08101
PRIDEiP08101

PTM databases

GlyConnecti342
iPTMnetiP08101
PhosphoSitePlusiP08101
UniCarbKBiP08101

Expressioni

Tissue specificityi

Widely expressed by cells of hemopoietic origin. The isoforms are differentially expressed. Isoform IIB1 is preferentially expressed by cells of the lymphoid lineage, isoform IIB2 by cells of the myeloid lineage, and isoform IIB3 is released by macrophages and is present in the serum. Isoform IIB1' is expressed in myeloid and lymphoid cell lines, in normal spleen cells, and in resting or LPS-activated B-cells but is not detected in mesenteric lymph node cells.

Gene expression databases

CleanExiMM_FCGR2B

Interactioni

Subunit structurei

Interacts with FGR (By similarity). Interacts with LYN.By similarity1 Publication

Protein-protein interaction databases

BioGridi199619, 3 interactors
ELMiP08101
IntActiP08101, 1 interactor
MINTiP08101
STRINGi10090.ENSMUSP00000027966

Structurei

3D structure databases

ProteinModelPortaliP08101
SMRiP08101
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini50 – 106Ig-like C2-type 1Add BLAST57
Domaini131 – 189Ig-like C2-type 2Add BLAST59

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi307 – 312ITIM motif6

Domaini

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410J9AP Eukaryota
ENOG410YXNK LUCA
HOVERGENiHBG051602
InParanoidiP08101
KOiK12560
PhylomeDBiP08101

Family and domain databases

Gene3Di2.60.40.10, 2 hits
InterProiView protein in InterPro
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003599 Ig_sub
PfamiView protein in Pfam
PF13895 Ig_2, 2 hits
SMARTiView protein in SMART
SM00409 IG, 2 hits
SUPFAMiSSF48726 SSF48726, 2 hits
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 1 hit

Sequences (4+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform IIB1 (identifier: P08101-1) [UniParc]FASTAAdd to basket
Also known as: Beta-1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MESNWTVHVF SRTLCHMLLW TAVLNLAAGT HDLPKAVVKL EPPWIQVLKE
60 70 80 90 100
DTVTLTCEGT HNPGNSSTQW FHNGRSIRSQ VQASYTFKAT VNDSGEYRCQ
110 120 130 140 150
MEQTRLSDPV DLGVISDWLL LQTPQLVFLE GETITLRCHS WRNKLLNRIS
160 170 180 190 200
FFHNEKSVRY HHYSSNFSIP KANHSHSGDY YCKGSLGRTL HQSKPVTITV
210 220 230 240 250
QGPKSSRSLP VLTIVAAVTG IAVAAIVIIL VSLVYLKKKQ VPALPGNPDH
260 270 280 290 300
REMGETLPEE VGEYRQPSGG SVPVSPGPPS GLEPTSSSPY NPPDLEEAAK
310 320 330
TEAENTITYS LLKHPEALDE ETEHDYQNHI
Length:330
Mass (Da):36,695
Last modified:November 1, 1997 - v2
Checksum:iA463B9EFF2717511
GO
Isoform IIB2 (identifier: P08101-2) [UniParc]FASTAAdd to basket
Also known as: Beta-2

The sequence of this isoform differs from the canonical sequence as follows:
     243-290: ALPGNPDHREMGETLPEEVGEYRQPSGGSVPVSPGPPSGLEPTSSSPY → D

Show »
Length:283
Mass (Da):31,881
Checksum:i84718A2D4D82EC89
GO
Isoform IIB1' (identifier: P08101-3) [UniParc]FASTAAdd to basket
Also known as: Beta-1'

The sequence of this isoform differs from the canonical sequence as follows:
     262-290: GEYRQPSGGSVPVSPGPPSGLEPTSSSPY → D

Show »
Length:302
Mass (Da):33,954
Checksum:i7706C4ADE2EF2CB9
GO
Isoform IIB3 (identifier: P08101-4)
Also known as: Beta-3
Sequence is not available
Length:
Mass (Da):

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0B4J1G1A0A0B4J1G1_MOUSE
Fc receptor, IgG, low affinity IIb
Fcgr2b
293Annotation score:
E9Q415E9Q415_MOUSE
Fc receptor, IgG, low affinity IIb
Fcgr2b
312Annotation score:
A0A0B4J1E6A0A0B4J1E6_MOUSE
Fc receptor, IgG, low affinity IIb
Fcgr2b
340Annotation score:

Sequence cautioni

The sequence CAA28309 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti270 – 278GSVPVSPGP → LSACQPRA in AAA37608 (PubMed:2946078).Curated9
Sequence conflicti299A → P (PubMed:2957319).Curated1
Sequence conflicti299A → P (PubMed:2138587).Curated1

Polymorphismi

Ly-17 alloantigenic system involves residues 116 and 161. Ly-17.1 mice are Pro-116 and Glu-161; Ly-17.2 mice are Leu-116 and Leu-161. These polymorphisms do not affect IgG binding.1 Publication

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural varianti116S → L in strain: DBA/2; Ly17.2 allotype. 1 Publication1
Natural varianti116S → P in strain: NZB; Ly17.1 allotype. 1 Publication1
Natural varianti145L → P. 1
Natural varianti161H → L in strain: DBA/2; Ly17.2 allotype. 1 Publication1
Natural varianti161H → Q in strain: NZB; Ly17.1 allotype. 1 Publication1
Natural varianti190L → Q. 1
Natural varianti195P → T in strain: NZB. 1
Natural varianti287S → I in strain: NZB. 1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_002640243 – 290ALPGN…SSSPY → D in isoform IIB2. 2 PublicationsAdd BLAST48
Alternative sequenceiVSP_002641262 – 290GEYRQ…SSSPY → D in isoform IIB1'. 1 PublicationAdd BLAST29

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M16367 mRNA Translation: AAA37608.1
M14216 mRNA Translation: AAA37609.1
M17515 mRNA Translation: AAA37607.1
M31312 Genomic DNA Translation: AAA37610.1
X04648 mRNA Translation: CAA28309.1 Different initiation.
U31801 mRNA Translation: AAA92707.1
U31802 mRNA Translation: AAA92708.1
U31803 mRNA Translation: AAA92709.1
U31804 mRNA Translation: AAA92710.1
M14276 mRNA Translation: AAA37605.1
U51629 mRNA Translation: AAA97464.1
PIRiA40071
B40071 FCMSG1
I49660
RefSeqiNP_034317.1, NM_010187.2
UniGeneiMm.425062

Genome annotation databases

GeneIDi14130
KEGGimmu:14130
UCSCiuc007dms.2 mouse [P08101-1]
uc007dmt.2 mouse [P08101-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M16367 mRNA Translation: AAA37608.1
M14216 mRNA Translation: AAA37609.1
M17515 mRNA Translation: AAA37607.1
M31312 Genomic DNA Translation: AAA37610.1
X04648 mRNA Translation: CAA28309.1 Different initiation.
U31801 mRNA Translation: AAA92707.1
U31802 mRNA Translation: AAA92708.1
U31803 mRNA Translation: AAA92709.1
U31804 mRNA Translation: AAA92710.1
M14276 mRNA Translation: AAA37605.1
U51629 mRNA Translation: AAA97464.1
PIRiA40071
B40071 FCMSG1
I49660
RefSeqiNP_034317.1, NM_010187.2
UniGeneiMm.425062

3D structure databases

ProteinModelPortaliP08101
SMRiP08101
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi199619, 3 interactors
ELMiP08101
IntActiP08101, 1 interactor
MINTiP08101
STRINGi10090.ENSMUSP00000027966

Protein family/group databases

MEROPSiI43.001

PTM databases

GlyConnecti342
iPTMnetiP08101
PhosphoSitePlusiP08101
UniCarbKBiP08101

Proteomic databases

PaxDbiP08101
PRIDEiP08101

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi14130
KEGGimmu:14130
UCSCiuc007dms.2 mouse [P08101-1]
uc007dmt.2 mouse [P08101-2]

Organism-specific databases

CTDi2213
MGIiMGI:95499 Fcgr2b

Phylogenomic databases

eggNOGiENOG410J9AP Eukaryota
ENOG410YXNK LUCA
HOVERGENiHBG051602
InParanoidiP08101
KOiK12560
PhylomeDBiP08101

Miscellaneous databases

PROiPR:P08101
SOURCEiSearch...

Gene expression databases

CleanExiMM_FCGR2B

Family and domain databases

Gene3Di2.60.40.10, 2 hits
InterProiView protein in InterPro
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003599 Ig_sub
PfamiView protein in Pfam
PF13895 Ig_2, 2 hits
SMARTiView protein in SMART
SM00409 IG, 2 hits
SUPFAMiSSF48726 SSF48726, 2 hits
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiFCGR2_MOUSE
AccessioniPrimary (citable) accession number: P08101
Secondary accession number(s): P08102
, P12316, P97917, Q60938, Q60939, Q60940, Q61170, Q61558
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 1, 1988
Last sequence update: November 1, 1997
Last modified: September 12, 2018
This is version 173 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again