We will be switching to the new UniProt website soon. Please explore and share your feedback. Take me to the new website.

UniProtKB - P07445 (SDIS_PSEPU)

>sp|P07445|SDIS_PSEPU Steroid Delta-isomerase OS=Pseudomonas putida OX=303 GN=ksi PE=1 SV=1
MNLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFYRQG
LGGGKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYW
SEVNLSVREPQ

Entry version 118 (23 Feb 2022)
Sequence version 1 (01 Apr 1988)
Previous versions | rss

Add a publication Feedback

Protein

Steroid Delta-isomerase

Gene

ksi

Organism

Pseudomonas putida (Arthrobacter siderocapsulatus)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Catalytic activityⁱ

a 3-oxo-Δ⁵-steroid
Search proteins in UniProtKB for this molecule.
Search chemical reactions in Rhea for this molecule.
See the description of this molecule in ChEBI.
=
a 3-oxo-Δ⁴-steroid
Search proteins in UniProtKB for this molecule.
Search chemical reactions in Rhea for this molecule.
See the description of this molecule in ChEBI.
EC:
5.3.3.1
- Search proteins in UniProtKB for this EC number.
- See the description of this EC number in ENZYME.
- Search reactions for this EC number in Rhea.
Source:
Rhea
Search for this reaction in UniProtKB.
See the description of this reaction in Rhea.
. Show »« Hide
a 3-oxo-Δ⁵-steroid
zoom
=
a 3-oxo-Δ⁴-steroid
zoom

Sites

Feature key	Position(s)	DescriptionActions	Length
Active siteⁱ	16	Proton donor	1
Active siteⁱ	40	Proton acceptor	1
Binding siteⁱ	103	Substrate1 Publication	1

GO - Molecular functionⁱ

steroid delta-isomerase activity Source: UniProtKB-EC

Complete GO annotation on QuickGO ...

GO - Biological processⁱ

steroid metabolic process Source: UniProtKB-KW

Complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Isomerase
Biological process	Lipid metabolism, Steroid metabolism

Enzyme and pathway databases

BRENDAⁱ	5.3.3.1, 5092

BRENDAⁱ

5.3.3.1, 5092

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Steroid Delta-isomerase (EC:5.3.3.1) Alternative name(s): Delta(5)-3-ketosteroid isomerase
Gene namesⁱ	Name:ksi
Organismⁱ	Pseudomonas putida (Arthrobacter siderocapsulatus)
Taxonomic identifierⁱ	303 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Bacteria › Proteobacteria › Gammaproteobacteria › Pseudomonadales › Pseudomonadaceae › Pseudomonas › Pseudomonas putida group

Pathology & Biotechⁱ

Mutagenesis

Feature key	Position(s)	DescriptionActions	Length
Mutagenesisⁱ	16	Y → F: Reduces activity 2000-fold. Reduces activity 10000-fold; when associated with E-103; N-103 or L-103. 3 Publications	1
Mutagenesisⁱ	16	Y → S: Reduces activity 20-fold. 3 Publications	1
Mutagenesisⁱ	32	Y → S: Reduces activity 4-fold. 1 Publication	1
Mutagenesisⁱ	57	Y → S: Reduces activity 100-fold.	1
Mutagenesisⁱ	92	W → A: Slightly reduces activity. Reduces protein stability.	1
Mutagenesisⁱ	103	D → A or L: Reduces activity 100-fold. Reduces activity 10000-fold; when associated with F-16. 2 Publications	1
Mutagenesisⁱ	103	D → E: Slightly reduces activity. Reduces activity 10000-fold; when associated with F-16. 2 Publications	1
Mutagenesisⁱ	103	D → N: Reduces activity 4-fold. Reduces activity 10000-fold; when associated with F-16. 2 Publications	1
Mutagenesisⁱ	125	L → A: Slightly reduces activity and reduces protein stability; when associated with A-127. 1 Publication	1
Mutagenesisⁱ	127	V → A: Slightly reduces activity and reduces protein stability; when associated with A-125. 1 Publication	1

Chemistry databases

ChEMBLⁱ	CHEMBL2321641
Drug and drug target database More...DrugBankⁱ	DB03619, Deoxycholic acid DB03515, Equilenin
DrugCentral More...DrugCentralⁱ	P07445

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000097646	1 – 131	Steroid Delta-isomeraseAdd BLAST		131

Expressionⁱ

Inductionⁱ

By steroids.

Interactionⁱ

Subunit structureⁱ

Homodimer.

3 Publications

Chemistry databases

BindingDBⁱ

P07445

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Helixⁱ	6 – 22	Combined sources	17
Helixⁱ	25 – 30	Combined sources	6
Beta strandⁱ	32 – 41	Combined sources	10
Helixⁱ	49 – 61	Combined sources	13
Beta strandⁱ	62 – 64	Combined sources	3
Beta strandⁱ	67 – 72	Combined sources	6
Beta strandⁱ	78 – 92	Combined sources	15
Beta strandⁱ	95 – 107	Combined sources	13
Beta strandⁱ	111 – 119	Combined sources	9
Helixⁱ	122 – 124	Combined sources	3
Beta strandⁱ	125 – 127	Combined sources	3

Show more details

3D structure databases

SMRⁱ	P07445
ModBaseⁱ	Search...
PDBe-KBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ	P07445

EvolutionaryTraceⁱ

P07445

Family & Domainsⁱ

Family and domain databases

Conserved Domains Database More...CDDⁱ	cd00781, ketosteroid_isomerase, 1 hit
InterProⁱ	View protein in InterPro IPR039256, Ketosteroid_isomerase IPR032710, NTF2-like_dom_sf IPR037401, SnoaL-like
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF12680, SnoaL_2, 1 hit
SUPFAMⁱ	SSF54427, SSF54427, 1 hit

Sequenceⁱ

Sequence statusⁱ: Complete.

P07445-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MNLPTAQEVQ GLMARYIELV DVGDIEAIVQ MYADDATVED PFGQPPIHGR 
        60         70         80         90        100
EQIAAFYRQG LGGGKVRACL TGPVRASHNG CGAMPFRVEM VWNGQPCALD 
       110        120        130 
VIDVMRFDEH GRIQTMQAYW SEVNLSVREP Q

Length:131

Mass (Da):14,536

Last modified:April 1, 1988 - v1

Checksum:ⁱ08711198C13CF014

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	L13127 Genomic DNA Translation: AAA64437.1
PIRⁱ	A25216, SIPSDP

Protein	Similar proteins		Species	Score	Length	Source
P07445	Steroid Delta-isomerase		Pseudomonas wadenswilerensis		131	UniRef90_P07445
Steroid Delta-isomerase		Pseudomonas sp. JV241A		131
+33

Protein	Similar proteins		Species	Score	Length	Source
P07445	Steroid Delta-isomerase		Pseudomonas sp. JV241A		131	UniRef50_P07445
Steroid Delta-isomerase		Pseudomonas wadenswilerensis		131
+39

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	L13127 Genomic DNA Translation: AAA64437.1
PIRⁱ	A25216, SIPSDP

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	1C7H	X-ray	2.50	A	1-131	[»]
	1CQS	X-ray	1.90	A/B	1-131	[»]
	1DMM	X-ray	1.90	A	1-131	[»]
	1DMN	X-ray	2.05	A	1-131	[»]
	1DMQ	X-ray	2.15	A	1-131	[»]
	1E3R	X-ray	2.50	A/B	1-131	[»]
	1E3V	X-ray	2.00	A/B	1-131	[»]
	1E97	X-ray	2.00	A	1-131	[»]
	1EA2	X-ray	1.80	A	1-131	[»]
	1GS3	X-ray	2.10	A	1-131	[»]
	1K41	X-ray	2.20	A/B	1-131	[»]
	1OGX	X-ray	2.00	A/B	1-131	[»]
	1OH0	X-ray	1.10	A/B	1-131	[»]
	1OHO	X-ray	1.90	A	1-131	[»]
	1OPY	X-ray	1.90	A	1-131	[»]
	1VZZ	X-ray	2.30	A/B	1-131	[»]
	1W00	X-ray	2.20	A/B	1-131	[»]
	1W01	X-ray	2.20	A/B	1-131	[»]
	1W02	X-ray	2.30	A	1-131	[»]
	1W6Y	X-ray	2.10	A	1-131	[»]
	2INX	X-ray	1.50	A	1-131	[»]
	2PZV	X-ray	1.25	A/B/C/D	1-131	[»]
	3CPO	X-ray	1.24	A	1-131	[»]
	3FZW	X-ray	1.32	A/B	1-131	[»]
	3IPT	X-ray	1.63	A/B/C/D	1-131	[»]
	3OWS	X-ray	1.71	A/B/C/D	1-131	[»]
	3OWU	X-ray	1.70	A/B/C/D	1-131	[»]
	3OWY	X-ray	2.30	A/B/C/D/E/F/G/H	1-131	[»]
	3OX9	X-ray	2.00	A/B/C/D	1-131	[»]
	3OXA	X-ray	1.89	A/B/C/D	1-131	[»]
	3RGR	X-ray	1.59	A	1-131	[»]
	3SED	X-ray	1.30	A	3-127	[»]
	3T8N	X-ray	1.47	A/B/D/F	1-131	[»]
	3VGN	X-ray	1.30	A/B	1-131	[»]
	3VSY	X-ray	1.50	A/B	3-131	[»]
	4CDL	X-ray	2.50	A	1-131	[»]
	4K1U	X-ray	2.00	A/B	1-131	[»]
	4K1V	X-ray	1.80	A	1-131	[»]
	5AI1	X-ray	2.10	A	1-131	[»]
	5D81	X-ray	1.39	A	1-131	[»]
	5D82	X-ray	1.37	A/B	1-131	[»]
	5D83	X-ray	1.70	A/B	1-131	[»]
	5G2G	X-ray	1.60	A/B	2-128	[»]
	5KP1	X-ray	1.22	A/B/C/D	1-131	[»]
	5KP3	X-ray	1.70	A/B	1-131	[»]
	5KP4	X-ray	1.71	A/B	1-131	[»]
	6C17	X-ray	1.10	A	1-131	[»]
	6C1J	X-ray	1.06	A	1-131	[»]
	6C1X	X-ray	1.05	A	1-131	[»]
	6F4Y	X-ray	1.92	A/B	3-127	[»]
	6F50	X-ray	2.00	A/B	3-127	[»]
	6F53	X-ray	1.49	A	3-127	[»]
	6F54	X-ray	1.08	A/B	3-127	[»]
	6TZD	X-ray	1.45	A/B	1-131	[»]
	6U1Z	X-ray	1.50	A/B	1-131	[»]
	6U4I	X-ray	1.55	A/B	1-131	[»]
	6UBQ	X-ray	1.30	A/B	1-131	[»]
	6UCN	X-ray	1.32	A/B	1-131	[»]
	6UCW	X-ray	1.25	A/B	1-131	[»]
	6UCY	X-ray	1.15	A/B	1-131	[»]
	6UFS	X-ray	1.47	A/B	1-131	[»]
SMRⁱ	P07445
ModBaseⁱ	Search...
PDBe-KBⁱ	Search...

Chemistry databases

BindingDBⁱ	P07445
ChEMBLⁱ	CHEMBL2321641
DrugBankⁱ	DB03619, Deoxycholic acid DB03515, Equilenin
DrugCentralⁱ	P07445

Enzyme and pathway databases

BRENDAⁱ	5.3.3.1, 5092

BRENDAⁱ

5.3.3.1, 5092

Miscellaneous databases

EvolutionaryTraceⁱ	P07445

EvolutionaryTraceⁱ

P07445

Family and domain databases

CDDⁱ	cd00781, ketosteroid_isomerase, 1 hit
InterProⁱ	View protein in InterPro IPR039256, Ketosteroid_isomerase IPR032710, NTF2-like_dom_sf IPR037401, SnoaL-like
Pfamⁱ	View protein in Pfam PF12680, SnoaL_2, 1 hit
SUPFAMⁱ	SSF54427, SSF54427, 1 hit
MobiDBⁱ	Search...

Entry informationⁱ

Entry nameⁱ	SDIS_PSEPU
Accessionⁱ	P07445Primary (citable) accession number: P07445
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	April 1, 1988
	Last sequence update:	April 1, 1988
	Last modified:	February 23, 2022
	This is version 118 of the entry and version 1 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Prokaryotic Protein Annotation Program

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P07445 (SDIS_PSEPU)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the 'basket' to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Steroid Delta-isomerase

ksi

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Chemistry databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Chemistry databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Family and domain databases

Sequence databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Chemistry databases

Enzyme and pathway databases

Miscellaneous databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

Catalytic activityⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Expressionⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ