Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 70 (11 Dec 2019)
Sequence version 2 (01 Feb 2005)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Sericin 1

Gene

ser1

Organism
Bombyx mori (Silk moth)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Provides the silk fibroin thread with a sticky coating. Acts as a cement by sticking silk threads together.

Miscellaneous

The glue-like property of sericin is attributed to the hydrogen bonding between serine residues of sericin with serine residues in the fibroin structural components of silk fiber.

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionSilk protein

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Sericin 1
Alternative name(s):
Silk gum protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ser1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiBombyx mori (Silk moth)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7091 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraHolometabolaLepidopteraGlossataDitrysiaBombycoideaBombycidaeBombycinaeBombyx
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005204 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Unassembled WGS sequence

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the use of a specific protein in the biotechnological industry.<p><a href='/help/biotechnological_use' target='_top'>More...</a></p>Biotechnological usei

Sericin is useful because of its properties. The protein resists oxidation, is antibacterial, UV resistant, and absorbs and releases moisture easily. Sericin can be cross-linked, copolymerized, and blended with other macromolecular materials, especially artificial polymers, to produce materials with improved properties. The protein is also used as an improving reagent or a coating material for natural and artificial fibers, fabrics, and articles. The materials modified with sericin and composites are useful as degradable biomaterials, biomedical materials, polymers for forming articles, functional membranes, fibers, and fabrics.1 Publication

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 21Sequence analysisAdd BLAST21
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000002232122 – 1186Sericin 1Add BLAST1165

Proteomic databases

PRoteomics IDEntifications database

More...
PRIDEi
P07856

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Produced exclusively in the middle (MSG) section of silk glands.

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati593 – 6301Add BLAST38
Repeati631 – 6682Add BLAST38
Repeati669 – 7063Add BLAST38
Repeati707 – 7444Add BLAST38
Repeati745 – 7825Add BLAST38
Repeati783 – 8206Add BLAST38
Repeati821 – 8587Add BLAST38
Repeati859 – 8968Add BLAST38
Repeati897 – 9349Add BLAST38
Repeati935 – 97210Add BLAST38
Repeati973 – 101011Add BLAST38

Keywords - Domaini

Repeat, Signal

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1B (identifier: P07856-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRFVLCCTLI ALAALSVKAF GHHPGNRDTV EVKNRKYNAA SSESSYLNKD
60 70 80 90 100
NDSISAGAHR AKSVEQSQDK SKYTSGPEGV SYSGRSQNYK DSKQAYADYH
110 120 130 140 150
SDPNGGSASA GQSRDSSLRE RNVHYVSDGE AVAASSDARD ENRSAQQNAQ
160 170 180 190 200
ANWNADGSYG VSADRSGSAS SRRRQANYYS DKDITAASKD DSRADSSRRS
210 220 230 240 250
NAYYNRDSDG SESAGLSDRS ASSSKNDNVF VYRTKDSIGG QAKSSRSSHS
260 270 280 290 300
QESDAYYNSS PDGSYNAGTR DSSISNKKKA SSTIYADKDQ IRAANDRSSS
310 320 330 340 350
KQLKQSSAQI SSGPEGTSVS SKDRQYSNDK RSKSDAYVGR DGTVAYSNKD
360 370 380 390 400
SEKTSRQSNT NYADQNSVRS DSAASDQTSK SYDRGYSDKN IVAHSSGSRG
410 420 430 440 450
SQNQKSSSYR ADKDGFSSST NTEKSKFSSS NSVVETSDGA SASRESSAED
460 470 480 490 500
TKSSNSNVQS DEKSASQSSS SRSSQESASY SSSSSSSTLS EDSSEVDIDL
510 520 530 540 550
GNLGWWWNSD NKVQRAAGGA TKSGASSSTQ ATTVSGADDS ADSYTWWWNP
560 570 580 590 600
RRSSSSSSSA SSSSSGSNVG GSSQSSGSST SGSNARGHLG TVSSTGSTSN
610 620 630 640 650
TDSSSKSAGS RTSGGSSTYG YSSSHRGGSV SSTGSSSNTD SSTKNAGSST
660 670 680 690 700
SGGSSTYGYS SSHRGGSVSS TGSSSNTDSS TKSAGSSTSG GSSTYGYSSR
710 720 730 740 750
HRGGRVSSTG SSSTTDASSN SVGSSTSGGS STYGYSSNSR DGSVSSTGSS
760 770 780 790 800
SNTDSNSNSA GSSTSGGSST YGYSSNSRDG SVSSTGSSSN TDSNSNSAGS
810 820 830 840 850
STSGGSSTYG YSSNSRDGSV SSTGSSSNTD ASTDLTGSST SGGSSTYGYS
860 870 880 890 900
SDSRDGSVSS TGSSSNTDAS TDLAGSSTSG GSSTYGYSSD CGDGSVSSTG
910 920 930 940 950
SSSNTDASTD LAGSSTSGGS STYGYSSDSR DGSVSSTGSS SNTDASTDLA
960 970 980 990 1000
GSSTSGGSST YGYSSNSRDG SVSSTGSSSN TDASTDLTGS STSGGSSTYG
1010 1020 1030 1040 1050
YSSSNRDGSV LATGSSSNTD ASTTEESTTS AGSSTEGYSS SSHDGSVTST
1060 1070 1080 1090 1100
DGSSTSGGAS SSSASTAKSD AASSEDGFWW WNRRKSGSGH KSATVQSSTT
1110 1120 1130 1140 1150
DKTSTDSASS TDSTSSTSGA STTTSGSSST SGGSSTSDAS STSSSVSRSH
1160 1170 1180
HSGVNRLLHK PGQGKICLCF ENIFDIPYHL RKNIGV
Length:1,186
Mass (Da):119,486
Last modified:February 1, 2005 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF6399DD3AE938D2E
GO
Isoform 1A (identifier: P07856-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     24-461: PGNRDTVEVK...KSSNSNVQSD → QTGEEEELFDVVSYQKIEDGKPVIIMKVIPV

Show »
Length:779
Mass (Da):76,037
Checksum:i5F573A6FC81A30F2
GO
Isoform 1A' (identifier: P07856-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     25-488: Missing.

Show »
Length:722
Mass (Da):69,932
Checksum:i446254EC6DD99514
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti50D → A in BAD00700 (PubMed:14677702).Curated1
Sequence conflicti59H → R in BAD00700 (PubMed:14677702).Curated1
Sequence conflicti513V → A in BAD00699 (PubMed:14677702).Curated1
Sequence conflicti524G → E in BAD00699 (PubMed:14677702).Curated1
Sequence conflicti1011L → S in BAD00699 (PubMed:14677702).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_01270224 – 461PGNRD…NVQSD → QTGEEEELFDVVSYQKIEDG KPVIIMKVIPV in isoform 1A. 1 PublicationAdd BLAST438
Alternative sequenceiVSP_01270325 – 488Missing in isoform 1A'. 1 PublicationAdd BLAST464

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB112019 mRNA Translation: BAD00698.1
AB112020 mRNA Translation: BAD00699.1
AB112021 mRNA Translation: BAD00700.1
AADK01002558 Genomic DNA No translation available.
J01029 Genomic DNA No translation available.
J01030 Genomic DNA No translation available.
J01031 Genomic DNA No translation available.
M26101 mRNA Translation: AAA27843.1
M26102 mRNA Translation: AAA27844.1
M26103 mRNA Translation: AAA27845.1
M26104 mRNA Translation: AAA27846.1

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB112019 mRNA Translation: BAD00698.1
AB112020 mRNA Translation: BAD00699.1
AB112021 mRNA Translation: BAD00700.1
AADK01002558 Genomic DNA No translation available.
J01029 Genomic DNA No translation available.
J01030 Genomic DNA No translation available.
J01031 Genomic DNA No translation available.
M26101 mRNA Translation: AAA27843.1
M26102 mRNA Translation: AAA27844.1
M26103 mRNA Translation: AAA27845.1
M26104 mRNA Translation: AAA27846.1

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Proteomic databases

PRIDEiP07856

Family and domain databases

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSERI1_BOMMO
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P07856
Secondary accession number(s): O96850
, O96851, Q76B21, Q76B22, Q76B23
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 1, 1988
Last sequence update: February 1, 2005
Last modified: December 11, 2019
This is version 70 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Direct protein sequencing, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again