Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Uromodulin

Gene

UMOD

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Uromodulin: Functions in biogenesis and organization of the apical membrane of epithelial cells of the thick ascending limb of Henle's loop (TALH), where it promotes formation of complex filamentous gel-like structure that may play a role in the water barrier permeability (Probable). May serve as a receptor for binding and endocytosis of cytokines (IL-1, IL-2) and TNF (PubMed:3498215). Facilitates neutrophil migration across renal epithelia (PubMed:20798515).Curated2 Publications
Uromodulin, secreted form: In the urine, may contribute to colloid osmotic pressure, retards passage of positively charged electrolytes, prevents urinary tract infection and inhibits formation of liquid containing supersaturated salts and subsequent formation of salt crystals.By similarityCurated

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • calcium ion binding Source: InterPro
  • IgG binding Source: BHF-UCL

GO - Biological processi

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-446203 Asparagine N-linked glycosylation

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P07911

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Uromodulin
Alternative name(s):
Tamm-Horsfall urinary glycoprotein
Short name:
THP
Cleaved into the following chain:
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:UMOD
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000169344.15

Human Gene Nomenclature Database

More...
HGNCi
HGNC:12559 UMOD

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
191845 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P07911

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell membrane, Cell projection, Cilium, Membrane, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Familial juvenile hyperuricemic nephropathy 1 (HNFJ1)14 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA renal disease characterized by juvenile onset of hyperuricemia, polyuria, progressive renal failure, and gout. The disease is associated with interstitial pathological changes resulting in fibrosis.
See also OMIM:162000
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_07305252C → W in HNFJ1. 1 Publication1
Natural variantiVAR_07305359D → A in HNFJ1; results in defective trafficking of mutant protein to the plasma membrane; the mutant is retained in the ER. 2 Publications1
Natural variantiVAR_02595077C → Y in HNFJ1. 1 PublicationCorresponds to variant dbSNP:rs121917768EnsemblClinVar.1
Natural variantiVAR_071398109V → E in HNFJ1; causes a delay in protein export to the plasma membrane due to a longer retention time in the ER. 1 PublicationCorresponds to variant dbSNP:rs780462125EnsemblClinVar.1
Natural variantiVAR_073054112C → R in HNFJ1. 1 Publication1
Natural variantiVAR_025952126C → R in HNFJ1. 2 PublicationsCorresponds to variant dbSNP:rs121917769EnsemblClinVar.1
Natural variantiVAR_025953128N → S in HNFJ1; results in defective trafficking of mutant protein to the plasma membrane; the mutant is retained in the ER. 2 PublicationsCorresponds to variant dbSNP:rs121917770EnsemblClinVar.1
Natural variantiVAR_073055135C → S in HNFJ1. 1 Publication1
Natural variantiVAR_025954148C → W in HNFJ1; phenotype overlapping with medullary cystic kidney disease; causes a delay in protein export to the plasma membrane due to a longer retention time in the ER. 2 Publications1
Natural variantiVAR_017667148C → Y in HNFJ1. 1 PublicationCorresponds to variant dbSNP:rs28934582EnsemblClinVar.1
Natural variantiVAR_025955150C → S in HNFJ1; phenotype overlapping with medullary cystic kidney disease; causes a delay in protein export to the plasma membrane due to a longer retention time in the ER; results is abnormal intracellular polymerization of the mutant protein. 3 Publications1
Natural variantiVAR_073057170C → Y in HNFJ1. 1 Publication1
Natural variantiVAR_073058185R → S in HNFJ1. 1 Publication1
Natural variantiVAR_073059195C → F in HNFJ1. 1 Publication1
Natural variantiVAR_073060202W → S in HNFJ1. 1 Publication1
Natural variantiVAR_073061204R → G in HNFJ1; results in defective trafficking of mutant protein to the plasma membrane; the mutant is retained in the ER. 2 Publications1
Natural variantiVAR_073062217C → G in HNFJ1. 1 PublicationCorresponds to variant dbSNP:rs28934583EnsemblClinVar.1
Natural variantiVAR_017668217C → R in HNFJ1; results in defective trafficking of mutant protein to the plasma membrane; the mutant is retained in the ER. 2 PublicationsCorresponds to variant dbSNP:rs28934583EnsemblClinVar.1
Natural variantiVAR_073063222R → P in HNFJ1. 1 Publication1
Natural variantiVAR_025956223C → Y in HNFJ1. 1 Publication1
Natural variantiVAR_073064225T → M in HNFJ1. 1 Publication1
Natural variantiVAR_071399230W → R in HNFJ1. 1 Publication1
Natural variantiVAR_073065236P → L in HNFJ1. 1 PublicationCorresponds to variant dbSNP:rs1447458978Ensembl.1
Natural variantiVAR_071400236P → Q in HNFJ1; causes a delay in protein export to the plasma membrane due to a longer retention time in the ER. 1 Publication1
Natural variantiVAR_073066236P → R in HNFJ1; results in defective trafficking of mutant protein to the plasma membrane; the mutant is retained in the ER. 1 Publication1
Natural variantiVAR_025958248C → W in MCKD2 and HNFJ1; causes a delay in protein export to the plasma membrane due to a longer retention time in the ER. 2 PublicationsCorresponds to variant dbSNP:rs886043751EnsemblClinVar.1
Natural variantiVAR_025959255C → Y in HNFJ1. 1 PublicationCorresponds to variant dbSNP:rs121917771EnsemblClinVar.1
Natural variantiVAR_073067282C → R in HNFJ1. 1 Publication1
Natural variantiVAR_025960300C → G in HNFJ1. 1 PublicationCorresponds to variant dbSNP:rs121917772EnsemblClinVar.1
Natural variantiVAR_073068316Q → P in HNFJ1. 1 Publication1
Natural variantiVAR_025962317C → Y in HNFJ1; phenotype overlapping with medullary cystic kidney disease; causes a delay in protein export to the plasma membrane due to a longer retention time in the ER. 1 Publication1
Natural variantiVAR_073069347C → G in HNFJ1; causes a delay in protein export to the plasma membrane due to a longer retention time in the ER. 1 Publication1
Natural variantiVAR_071401461A → E in HNFJ1. 1 Publication1
Medullary cystic kidney disease 2 (MCKD2)6 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of tubulointerstitial nephropathy characterized by formation of renal cysts at the corticomedullary junction. It is characterized by adult onset of impaired renal function and salt wasting resulting in end-stage renal failure by the sixth decade.
See also OMIM:603860
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02595193 – 97VCPEG → AASC in MCKD2; results in mutant retention in the ER; results is abnormal intracellular polymerization of the mutant protein. 2 Publications5
Natural variantiVAR_017666103G → C in MCKD2. 1 PublicationCorresponds to variant dbSNP:rs28934584EnsemblClinVar.1
Natural variantiVAR_077514120C → G in MCKD2; serum levels severely reduced. 1 Publication1
Natural variantiVAR_025957225T → K in MCKD2; results in defective trafficking of mutant protein to the plasma membrane; the mutant is retained in the ER. 2 Publications1
Natural variantiVAR_025958248C → W in MCKD2 and HNFJ1; causes a delay in protein export to the plasma membrane due to a longer retention time in the ER. 2 PublicationsCorresponds to variant dbSNP:rs886043751EnsemblClinVar.1
Glomerulocystic kidney disease with hyperuricemia and isosthenuria (GCKDHI)2 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA renal disorder characterized by a cystic dilation of Bowman space, a collapse of glomerular tuft, and hyperuricemia due to low fractional excretion of uric acid and severe impairment of urine concentrating ability.
See also OMIM:609886
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_025961315C → R in GCKDHI; causes a delay in protein export to the plasma membrane due to a longer retention time in the ER. 2 PublicationsCorresponds to variant dbSNP:rs121917773EnsemblClinVar.1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi333L → K: Abolishes polymerization and filament formation of the secreted form. 1 Publication1
Mutagenesisi421I → K: Abolishes polymerization and filament formation of the secreted form. 1 Publication1
Mutagenesisi430D → L: Impairs polymerization and filament formation of the secreted form. 1 Publication1
Mutagenesisi435L → S: Impairs polymerization and filament formation of the secreted form. 1 Publication1
Mutagenesisi458V → R: Leads to retention in the endoplasmic reticulum, probably due to misfolding. 1 Publication1
Mutagenesisi586 – 589RFRS → AAAA: Abolishes cleavage by HPN. 3 Publications4
Mutagenesisi598 – 600VLN → AAA: Decreased export from the endoplasmic reticulum, leading to decreased secretion. Impairs polymerization. 1 Publication3
Mutagenesisi602 – 603GP → AA: Decreased export from the endoplasmic reticulum, leading to decreased secretion. Impairs polymerization. 1 Publication2
Mutagenesisi605 – 607TRK → AAA: No effect on secretion. Does not impair polymerization. 1 Publication3

Keywords - Diseasei

Ciliopathy, Disease mutation, Nephronophthisis

Organism-specific databases

DisGeNET

More...
DisGeNETi
7369

GeneReviews a resource of expert-authored, peer-reviewed disease descriptions.

More...
GeneReviewsi
UMOD

MalaCards human disease database

More...
MalaCardsi
UMOD
MIMi162000 phenotype
603860 phenotype
609886 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000169344

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
209886 Familial juvenile hyperuricemic nephropathy type 1
88950 UMOD-related autosomal dominant tubulointerstitial kidney disease

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA37199

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
UMOD

Domain mapping of disease mutations (DMDM)

More...
DMDMi
137116

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 24Add BLAST24
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000004167125 – 614UromodulinAdd BLAST590
ChainiPRO_000040790925 – 587Uromodulin, secreted formAdd BLAST563
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes a propeptide, which is a part of a protein that is cleaved during maturation or activation. Once cleaved, a propeptide generally has no independent biological function.<p><a href='/help/propep' target='_top'>More...</a></p>PropeptideiPRO_0000041672615 – 640Removed in mature formSequence analysisAdd BLAST26

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi32 ↔ 41PROSITE-ProRule annotation
Disulfide bondi35 ↔ 50PROSITE-ProRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi38N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi52 ↔ 63PROSITE-ProRule annotation
Disulfide bondi69 ↔ 83PROSITE-ProRule annotation
Glycosylationi76N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi77 ↔ 92PROSITE-ProRule annotation
Glycosylationi80N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi94 ↔ 106PROSITE-ProRule annotation
Disulfide bondi112 ↔ 126PROSITE-ProRule annotation
Disulfide bondi120 ↔ 135PROSITE-ProRule annotation
Disulfide bondi137 ↔ 148PROSITE-ProRule annotation
Glycosylationi232N-linked (GlcNAc...) (complex) asparagine2 Publications1
GlycosylationiCAR_000178275N-linked (GlcNAc...) asparagine1
Disulfide bondi297 ↔ 3061 Publication
Disulfide bondi300 ↔ 3151 Publication
Disulfide bondi317 ↔ 3471 Publication
Glycosylationi322N-linked (GlcNAc...) (complex) asparagine1 Publication1
Disulfide bondi335 ↔ 4251 Publication
Disulfide bondi366 ↔ 3891 Publication
Glycosylationi396N-linked (GlcNAc...) (complex) asparagine1 Publication1
Disulfide bondi506 ↔ 566PROSITE-ProRule annotation1 Publication
Disulfide bondi527 ↔ 5821 Publication
Disulfide bondi571 ↔ 5781 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi614GPI-anchor amidated serineSequence analysis1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

N-glycosylated (PubMed:19005207, PubMed:26673890, PubMed:26811476). N-glycan heterogeneity at Asn-232: Hex7HexNAc6 (major) and dHex1Hex7HexNAc6 (minor); at Asn-322: dHex1Hex6HexNAc5 (minor), dHex1Hex7HexNAc6 (major) and dHex1Hex8HexNAc7 (minor); at Asn-396: Hex6HexNAc5 (major), dHex1Hex6HexNAc5 (minor) and Hex7HexNAc6 (minor) (PubMed:22171320).4 Publications
Proteolytically cleaved at a conserved C-terminal proteolytic cleavage site to generate the secreted form found in urine (PubMed:18375198, PubMed:19005207). This cleavage is catalyzed by HPN (PubMed:26673890).3 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei587 – 588Cleavage1 Publication2

Keywords - PTMi

Disulfide bond, Glycoprotein, GPI-anchor, Lipoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P07911

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P07911

PeptideAtlas

More...
PeptideAtlasi
P07911

PRoteomics IDEntifications database

More...
PRIDEi
P07911

ProteomicsDB human proteome resource

More...
ProteomicsDBi
52038
52039 [P07911-2]
52040 [P07911-3]
52041 [P07911-4]

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
613

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P07911

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P07911

UniCarbKB; an annotated and curated database of glycan structures

More...
UniCarbKBi
P07911

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in the tubular cells of the kidney. Most abundant protein in normal urine (at protein level). Synthesized exclusively in the kidney. Expressed exclusively by epithelial cells of the thick ascending limb of Henle's loop (TALH) and of distal convoluted tubule lumen.5 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000169344 Expressed in 55 organ(s), highest expression level in renal medulla

CleanEx database of gene expression profiles

More...
CleanExi
HS_UMOD

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P07911 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P07911 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB009446
HPA043420
HPA054721

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Uromodulin, secreted form: homodimer that then polymerizes into long filaments.3 Publications

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
113216, 2 interactors

Protein interaction database and analysis system

More...
IntActi
P07911, 2 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000306279

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1640
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4WRNX-ray3.20A/B295-610[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P07911

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P07911

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini28 – 64EGF-like 1PROSITE-ProRule annotationAdd BLAST37
Domaini65 – 107EGF-like 2; calcium-bindingPROSITE-ProRule annotationAdd BLAST43
Domaini108 – 149EGF-like 3; calcium-bindingPROSITE-ProRule annotationAdd BLAST42
Domaini334 – 589ZPPROSITE-ProRule annotationAdd BLAST256

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni430 – 453Important for secretion and polymerization into filaments1 PublicationAdd BLAST24
Regioni586 – 589Essential for cleavage by HPN3 Publications4
Regioni598 – 607Regulates polymerization into filaments1 Publication10

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The ZP domain mediates polymerization, leading to the formation of long filaments.1 Publication

Keywords - Domaini

EGF-like domain, Repeat, Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IVSV Eukaryota
ENOG410YDU6 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156742

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000293303

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG004349

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P07911

KEGG Orthology (KO)

More...
KOi
K18274

Database of Orthologous Groups

More...
OrthoDBi
665331at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P07911

TreeFam database of animal gene trees

More...
TreeFami
TF330284

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001881 EGF-like_Ca-bd_dom
IPR013032 EGF-like_CS
IPR000742 EGF-like_dom
IPR000152 EGF-type_Asp/Asn_hydroxyl_site
IPR018097 EGF_Ca-bd_CS
IPR024731 EGF_dom
IPR009030 Growth_fac_rcpt_cys_sf
IPR001507 ZP_dom
IPR017977 ZP_dom_CS

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12947 EGF_3, 1 hit
PF07645 EGF_CA, 2 hits
PF00100 Zona_pellucida, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00023 ZPELLUCIDA

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00181 EGF, 3 hits
SM00179 EGF_CA, 2 hits
SM00241 ZP, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF57184 SSF57184, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00010 ASX_HYDROXYL, 2 hits
PS01186 EGF_2, 3 hits
PS50026 EGF_3, 3 hits
PS01187 EGF_CA, 2 hits
PS00682 ZP_1, 1 hit
PS51034 ZP_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P07911-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGQPSLTWML MVVVASWFIT TAATDTSEAR WCSECHSNAT CTEDEAVTTC
60 70 80 90 100
TCQEGFTGDG LTCVDLDECA IPGAHNCSAN SSCVNTPGSF SCVCPEGFRL
110 120 130 140 150
SPGLGCTDVD ECAEPGLSHC HALATCVNVV GSYLCVCPAG YRGDGWHCEC
160 170 180 190 200
SPGSCGPGLD CVPEGDALVC ADPCQAHRTL DEYWRSTEYG EGYACDTDLR
210 220 230 240 250
GWYRFVGQGG ARMAETCVPV LRCNTAAPMW LNGTHPSSDE GIVSRKACAH
260 270 280 290 300
WSGHCCLWDA SVQVKACAGG YYVYNLTAPP ECHLAYCTDP SSVEGTCEEC
310 320 330 340 350
SIDEDCKSNN GRWHCQCKQD FNITDISLLE HRLECGANDM KVSLGKCQLK
360 370 380 390 400
SLGFDKVFMY LSDSRCSGFN DRDNRDWVSV VTPARDGPCG TVLTRNETHA
410 420 430 440 450
TYSNTLYLAD EIIIRDLNIK INFACSYPLD MKVSLKTALQ PMVSALNIRV
460 470 480 490 500
GGTGMFTVRM ALFQTPSYTQ PYQGSSVTLS TEAFLYVGTM LDGGDLSRFA
510 520 530 540 550
LLMTNCYATP SSNATDPLKY FIIQDRCPHT RDSTIQVVEN GESSQGRFSV
560 570 580 590 600
QMFRFAGNYD LVYLHCEVYL CDTMNEKCKP TCSGTRFRSG SVIDQSRVLN
610 620 630 640
LGPITRKGVQ ATVSRAFSSL GLLKVWLPLL LSATLTLTFQ
Length:640
Mass (Da):69,761
Last modified:August 1, 1988 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD26A07A76353AE48
GO
Isoform 2 (identifier: P07911-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     67-199: Missing.

Note: No experimental confirmation available.
Show »
Length:507
Mass (Da):55,960
Checksum:iFBFC739EA15E3D22
GO
Isoform 3 (identifier: P07911-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     205-234: FVGQGGARMAETCVPVLRCNTAAPMWLNGT → P

Note: No experimental confirmation available.
Show »
Length:611
Mass (Da):66,724
Checksum:i459663CEADC74EA3
GO
Isoform 4 (identifier: P07911-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     133-154: Missing.

Show »
Length:618
Mass (Da):67,418
Checksum:iAF3732AED73ADEF2
GO
Isoform 5 (identifier: P07911-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     29-29: A → ARTKYNCPARWSWRTPQRGGDTEQGPDEDFTSQG

Show »
Length:673
Mass (Da):73,571
Checksum:i55D7B9D0F81974C0
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
I3L1M3I3L1M3_HUMAN
Uromodulin
UMOD
125Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L3E0I3L3E0_HUMAN
Uromodulin
UMOD
161Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L4Y6I3L4Y6_HUMAN
Uromodulin
UMOD
102Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L3Z4I3L3Z4_HUMAN
Uromodulin
UMOD
161Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L2J2I3L2J2_HUMAN
Uromodulin
UMOD
88Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
X6RBG4X6RBG4_HUMAN
Uromodulin
UMOD
689Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L4B0I3L4B0_HUMAN
Uromodulin
UMOD
86Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L2K2I3L2K2_HUMAN
Uromodulin
UMOD
138Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q8NHW8Q8NHW8_HUMAN
Uromodulin
UMOD
29Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti288T → A in BAG51560 (PubMed:14702039).Curated1
Sequence conflicti503M → I in BAG51560 (PubMed:14702039).Curated1
Sequence conflicti565H → D in AAA36799 (PubMed:3498215).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_07305252C → W in HNFJ1. 1 Publication1
Natural variantiVAR_07305359D → A in HNFJ1; results in defective trafficking of mutant protein to the plasma membrane; the mutant is retained in the ER. 2 Publications1
Natural variantiVAR_02595077C → Y in HNFJ1. 1 PublicationCorresponds to variant dbSNP:rs121917768EnsemblClinVar.1
Natural variantiVAR_02595193 – 97VCPEG → AASC in MCKD2; results in mutant retention in the ER; results is abnormal intracellular polymerization of the mutant protein. 2 Publications5
Natural variantiVAR_017666103G → C in MCKD2. 1 PublicationCorresponds to variant dbSNP:rs28934584EnsemblClinVar.1
Natural variantiVAR_071398109V → E in HNFJ1; causes a delay in protein export to the plasma membrane due to a longer retention time in the ER. 1 PublicationCorresponds to variant dbSNP:rs780462125EnsemblClinVar.1
Natural variantiVAR_073054112C → R in HNFJ1. 1 Publication1
Natural variantiVAR_077514120C → G in MCKD2; serum levels severely reduced. 1 Publication1
Natural variantiVAR_025952126C → R in HNFJ1. 2 PublicationsCorresponds to variant dbSNP:rs121917769EnsemblClinVar.1
Natural variantiVAR_025953128N → S in HNFJ1; results in defective trafficking of mutant protein to the plasma membrane; the mutant is retained in the ER. 2 PublicationsCorresponds to variant dbSNP:rs121917770EnsemblClinVar.1
Natural variantiVAR_073055135C → S in HNFJ1. 1 Publication1
Natural variantiVAR_025954148C → W in HNFJ1; phenotype overlapping with medullary cystic kidney disease; causes a delay in protein export to the plasma membrane due to a longer retention time in the ER. 2 Publications1
Natural variantiVAR_017667148C → Y in HNFJ1. 1 PublicationCorresponds to variant dbSNP:rs28934582EnsemblClinVar.1
Natural variantiVAR_025955150C → S in HNFJ1; phenotype overlapping with medullary cystic kidney disease; causes a delay in protein export to the plasma membrane due to a longer retention time in the ER; results is abnormal intracellular polymerization of the mutant protein. 3 Publications1
Natural variantiVAR_073056155C → R Probable-disease association mutation found in a patient with cystic kidney disease; results in mutant retention in the ER; results is abnormal intracellular polymerization of the mutant protein. 1 Publication1
Natural variantiVAR_073057170C → Y in HNFJ1. 1 Publication1
Natural variantiVAR_073058185R → S in HNFJ1. 1 Publication1
Natural variantiVAR_073059195C → F in HNFJ1. 1 Publication1
Natural variantiVAR_073060202W → S in HNFJ1. 1 Publication1
Natural variantiVAR_073061204R → G in HNFJ1; results in defective trafficking of mutant protein to the plasma membrane; the mutant is retained in the ER. 2 Publications1
Natural variantiVAR_073062217C → G in HNFJ1. 1 PublicationCorresponds to variant dbSNP:rs28934583EnsemblClinVar.1
Natural variantiVAR_017668217C → R in HNFJ1; results in defective trafficking of mutant protein to the plasma membrane; the mutant is retained in the ER. 2 PublicationsCorresponds to variant dbSNP:rs28934583EnsemblClinVar.1
Natural variantiVAR_073063222R → P in HNFJ1. 1 Publication1
Natural variantiVAR_025956223C → Y in HNFJ1. 1 Publication1
Natural variantiVAR_025957225T → K in MCKD2; results in defective trafficking of mutant protein to the plasma membrane; the mutant is retained in the ER. 2 Publications1
Natural variantiVAR_073064225T → M in HNFJ1. 1 Publication1
Natural variantiVAR_071399230W → R in HNFJ1. 1 Publication1
Natural variantiVAR_073065236P → L in HNFJ1. 1 PublicationCorresponds to variant dbSNP:rs1447458978Ensembl.1
Natural variantiVAR_071400236P → Q in HNFJ1; causes a delay in protein export to the plasma membrane due to a longer retention time in the ER. 1 Publication1
Natural variantiVAR_073066236P → R in HNFJ1; results in defective trafficking of mutant protein to the plasma membrane; the mutant is retained in the ER. 1 Publication1
Natural variantiVAR_025958248C → W in MCKD2 and HNFJ1; causes a delay in protein export to the plasma membrane due to a longer retention time in the ER. 2 PublicationsCorresponds to variant dbSNP:rs886043751EnsemblClinVar.1
Natural variantiVAR_025959255C → Y in HNFJ1. 1 PublicationCorresponds to variant dbSNP:rs121917771EnsemblClinVar.1
Natural variantiVAR_073067282C → R in HNFJ1. 1 Publication1
Natural variantiVAR_025960300C → G in HNFJ1. 1 PublicationCorresponds to variant dbSNP:rs121917772EnsemblClinVar.1
Natural variantiVAR_025961315C → R in GCKDHI; causes a delay in protein export to the plasma membrane due to a longer retention time in the ER. 2 PublicationsCorresponds to variant dbSNP:rs121917773EnsemblClinVar.1
Natural variantiVAR_073068316Q → P in HNFJ1. 1 Publication1
Natural variantiVAR_025962317C → Y in HNFJ1; phenotype overlapping with medullary cystic kidney disease; causes a delay in protein export to the plasma membrane due to a longer retention time in the ER. 1 Publication1
Natural variantiVAR_073069347C → G in HNFJ1; causes a delay in protein export to the plasma membrane due to a longer retention time in the ER. 1 Publication1
Natural variantiVAR_061993458V → L. Corresponds to variant dbSNP:rs55772253EnsemblClinVar.1
Natural variantiVAR_071401461A → E in HNFJ1. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_05482829A → ARTKYNCPARWSWRTPQRGG DTEQGPDEDFTSQG in isoform 5. 1 Publication1
Alternative sequenceiVSP_01756567 – 199Missing in isoform 2. 1 PublicationAdd BLAST133
Alternative sequenceiVSP_040973133 – 154Missing in isoform 4. 1 PublicationAdd BLAST22
Alternative sequenceiVSP_017566205 – 234FVGQG…WLNGT → P in isoform 3. 1 PublicationAdd BLAST30

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
M15881 mRNA Translation: AAA36798.1
M17778 mRNA Translation: AAA36799.1
AY162970
, AY162963, AY162964, AY162965, AY162967, AY162968, AY162969 Genomic DNA Translation: AAO64446.1
AK127643 mRNA Translation: BAC87070.1
AK055722 mRNA Translation: BAG51560.1
AK091961 mRNA Translation: BAG52451.1
AC106796 Genomic DNA No translation available.
BC035975 mRNA Translation: AAH35975.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS10583.1 [P07911-1]
CCDS61876.1 [P07911-5]

Protein sequence database of the Protein Information Resource

More...
PIRi
A30452

NCBI Reference Sequences

More...
RefSeqi
NP_001008390.1, NM_001008389.2 [P07911-1]
NP_001265543.1, NM_001278614.1 [P07911-5]
NP_003352.2, NM_003361.3 [P07911-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.654425

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000302509; ENSP00000306279; ENSG00000169344 [P07911-1]
ENST00000396134; ENSP00000379438; ENSG00000169344 [P07911-5]
ENST00000570689; ENSP00000460548; ENSG00000169344 [P07911-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
7369

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:7369

UCSC genome browser

More...
UCSCi
uc002dgz.5 human [P07911-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M15881 mRNA Translation: AAA36798.1
M17778 mRNA Translation: AAA36799.1
AY162970
, AY162963, AY162964, AY162965, AY162967, AY162968, AY162969 Genomic DNA Translation: AAO64446.1
AK127643 mRNA Translation: BAC87070.1
AK055722 mRNA Translation: BAG51560.1
AK091961 mRNA Translation: BAG52451.1
AC106796 Genomic DNA No translation available.
BC035975 mRNA Translation: AAH35975.1
CCDSiCCDS10583.1 [P07911-1]
CCDS61876.1 [P07911-5]
PIRiA30452
RefSeqiNP_001008390.1, NM_001008389.2 [P07911-1]
NP_001265543.1, NM_001278614.1 [P07911-5]
NP_003352.2, NM_003361.3 [P07911-1]
UniGeneiHs.654425

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4WRNX-ray3.20A/B295-610[»]
ProteinModelPortaliP07911
SMRiP07911
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi113216, 2 interactors
IntActiP07911, 2 interactors
STRINGi9606.ENSP00000306279

PTM databases

GlyConnecti613
iPTMnetiP07911
PhosphoSitePlusiP07911
UniCarbKBiP07911

Polymorphism and mutation databases

BioMutaiUMOD
DMDMi137116

Proteomic databases

jPOSTiP07911
PaxDbiP07911
PeptideAtlasiP07911
PRIDEiP07911
ProteomicsDBi52038
52039 [P07911-2]
52040 [P07911-3]
52041 [P07911-4]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000302509; ENSP00000306279; ENSG00000169344 [P07911-1]
ENST00000396134; ENSP00000379438; ENSG00000169344 [P07911-5]
ENST00000570689; ENSP00000460548; ENSG00000169344 [P07911-1]
GeneIDi7369
KEGGihsa:7369
UCSCiuc002dgz.5 human [P07911-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
7369
DisGeNETi7369
EuPathDBiHostDB:ENSG00000169344.15

GeneCards: human genes, protein and diseases

More...
GeneCardsi
UMOD
GeneReviewsiUMOD

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0012858
HGNCiHGNC:12559 UMOD
HPAiCAB009446
HPA043420
HPA054721
MalaCardsiUMOD
MIMi162000 phenotype
191845 gene
603860 phenotype
609886 phenotype
neXtProtiNX_P07911
OpenTargetsiENSG00000169344
Orphaneti209886 Familial juvenile hyperuricemic nephropathy type 1
88950 UMOD-related autosomal dominant tubulointerstitial kidney disease
PharmGKBiPA37199

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IVSV Eukaryota
ENOG410YDU6 LUCA
GeneTreeiENSGT00940000156742
HOGENOMiHOG000293303
HOVERGENiHBG004349
InParanoidiP07911
KOiK18274
OrthoDBi665331at2759
PhylomeDBiP07911
TreeFamiTF330284

Enzyme and pathway databases

ReactomeiR-HSA-446203 Asparagine N-linked glycosylation
SIGNORiP07911

Miscellaneous databases

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
Tamm%E2%80%93Horsfall_protein

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
7369

Protein Ontology

More...
PROi
PR:P07911

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000169344 Expressed in 55 organ(s), highest expression level in renal medulla
CleanExiHS_UMOD
ExpressionAtlasiP07911 baseline and differential
GenevisibleiP07911 HS

Family and domain databases

InterProiView protein in InterPro
IPR001881 EGF-like_Ca-bd_dom
IPR013032 EGF-like_CS
IPR000742 EGF-like_dom
IPR000152 EGF-type_Asp/Asn_hydroxyl_site
IPR018097 EGF_Ca-bd_CS
IPR024731 EGF_dom
IPR009030 Growth_fac_rcpt_cys_sf
IPR001507 ZP_dom
IPR017977 ZP_dom_CS
PfamiView protein in Pfam
PF12947 EGF_3, 1 hit
PF07645 EGF_CA, 2 hits
PF00100 Zona_pellucida, 1 hit
PRINTSiPR00023 ZPELLUCIDA
SMARTiView protein in SMART
SM00181 EGF, 3 hits
SM00179 EGF_CA, 2 hits
SM00241 ZP, 1 hit
SUPFAMiSSF57184 SSF57184, 1 hit
PROSITEiView protein in PROSITE
PS00010 ASX_HYDROXYL, 2 hits
PS01186 EGF_2, 3 hits
PS50026 EGF_3, 3 hits
PS01187 EGF_CA, 2 hits
PS00682 ZP_1, 1 hit
PS51034 ZP_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiUROM_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P07911
Secondary accession number(s): B3KP48
, B3KRN9, E9PEA4, Q540J6, Q6ZS84, Q8IYG0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 1, 1988
Last sequence update: August 1, 1988
Last modified: January 16, 2019
This is version 189 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again