Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sericin 1

Gene

ser1

Organism
Bombyx mori (Silk moth)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Provides the silk fibroin thread with a sticky coating. Acts as a cement by sticking silk threads together.

Miscellaneous

The glue-like property of sericin is attributed to the hydrogen bonding between serine residues of sericin with serine residues in the fibroin structural components of silk fiber.

Keywordsi

Molecular functionSilk protein

Names & Taxonomyi

Protein namesi
Recommended name:
Sericin 1
Alternative name(s):
Silk gum protein
Gene namesi
Name:ser1
OrganismiBombyx mori (Silk moth)
Taxonomic identifieri7091 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraHolometabolaLepidopteraGlossataDitrysiaBombycoideaBombycidaeBombycinaeBombyx
Proteomesi
  • UP000005204 Componenti: Unassembled WGS sequence

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Biotechnological usei

Sericin is useful because of its properties. The protein resists oxidation, is antibacterial, UV resistant, and absorbs and releases moisture easily. Sericin can be cross-linked, copolymerized, and blended with other macromolecular materials, especially artificial polymers, to produce materials with improved properties. The protein is also used as an improving reagent or a coating material for natural and artificial fibers, fabrics, and articles. The materials modified with sericin and composites are useful as degradable biomaterials, biomedical materials, polymers for forming articles, functional membranes, fibers, and fabrics.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 21Sequence analysisAdd BLAST21
ChainiPRO_000002232122 – 1186Sericin 1Add BLAST1165

Proteomic databases

PRIDEiP07856

Expressioni

Tissue specificityi

Produced exclusively in the middle (MSG) section of silk glands.

Structurei

3D structure databases

ProteinModelPortaliP07856
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati593 – 6301Add BLAST38
Repeati631 – 6682Add BLAST38
Repeati669 – 7063Add BLAST38
Repeati707 – 7444Add BLAST38
Repeati745 – 7825Add BLAST38
Repeati783 – 8206Add BLAST38
Repeati821 – 8587Add BLAST38
Repeati859 – 8968Add BLAST38
Repeati897 – 9349Add BLAST38
Repeati935 – 97210Add BLAST38
Repeati973 – 101011Add BLAST38

Keywords - Domaini

Repeat, Signal

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1B (identifier: P07856-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRFVLCCTLI ALAALSVKAF GHHPGNRDTV EVKNRKYNAA SSESSYLNKD
60 70 80 90 100
NDSISAGAHR AKSVEQSQDK SKYTSGPEGV SYSGRSQNYK DSKQAYADYH
110 120 130 140 150
SDPNGGSASA GQSRDSSLRE RNVHYVSDGE AVAASSDARD ENRSAQQNAQ
160 170 180 190 200
ANWNADGSYG VSADRSGSAS SRRRQANYYS DKDITAASKD DSRADSSRRS
210 220 230 240 250
NAYYNRDSDG SESAGLSDRS ASSSKNDNVF VYRTKDSIGG QAKSSRSSHS
260 270 280 290 300
QESDAYYNSS PDGSYNAGTR DSSISNKKKA SSTIYADKDQ IRAANDRSSS
310 320 330 340 350
KQLKQSSAQI SSGPEGTSVS SKDRQYSNDK RSKSDAYVGR DGTVAYSNKD
360 370 380 390 400
SEKTSRQSNT NYADQNSVRS DSAASDQTSK SYDRGYSDKN IVAHSSGSRG
410 420 430 440 450
SQNQKSSSYR ADKDGFSSST NTEKSKFSSS NSVVETSDGA SASRESSAED
460 470 480 490 500
TKSSNSNVQS DEKSASQSSS SRSSQESASY SSSSSSSTLS EDSSEVDIDL
510 520 530 540 550
GNLGWWWNSD NKVQRAAGGA TKSGASSSTQ ATTVSGADDS ADSYTWWWNP
560 570 580 590 600
RRSSSSSSSA SSSSSGSNVG GSSQSSGSST SGSNARGHLG TVSSTGSTSN
610 620 630 640 650
TDSSSKSAGS RTSGGSSTYG YSSSHRGGSV SSTGSSSNTD SSTKNAGSST
660 670 680 690 700
SGGSSTYGYS SSHRGGSVSS TGSSSNTDSS TKSAGSSTSG GSSTYGYSSR
710 720 730 740 750
HRGGRVSSTG SSSTTDASSN SVGSSTSGGS STYGYSSNSR DGSVSSTGSS
760 770 780 790 800
SNTDSNSNSA GSSTSGGSST YGYSSNSRDG SVSSTGSSSN TDSNSNSAGS
810 820 830 840 850
STSGGSSTYG YSSNSRDGSV SSTGSSSNTD ASTDLTGSST SGGSSTYGYS
860 870 880 890 900
SDSRDGSVSS TGSSSNTDAS TDLAGSSTSG GSSTYGYSSD CGDGSVSSTG
910 920 930 940 950
SSSNTDASTD LAGSSTSGGS STYGYSSDSR DGSVSSTGSS SNTDASTDLA
960 970 980 990 1000
GSSTSGGSST YGYSSNSRDG SVSSTGSSSN TDASTDLTGS STSGGSSTYG
1010 1020 1030 1040 1050
YSSSNRDGSV LATGSSSNTD ASTTEESTTS AGSSTEGYSS SSHDGSVTST
1060 1070 1080 1090 1100
DGSSTSGGAS SSSASTAKSD AASSEDGFWW WNRRKSGSGH KSATVQSSTT
1110 1120 1130 1140 1150
DKTSTDSASS TDSTSSTSGA STTTSGSSST SGGSSTSDAS STSSSVSRSH
1160 1170 1180
HSGVNRLLHK PGQGKICLCF ENIFDIPYHL RKNIGV
Length:1,186
Mass (Da):119,486
Last modified:February 1, 2005 - v2
Checksum:iF6399DD3AE938D2E
GO
Isoform 1A (identifier: P07856-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     24-461: PGNRDTVEVK...KSSNSNVQSD → QTGEEEELFDVVSYQKIEDGKPVIIMKVIPV

Show »
Length:779
Mass (Da):76,037
Checksum:i5F573A6FC81A30F2
GO
Isoform 1A' (identifier: P07856-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     25-488: Missing.

Show »
Length:722
Mass (Da):69,932
Checksum:i446254EC6DD99514
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti50D → A in BAD00700 (PubMed:14677702).Curated1
Sequence conflicti59H → R in BAD00700 (PubMed:14677702).Curated1
Sequence conflicti513V → A in BAD00699 (PubMed:14677702).Curated1
Sequence conflicti524G → E in BAD00699 (PubMed:14677702).Curated1
Sequence conflicti1011L → S in BAD00699 (PubMed:14677702).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_01270224 – 461PGNRD…NVQSD → QTGEEEELFDVVSYQKIEDG KPVIIMKVIPV in isoform 1A. 1 PublicationAdd BLAST438
Alternative sequenceiVSP_01270325 – 488Missing in isoform 1A'. 1 PublicationAdd BLAST464

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB112019 mRNA Translation: BAD00698.1
AB112020 mRNA Translation: BAD00699.1
AB112021 mRNA Translation: BAD00700.1
AADK01002558 Genomic DNA No translation available.
J01029 Genomic DNA No translation available.
J01030 Genomic DNA No translation available.
J01031 Genomic DNA No translation available.
M26101 mRNA Translation: AAA27843.1
M26102 mRNA Translation: AAA27844.1
M26103 mRNA Translation: AAA27845.1
M26104 mRNA Translation: AAA27846.1
UniGeneiBmo.3924

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB112019 mRNA Translation: BAD00698.1
AB112020 mRNA Translation: BAD00699.1
AB112021 mRNA Translation: BAD00700.1
AADK01002558 Genomic DNA No translation available.
J01029 Genomic DNA No translation available.
J01030 Genomic DNA No translation available.
J01031 Genomic DNA No translation available.
M26101 mRNA Translation: AAA27843.1
M26102 mRNA Translation: AAA27844.1
M26103 mRNA Translation: AAA27845.1
M26104 mRNA Translation: AAA27846.1
UniGeneiBmo.3924

3D structure databases

ProteinModelPortaliP07856
ModBaseiSearch...
MobiDBiSearch...

Proteomic databases

PRIDEiP07856

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Family and domain databases

ProtoNetiSearch...

Entry informationi

Entry nameiSERI1_BOMMO
AccessioniPrimary (citable) accession number: P07856
Secondary accession number(s): O96850
, O96851, Q76B21, Q76B22, Q76B23
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 1, 1988
Last sequence update: February 1, 2005
Last modified: April 12, 2017
This is version 67 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again