UniProtKB - P07471 (CX6A2_BOVIN)

BLAST

>sp|P07471|CX6A2_BOVIN Cytochrome c oxidase subunit 6A2, mitochondrial OS=Bos taurus OX=9913 GN=COX6A2 PE=1 SV=2
MALPLKSLSRGLASAAKGDHGGTGARTWRFLTFGLALPSVALCTLNSWLHSGHRERPAFI
PYHHLRIRTKPFSWGDGNHTFFHNPRVNPLPTGYEKP

Align
Format
Add to basket Added to basket
History
Entry version 147 (10 Oct 2018)
Sequence version 2 (01 May 1992)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

Cytochrome c oxidase subunit 6A2, mitochondrial

Gene

COX6A2

Organism

Bos taurus (Bovine)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.

GO - Molecular functionⁱ

cytochrome-c oxidase activity Source: InterPro
enzyme regulator activity
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

aerobic respiration
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
mitochondrial electron transport, cytochrome c to oxygen
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635

View the complete GO annotation on QuickGO ...

Enzyme and pathway databases

BRENDAⁱ	1.9.3.1 908

BRENDAⁱ

1.9.3.1 908

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Cytochrome c oxidase subunit 6A2, mitochondrial Alternative name(s): Cytochrome c oxidase polypeptide VIa-heart Short name: COXVIAH Cytochrome c oxidase polypeptide VIb
Gene namesⁱ	Name:COX6A2 Synonyms:COX6A
Organismⁱ	Bos taurus (Bovine)
Taxonomic identifierⁱ	9913 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Laurasiatheria › Cetartiodactyla › Ruminantia › Pecora › Bovidae › Bovinae › Bos
Proteomesⁱ	UP000009136 Componentⁱ: Chromosome 25

Organism-specific databases

VGNCⁱ	VGNC:27637 COX6A2

VGNCⁱ

VGNC:27637 COX6A2

Topology

Feature key	Position(s)	DescriptionActions	Length
Topological domainⁱ	13 – 24	Mitochondrial matrixAdd BLAST	12
Transmembraneⁱ	25 – 49	HelicalAdd BLAST	25
Topological domainⁱ	50 – 97	Mitochondrial intermembraneAdd BLAST	48

Keywords - Cellular componentⁱ

Membrane, Mitochondrion, Mitochondrion inner membrane

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Transit peptideⁱ	1 – 12	Mitochondrion1 PublicationAdd BLAST		12
ChainⁱPRO_0000006115	13 – 97	Cytochrome c oxidase subunit 6A2, mitochondrialAdd BLAST		85

Proteomic databases

PaxDbⁱ	P07471
PRIDEⁱ	P07471

Expressionⁱ

Tissue specificityⁱ

Heart/muscle specific isoform.

Gene expression databases

Bgeeⁱ	ENSBTAG00000019521 Expressed in 6 organ(s), highest expression level in heart

Bgeeⁱ

ENSBTAG00000019521 Expressed in 6 organ(s), highest expression level in heart

Interactionⁱ

Protein-protein interaction databases

CORUMⁱ	P07471
Database of interacting proteins More...DIPⁱ	DIP-39018N
IntActⁱ	P07471, 2 interactors
STRINGⁱ	9913.ENSBTAP00000026002

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Beta strandⁱ	21 – 23	Combined sources	3
Helixⁱ	25 – 34	Combined sources	10
Helixⁱ	36 – 47	Combined sources	12
Beta strandⁱ	77 – 79	Combined sources	3
Turnⁱ	85 – 87	Combined sources	3
Beta strandⁱ	91 – 93	Combined sources	3

Show more details

3D structure databases

ProteinModelPortalⁱ	P07471
SMRⁱ	P07471
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ	P07471

EvolutionaryTraceⁱ

P07471

Family & Domainsⁱ

Sequence similaritiesⁱ

Belongs to the cytochrome c oxidase subunit 6A family.Curated

Keywords - Domainⁱ

Transit peptide, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGⁱ	KOG3469 Eukaryota ENOG411253X LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00390000002756
HOGENOMⁱ	HOG000193965
HOVERGENⁱ	HBG060482
InParanoidⁱ	P07471
KEGG Orthology (KO) More...KOⁱ	K02266
OMAⁱ	REPFAKY
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G0C5F
TreeFamⁱ	TF105064

Family and domain databases

Conserved Domains Database More...CDDⁱ	cd00925 Cyt_c_Oxidase_VIa, 1 hit
Gene3Dⁱ	4.10.95.10, 1 hit
InterProⁱ	View protein in InterPro IPR001349 Cyt_c_oxidase_su6a IPR018507 Cyt_c_oxidase_su6a_CS IPR036418 Cyt_c_oxidase_su6a_sf
PANTHERⁱ	PTHR11504 PTHR11504, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF02046 COX6A, 1 hit
PIRSFⁱ	PIRSF000277 COX6A1, 1 hit
ProDomⁱ	View protein in ProDom or Entries sharing at least one domain PD006036 Cyt_c_oxidase_su6a, 1 hit
SUPFAMⁱ	SSF81411 SSF81411, 1 hit
PROSITEⁱ	View protein in PROSITE PS01329 COX6A, 1 hit

Sequenceⁱ

Sequence statusⁱ: Complete.

Sequence processingⁱ: The displayed sequence is further processed into a mature form.

P07471-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MALPLKSLSR GLASAAKGDH GGTGARTWRF LTFGLALPSV ALCTLNSWLH 
        60         70         80         90 
SGHRERPAFI PYHHLRIRTK PFSWGDGNHT FFHNPRVNPL PTGYEKP

Length:97

Mass (Da):10,800

Last modified:May 1, 1992 - v2

Checksum:ⁱ59B408A1B9B6AF4F

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	X56857 mRNA Translation: CAA40183.1 S64127 Genomic DNA Translation: AAB27605.1 BC103117 mRNA Translation: AAI03118.1
PIRⁱ	S35702 OGBO6
NCBI Reference Sequences More...RefSeqⁱ	NP_776947.1, NM_174522.3
UniGeneⁱ	Bt.49093

Genome annotation databases

Ensemblⁱ	ENSBTAT00000026002; ENSBTAP00000026002; ENSBTAG00000019521
GeneIDⁱ	282200
KEGGⁱ	bta:282200

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
P07471	Cytochrome c oxidase subunit 6A, mitochondrial		wild yak		97	UniRef100_P07471
UPI00006834C4		BOVIN		85
UPI000011289B		BOVIN		84

Protein	Similar proteins		Species	Score	Length	Source
P07471	Cytochrome c oxidase subunit 6A, mitochondrial		wild yak		97	UniRef90_P07471
Cytochrome c oxidase subunit 6A, mitochondrial		DELLE		97
Cytochrome c oxidase subunit 6A, mitochondrial		LIPVE		97
Cytochrome c oxidase subunit 6A, mitochondrial		Yangtze finless porpoise		97
cytochrome c oxidase subunit 6A2, mitochondrial-like		BALAS		97
+10

Protein	Similar proteins		Species	Score	Length	Source
P07471	Cytochrome c oxidase subunit 6A, mitochondrial		wild yak		97	UniRef50_P07471
Cytochrome c oxidase subunit 6A, mitochondrial	)	SHEEP		97
Cytochrome c oxidase subunit 6A, mitochondrial		DELLE		97
Cytochrome c oxidase subunit 6A, mitochondrial		LIPVE		97
Cytochrome c oxidase subunit 6A, mitochondrial		Yangtze finless porpoise		97
+17

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	X56857 mRNA Translation: CAA40183.1 S64127 Genomic DNA Translation: AAB27605.1 BC103117 mRNA Translation: AAI03118.1
PIRⁱ	S35702 OGBO6
RefSeqⁱ	NP_776947.1, NM_174522.3
UniGeneⁱ	Bt.49093

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	1OCC	X-ray	2.80	G/T	13-96	[»]
	1OCO	X-ray	2.80	G/T	13-96	[»]
	1OCR	X-ray	2.35	G/T	13-96	[»]
	1OCZ	X-ray	2.90	G/T	13-96	[»]
	1V54	X-ray	1.80	G/T	13-97	[»]
	1V55	X-ray	1.90	G/T	13-97	[»]
	2DYR	X-ray	1.80	G/T	13-97	[»]
	2DYS	X-ray	2.20	G/T	13-97	[»]
	2EIJ	X-ray	1.90	G/T	13-97	[»]
	2EIK	X-ray	2.10	G/T	13-97	[»]
	2EIL	X-ray	2.10	G/T	13-97	[»]
	2EIM	X-ray	2.60	G/T	13-97	[»]
	2EIN	X-ray	2.70	G/T	13-97	[»]
	2OCC	X-ray	2.30	G/T	13-96	[»]
	2Y69	X-ray	1.95	G/T	1-97	[»]
	2YBB	electron microscopy	19.00	R	13-96	[»]
	2ZXW	X-ray	2.50	G/T	13-97	[»]
	3ABK	X-ray	2.00	G/T	13-97	[»]
	3ABL	X-ray	2.10	G/T	13-97	[»]
	3ABM	X-ray	1.95	G/T	13-97	[»]
	3AG1	X-ray	2.20	G/T	13-97	[»]
	3AG2	X-ray	1.80	G/T	13-97	[»]
	3AG3	X-ray	1.80	G/T	13-97	[»]
	3AG4	X-ray	2.05	G/T	13-97	[»]
	3ASN	X-ray	3.00	G/T	13-97	[»]
	3ASO	X-ray	2.30	G/T	13-97	[»]
	3WG7	X-ray	1.90	G/T	13-97	[»]
	3X2Q	X-ray	2.00	G/T	13-97	[»]
	5B1A	X-ray	1.50	G/T	13-97	[»]
	5B1B	X-ray	1.60	G/T	13-97	[»]
	5B3S	X-ray	1.68	G/T	13-97	[»]
	5GPN	electron microscopy	5.40	4	13-96	[»]
	5IY5	X-ray	2.00	G/T	13-96	[»]
	5LUF	electron microscopy	9.10	4	13-96	[»]
	5W97	X-ray	2.30	G/g	13-97	[»]
	5WAU	X-ray	1.95	G/g	13-97	[»]
	5X19	X-ray	2.20	G/T	13-97	[»]
	5X1B	X-ray	2.40	G/T	13-97	[»]
	5X1F	X-ray	2.20	G/T	13-97	[»]
	5XDQ	X-ray	1.77	G/T	13-97	[»]
	5XDX	X-ray	1.99	G/T	13-97	[»]
	5XTH	electron microscopy	3.90	3	13-96	[»]
	5XTI	electron microscopy	17.40	3/B3	13-96	[»]
	5Z84	X-ray	1.85	G/T	13-97	[»]
	5Z85	X-ray	1.85	G/T	13-97	[»]
	5Z86	X-ray	1.85	G/T	13-97	[»]
	5ZCO	X-ray	1.90	G/T	13-97	[»]
	5ZCP	X-ray	1.65	G/T	13-97	[»]
	5ZCQ	X-ray	1.65	G/T	13-97	[»]
ProteinModelPortalⁱ	P07471
SMRⁱ	P07471
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

CORUMⁱ	P07471
DIPⁱ	DIP-39018N
IntActⁱ	P07471, 2 interactors
STRINGⁱ	9913.ENSBTAP00000026002

Proteomic databases

PaxDbⁱ	P07471
PRIDEⁱ	P07471

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

Ensemblⁱ	ENSBTAT00000026002; ENSBTAP00000026002; ENSBTAG00000019521
GeneIDⁱ	282200
KEGGⁱ	bta:282200

Organism-specific databases

CTDⁱ	1339
VGNCⁱ	VGNC:27637 COX6A2

Phylogenomic databases

eggNOGⁱ	KOG3469 Eukaryota ENOG411253X LUCA
GeneTreeⁱ	ENSGT00390000002756
HOGENOMⁱ	HOG000193965
HOVERGENⁱ	HBG060482
InParanoidⁱ	P07471
KOⁱ	K02266
OMAⁱ	REPFAKY
OrthoDBⁱ	EOG091G0C5F
TreeFamⁱ	TF105064

Enzyme and pathway databases

BRENDAⁱ	1.9.3.1 908

BRENDAⁱ

1.9.3.1 908

Miscellaneous databases

EvolutionaryTraceⁱ	P07471

EvolutionaryTraceⁱ

P07471

Gene expression databases

Bgeeⁱ	ENSBTAG00000019521 Expressed in 6 organ(s), highest expression level in heart

Bgeeⁱ

ENSBTAG00000019521 Expressed in 6 organ(s), highest expression level in heart

Family and domain databases

CDDⁱ	cd00925 Cyt_c_Oxidase_VIa, 1 hit
Gene3Dⁱ	4.10.95.10, 1 hit
InterProⁱ	View protein in InterPro IPR001349 Cyt_c_oxidase_su6a IPR018507 Cyt_c_oxidase_su6a_CS IPR036418 Cyt_c_oxidase_su6a_sf
PANTHERⁱ	PTHR11504 PTHR11504, 1 hit
Pfamⁱ	View protein in Pfam PF02046 COX6A, 1 hit
PIRSFⁱ	PIRSF000277 COX6A1, 1 hit
ProDomⁱ	View protein in ProDom or Entries sharing at least one domain PD006036 Cyt_c_oxidase_su6a, 1 hit
SUPFAMⁱ	SSF81411 SSF81411, 1 hit
PROSITEⁱ	View protein in PROSITE PS01329 COX6A, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	CX6A2_BOVIN
Accessionⁱ	P07471Primary (citable) accession number: P07471 Secondary accession number(s): Q3SZ61
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	April 1, 1988
	Last sequence update:	May 1, 1992
	Last modified:	October 10, 2018
	This is version 147 of the entry and version 2 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P07471 (CX6A2_BOVIN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Cytochrome c oxidase subunit 6A2, mitochondrial

COX6A2

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Mitochondrion

Mitochondrion

Other locations

Topology

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Proteomic databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Phylogenomic databases

Family and domain databases

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

PTM / Processingⁱ

Expressionⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Keywords - Domainⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ