Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P07992 (ERCC1_HUMAN)

Entry version 198 (12 Aug 2020)
Sequence version 1 (01 Aug 1988)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

DNA excision repair protein ERCC-1

Gene

ERCC1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Non-catalytic component of a structure-specific DNA repair endonuclease responsible for the 5'-incision during DNA repair. Responsible, in conjunction with SLX4, for the first step in the repair of interstrand cross-links (ICL). Participates in the processing of anaphase bridge-generating DNA structures, which consist in incompletely processed DNA lesions arising during S or G2 phase, and can result in cytokinesis failure. Also required for homology-directed repair (HDR) of DNA double-strand breaks, in conjunction with SLX4.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi134 – 156Sequence analysisAdd BLAST23

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding, Endonuclease, Hydrolase, Nuclease
Biological processDNA damage, DNA repair

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		P07992

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-5685938, HDR through Single Strand Annealing (SSA)
R-HSA-5696395, Formation of Incision Complex in GG-NER
R-HSA-5696400, Dual Incision in GG-NER
R-HSA-6782135, Dual incision in TC-NER
R-HSA-6783310, Fanconi Anemia Pathway

SIGNOR Signaling Network Open Resource

More...SIGNORi		P07992

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
DNA excision repair protein ERCC-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ERCC1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 19

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000012061.15

Human Gene Nomenclature Database

More...HGNCi		HGNC:3433, ERCC1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		126380, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P07992

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Cerebro-oculo-facio-skeletal syndrome 4 (COFS4)2 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA disorder of prenatal onset characterized by microcephaly, congenital cataracts, facial dysmorphism, neurogenic arthrogryposis, growth failure and severe psychomotor retardation. COFS is considered to be part of the nucleotide-excision repair disorders spectrum that include also xeroderma pigmentosum, trichothiodystrophy and Cockayne syndrome.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_032776231F → L in COFS4; does not alter interaction with XPF/ERCC4 or GTF2H1. 2 PublicationsCorresponds to variant dbSNP:rs121913028EnsemblClinVar.1

Keywords - Diseasei

Cataract

Organism-specific databases

DisGeNET

More...DisGeNETi		2067

GeneReviews a resource of expert-authored, peer-reviewed disease descriptions.

More...GeneReviewsi		ERCC1

MalaCards human disease database

More...MalaCardsi		ERCC1
MIMi610758, phenotype

Open Targets

More...OpenTargetsi		ENSG00000012061

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		90322, Cockayne syndrome type 2
1466, COFS syndrome

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA155

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P07992, Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL3883316

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		ERCC1

Domain mapping of disease mutations (DMDM)

More...DMDMi		119538

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000870061 – 297DNA excision repair protein ERCC-1Add BLAST297

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineCombined sources1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki21Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki37Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki243Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMi

Acetylation, Isopeptide bond, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		P07992

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P07992

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P07992

MaxQB - The MaxQuant DataBase

More...MaxQBi		P07992

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P07992

PeptideAtlas

More...PeptideAtlasi		P07992

PRoteomics IDEntifications database

More...PRIDEi		P07992

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		3611
52055 [P07992-1]
52056 [P07992-2]
52057 [P07992-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P07992

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P07992

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000012061, Expressed in apex of heart and 239 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P07992, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P07992, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000012061, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterodimer composed of ERCC1 isoform 1 and XPF/ERRC4.

3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		108379, 46 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...ComplexPortali		CPX-478, ERCC1-XPF endonuclease complex [P07992-1]

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		P07992

Database of interacting proteins

More...DIPi		DIP-24235N

Protein interaction database and analysis system

More...IntActi		P07992, 25 interactors

Molecular INTeraction database

More...MINTi		P07992

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000013807

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P07992, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1297
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P07992

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		P07992

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni220 – 297HhH2, dimerization with ERCC4Add BLAST78

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi17 – 23Nuclear localization signalSequence analysis7

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the ERCC1/RAD10/SWI10 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG2841, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00390000011275

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P07992

KEGG Orthology (KO)

More...KOi		K10849

Identification of Orthologs from Complete Genome Data

More...OMAi		LNPDYIC

Database of Orthologous Groups

More...OrthoDBi		1336192at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P07992

TreeFam database of animal gene trees

More...TreeFami		TF101231

Family and domain databases

Intrinsically Disordered proteins with Extensive Annotations and Literature

More...IDEALi		IID00364

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR004579, ERCC1/RAD10/SWI10
IPR011335, Restrct_endonuc-II-like
IPR010994, RuvA_2-like

The PANTHER Classification System

More...PANTHERi		PTHR12749, PTHR12749, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF03834, Rad10, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF47781, SSF47781, 1 hit
SSF52980, SSF52980, 1 hit

TIGRFAMs; a protein family database

More...TIGRFAMsi		TIGR00597, rad10, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P07992-1) [UniParc]FASTAAdd to basket
Also known as: 202

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDPGKDKEGV PQPSGPPARK KFVIPLDEDE VPPGVAKPLF RSTQSLPTVD 
        60         70         80         90        100
TSAQAAPQTY AEYAISQPLE GAGATCPTGS EPLAGETPNQ ALKPGAKSNS 
       110        120        130        140        150
IIVSPRQRGN PVLKFVRNVP WEFGDVIPDY VLGQSTCALF LSLRYHNLHP 
       160        170        180        190        200
DYIHGRLQSL GKNFALRVLL VQVDVKDPQQ ALKELAKMCI LADCTLILAW 
       210        220        230        240        250
SPEEAGRYLE TYKAYEQKPA DLLMEKLEQD FVSRVTECLT TVKSVNKTDS 
       260        270        280        290 
QTLLTTFGSL EQLIAASRED LALCPGLGPQ KARRLFDVLH EPFLKVP
Length:297
Mass (Da):32,562
Last modified:August 1, 1988 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i6FCE3615732349E5
GO
Isoform 2 (identifier: P07992-2) [UniParc]FASTAAdd to basket
Also known as: 203

The sequence of this isoform differs from the canonical sequence as follows:
     235-258: Missing.

Note: Not functional in the nucleotide excision repair pathway. Does not interact with XPF/ERCC4.Curated
Show »
Length:273
Mass (Da):29,993
Checksum:i04DA21E774A33524
GO
Isoform 3 (identifier: P07992-3) [UniParc]FASTAAdd to basket
Also known as: 201

The sequence of this isoform differs from the canonical sequence as follows:
     282-297: ARRLFDVLHEPFLKVP → VRALGKNPRSWGKERAPNKHNLRPQSFKVKKEPKTRHSGFRL

Note: Not functional in the nucleotide excision repair pathway. Does not interact with XPF/ERCC4.Curated
Show »
Length:323
Mass (Da):35,563
Checksum:iD99BFAC9CE8E912E
GO
Isoform 4 (identifier: P07992-4) [UniParc]FASTAAdd to basket
Also known as: 204

The sequence of this isoform differs from the canonical sequence as follows:
     36-107: Missing.

Note: Not functional in the nucleotide excision repair pathway. Does not interact with XPF/ERCC4.Curated
Show »
Length:225
Mass (Da):25,211
Checksum:iAF78F4C26AC7DA7E
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
K7ER60K7ER60_HUMAN
DNA excision repair protein ERCC-1
ERCC1
213Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7ER89K7ER89_HUMAN
DNA excision repair protein ERCC-1
ERCC1
234Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EJW9K7EJW9_HUMAN
DNA excision repair protein ERCC-1
ERCC1
112Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EP14K7EP14_HUMAN
DNA excision repair protein ERCC-1
ERCC1
258Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7ES46K7ES46_HUMAN
DNA excision repair protein ERCC-1
ERCC1
209Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EK97K7EK97_HUMAN
DNA excision repair protein ERCC-1
ERCC1
141Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EMT9K7EMT9_HUMAN
DNA excision repair protein ERCC-1
ERCC1
91Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EJL2K7EJL2_HUMAN
DNA excision repair protein ERCC-1
ERCC1
45Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti53A → P in BAG37398 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_032776231F → L in COFS4; does not alter interaction with XPF/ERCC4 or GTF2H1. 2 PublicationsCorresponds to variant dbSNP:rs121913028EnsemblClinVar.1
Natural variantiVAR_019167266A → T1 PublicationCorresponds to variant dbSNP:rs3212977EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_05347436 – 107Missing in isoform 4. 1 PublicationAdd BLAST72
Alternative sequenceiVSP_042727235 – 258Missing in isoform 2. 1 PublicationAdd BLAST24
Alternative sequenceiVSP_043455282 – 297ARRLF…FLKVP → VRALGKNPRSWGKERAPNKH NLRPQSFKVKKEPKTRHSGF RL in isoform 3. 1 PublicationAdd BLAST16

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
M13194 mRNA Translation: AAA52394.1
M26163 Genomic DNA Translation: AAA52395.1
M28650 mRNA Translation: AAA35810.1
AF001925 mRNA Translation: AAC16253.1
AB069681 mRNA Translation: BAB62810.1
BT019806 mRNA Translation: AAV38609.1
AF512555 Genomic DNA Translation: AAM34796.1
AK092039 mRNA Translation: BAG52472.1
AK314884 mRNA Translation: BAG37398.1
AC092309 Genomic DNA No translation available.
AC138128 Genomic DNA No translation available.
AC138534 Genomic DNA No translation available.
AC139353 Genomic DNA No translation available.
CH471126 Genomic DNA Translation: EAW57349.1
BC008930 mRNA Translation: AAH08930.1
BC052813 mRNA Translation: AAH52813.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS12662.1 [P07992-1]
CCDS12663.1 [P07992-3]
CCDS54279.1 [P07992-2]

Protein sequence database of the Protein Information Resource

More...PIRi		A32875, A24781

NCBI Reference Sequences

More...RefSeqi		NP_001159521.1, NM_001166049.1 [P07992-2]
NP_001974.1, NM_001983.3 [P07992-1]
NP_973730.1, NM_202001.2 [P07992-3]
XP_005258691.1, XM_005258634.1
XP_005258692.1, XM_005258635.2
XP_005258693.1, XM_005258636.4
XP_011524912.1, XM_011526610.2
XP_016881948.1, XM_017026459.1
XP_016881949.1, XM_017026460.1
XP_016881950.1, XM_017026461.1
XP_016881951.1, XM_017026462.1
XP_016881952.1, XM_017026463.1
XP_016881953.1, XM_017026464.1
XP_016881954.1, XM_017026465.1
XP_016881955.1, XM_017026466.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000013807; ENSP00000013807; ENSG00000012061 [P07992-3]
ENST00000300853; ENSP00000300853; ENSG00000012061 [P07992-1]
ENST00000340192; ENSP00000345203; ENSG00000012061 [P07992-2]
ENST00000423698; ENSP00000394875; ENSG00000012061 [P07992-4]
ENST00000589165; ENSP00000468035; ENSG00000012061 [P07992-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		2067

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:2067

UCSC genome browser

More...UCSCi		uc002pbs.3, human [P07992-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology
NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M13194 mRNA Translation: AAA52394.1
M26163 Genomic DNA Translation: AAA52395.1
M28650 mRNA Translation: AAA35810.1
AF001925 mRNA Translation: AAC16253.1
AB069681 mRNA Translation: BAB62810.1
BT019806 mRNA Translation: AAV38609.1
AF512555 Genomic DNA Translation: AAM34796.1
AK092039 mRNA Translation: BAG52472.1
AK314884 mRNA Translation: BAG37398.1
AC092309 Genomic DNA No translation available.
AC138128 Genomic DNA No translation available.
AC138534 Genomic DNA No translation available.
AC139353 Genomic DNA No translation available.
CH471126 Genomic DNA Translation: EAW57349.1
BC008930 mRNA Translation: AAH08930.1
BC052813 mRNA Translation: AAH52813.1
CCDSiCCDS12662.1 [P07992-1]
CCDS12663.1 [P07992-3]
CCDS54279.1 [P07992-2]
PIRiA32875, A24781
RefSeqiNP_001159521.1, NM_001166049.1 [P07992-2]
NP_001974.1, NM_001983.3 [P07992-1]
NP_973730.1, NM_202001.2 [P07992-3]
XP_005258691.1, XM_005258634.1
XP_005258692.1, XM_005258635.2
XP_005258693.1, XM_005258636.4
XP_011524912.1, XM_011526610.2
XP_016881948.1, XM_017026459.1
XP_016881949.1, XM_017026460.1
XP_016881950.1, XM_017026461.1
XP_016881951.1, XM_017026462.1
XP_016881952.1, XM_017026463.1
XP_016881953.1, XM_017026464.1
XP_016881954.1, XM_017026465.1
XP_016881955.1, XM_017026466.1

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1Z00NMR-A220-297[»]
2A1IX-ray1.90A96-227[»]
2A1JX-ray2.70B220-296[»]
2JNWNMR-A96-214[»]
2JPDNMR-A96-219[»]
2MUTNMR-A220-297[»]
6SXAelectron microscopy3.60G1-297[»]
6SXBelectron microscopy7.90G1-297[»]
SMRiP07992
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi108379, 46 interactors
ComplexPortaliCPX-478, ERCC1-XPF endonuclease complex [P07992-1]
CORUMiP07992
DIPiDIP-24235N
IntActiP07992, 25 interactors
MINTiP07992
STRINGi9606.ENSP00000013807

Chemistry databases

ChEMBLiCHEMBL3883316

PTM databases

iPTMnetiP07992
PhosphoSitePlusiP07992

Polymorphism and mutation databases

BioMutaiERCC1
DMDMi119538

Proteomic databases

EPDiP07992
jPOSTiP07992
MassIVEiP07992
MaxQBiP07992
PaxDbiP07992
PeptideAtlasiP07992
PRIDEiP07992
ProteomicsDBi3611
52055 [P07992-1]
52056 [P07992-2]
52057 [P07992-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		3826, 1233 antibodies

The DNASU plasmid repository

More...DNASUi		2067

Genome annotation databases

EnsembliENST00000013807; ENSP00000013807; ENSG00000012061 [P07992-3]
ENST00000300853; ENSP00000300853; ENSG00000012061 [P07992-1]
ENST00000340192; ENSP00000345203; ENSG00000012061 [P07992-2]
ENST00000423698; ENSP00000394875; ENSG00000012061 [P07992-4]
ENST00000589165; ENSP00000468035; ENSG00000012061 [P07992-1]
GeneIDi2067
KEGGihsa:2067
UCSCiuc002pbs.3, human [P07992-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		2067
DisGeNETi2067
EuPathDBiHostDB:ENSG00000012061.15

GeneCards: human genes, protein and diseases

More...GeneCardsi		ERCC1
GeneReviewsiERCC1
HGNCiHGNC:3433, ERCC1
HPAiENSG00000012061, Low tissue specificity
MalaCardsiERCC1
MIMi126380, gene
610758, phenotype
neXtProtiNX_P07992
OpenTargetsiENSG00000012061
Orphaneti90322, Cockayne syndrome type 2
1466, COFS syndrome
PharmGKBiPA155

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG2841, Eukaryota
GeneTreeiENSGT00390000011275
InParanoidiP07992
KOiK10849
OMAiLNPDYIC
OrthoDBi1336192at2759
PhylomeDBiP07992
TreeFamiTF101231

Enzyme and pathway databases

PathwayCommonsiP07992
ReactomeiR-HSA-5685938, HDR through Single Strand Annealing (SSA)
R-HSA-5696395, Formation of Incision Complex in GG-NER
R-HSA-5696400, Dual Incision in GG-NER
R-HSA-6782135, Dual incision in TC-NER
R-HSA-6783310, Fanconi Anemia Pathway
SIGNORiP07992

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		2067, 52 hits in 876 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		ERCC1, human
EvolutionaryTraceiP07992

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		ERCC1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		2067
PharosiP07992, Tbio

Protein Ontology

More...PROi		PR:P07992
RNActiP07992, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000012061, Expressed in apex of heart and 239 other tissues
ExpressionAtlasiP07992, baseline and differential
GenevisibleiP07992, HS

Family and domain databases

IDEALiIID00364
InterProiView protein in InterPro
IPR004579, ERCC1/RAD10/SWI10
IPR011335, Restrct_endonuc-II-like
IPR010994, RuvA_2-like
PANTHERiPTHR12749, PTHR12749, 1 hit
PfamiView protein in Pfam
PF03834, Rad10, 1 hit
SUPFAMiSSF47781, SSF47781, 1 hit
SSF52980, SSF52980, 1 hit
TIGRFAMsiTIGR00597, rad10, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiERCC1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P07992
Secondary accession number(s): B2RC01
, B3KRR0, Q7Z7F5, Q96S40
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 1, 1988
Last sequence update: August 1, 1988
Last modified: August 12, 2020
This is version 198 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again