Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Prostate-specific antigen

Gene

KLK3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Hydrolyzes semenogelin-1 thus leading to the liquefaction of the seminal coagulum.

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

  • Preferential cleavage: -Tyr-|-Xaa-. EC:3.4.21.77

<p>This subsection of the ‘Function’ section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Inhibited by SERPINA5. Activity is strongly inhibited by Zn2+, 100 times more abundant in semen than in serum. This inhibition is relieved by exposure to semenogelins, which are avid zinc binders.2 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei65Charge relay system1 Publication1
Active sitei120Charge relay system1 Publication1
Active sitei213Charge relay system1 Publication1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • endopeptidase activity Source: UniProtKB
  • hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides Source: UniProtKB
  • serine-type endopeptidase activity Source: UniProtKB
  • serine-type peptidase activity Source: ProtInc

GO - Biological processi

  • antibacterial peptide production Source: UniProtKB
  • cellular protein metabolic process Source: Reactome
  • negative regulation of angiogenesis Source: UniProtKB
  • proteolysis Source: UniProtKB
  • regulation of systemic arterial blood pressure Source: GO_Central
  • zymogen activation Source: GO_Central

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Protease, Serine protease

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
3.4.21.77 2681

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-381426 Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
R-HSA-5625886 Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P07288

Protein family/group databases

MEROPS protease database

More...
MEROPSi
S01.162

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Prostate-specific antigen (EC:3.4.21.77)
Short name:
PSA
Alternative name(s):
Gamma-seminoprotein
Short name:
Seminin
Kallikrein-3
P-30 antigen
Semenogelase
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:KLK3
Synonyms:APS
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 19

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000142515.14

Human Gene Nomenclature Database

More...
HGNCi
HGNC:6364 KLK3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
176820 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P07288

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
354

Open Targets

More...
OpenTargetsi
ENSG00000142515

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA164741810

Protein family/group databases

Allergome; a platform for allergen knowledge

More...
Allergomei
2836 Hom s PSA

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL2099

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
2373

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
KLK3

Domain mapping of disease mutations (DMDM)

More...
DMDMi
130989

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 171 PublicationAdd BLAST17
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes a propeptide, which is a part of a protein that is cleaved during maturation or activation. Once cleaved, a propeptide generally has no independent biological function.<p><a href='/help/propep' target='_top'>More...</a></p>PropeptideiPRO_000002793118 – 24Activation peptide2 Publications7
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000002793225 – 261Prostate-specific antigenAdd BLAST237

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi31 ↔ 173PROSITE-ProRule annotation1 Publication
Disulfide bondi50 ↔ 66PROSITE-ProRule annotation1 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi69N-linked (GlcNAc...) asparagine1
Disulfide bondi152 ↔ 219PROSITE-ProRule annotation1 Publication
Disulfide bondi184 ↔ 198PROSITE-ProRule annotation1 Publication
Disulfide bondi209 ↔ 234PROSITE-ProRule annotation1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein, Zymogen

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P07288

PeptideAtlas

More...
PeptideAtlasi
P07288

PRoteomics IDEntifications database

More...
PRIDEi
P07288

ProteomicsDB human proteome resource

More...
ProteomicsDBi
51977

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
790

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P07288

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P07288

UniCarbKB; an annotated and curated database of glycan structures

More...
UniCarbKBi
P07288

Miscellaneous databases

CutDB - Proteolytic event database

More...
PMAP-CutDBi
P07288

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000142515 Expressed in 122 organ(s), highest expression level in prostate gland

CleanEx database of gene expression profiles

More...
CleanExi
HS_KLK3

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P07288 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P07288 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB000070
HPA000764

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Forms a heterodimer with SERPINA5.1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
ARP102753EBI-1220791,EBI-608057

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
106850, 9 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
P07288

Protein interaction database and analysis system

More...
IntActi
P07288, 6 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000314151

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
P07288

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1261
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1PFAmodel-A10-261[»]
2PSAmodel-A25-261[»]
2ZCHX-ray2.83P25-261[»]
2ZCKX-ray3.10P25-261[»]
2ZCLX-ray3.25P25-261[»]
3QUMX-ray3.20P/Q25-261[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P07288

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P07288

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P07288

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini25 – 258Peptidase S1PROSITE-ProRule annotationAdd BLAST234

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the peptidase S1 family. Kallikrein subfamily.PROSITE-ProRule annotation

Keywords - Domaini

Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3627 Eukaryota
COG5640 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153418

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000251820

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG013304

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P07288

KEGG Orthology (KO)

More...
KOi
K01351

Database of Orthologous Groups

More...
OrthoDBi
1314811at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P07288

TreeFam database of animal gene trees

More...
TreeFami
TF331065

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00190 Tryp_SPc, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR009003 Peptidase_S1_PA
IPR001314 Peptidase_S1A
IPR001254 Trypsin_dom
IPR018114 TRYPSIN_HIS
IPR033116 TRYPSIN_SER

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00089 Trypsin, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00722 CHYMOTRYPSIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00020 Tryp_SPc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50494 SSF50494, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50240 TRYPSIN_DOM, 1 hit
PS00134 TRYPSIN_HIS, 1 hit
PS00135 TRYPSIN_SER, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P07288-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MWVPVVFLTL SVTWIGAAPL ILSRIVGGWE CEKHSQPWQV LVASRGRAVC
60 70 80 90 100
GGVLVHPQWV LTAAHCIRNK SVILLGRHSL FHPEDTGQVF QVSHSFPHPL
110 120 130 140 150
YDMSLLKNRF LRPGDDSSHD LMLLRLSEPA ELTDAVKVMD LPTQEPALGT
160 170 180 190 200
TCYASGWGSI EPEEFLTPKK LQCVDLHVIS NDVCAQVHPQ KVTKFMLCAG
210 220 230 240 250
RWTGGKSTCS GDSGGPLVCN GVLQGITSWG SEPCALPERP SLYTKVVHYR
260
KWIKDTIVAN P
Length:261
Mass (Da):28,741
Last modified:July 1, 1989 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iAE9E732AF872141A
GO
Isoform 2 (identifier: P07288-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     211-261: GDSGGPLVCN...WIKDTIVANP → WVILITELTMPALPMVLHGSLVPWRGGV

Note: No experimental confirmation available.
Show »
Length:238
Mass (Da):26,317
Checksum:iD46C6C2B210F70A4
GO
Isoform 3 (identifier: P07288-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     69-69: N → K
     70-112: Missing.

Note: No experimental confirmation available.
Show »
Length:218
Mass (Da):23,725
Checksum:iB62C82BD085CC492
GO
Isoform 4 (identifier: P07288-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     69-69: N → K
     70-261: Missing.

Note: No experimental confirmation available.
Show »
Length:69
Mass (Da):7,616
Checksum:i6781B491913E35B2
GO
Isoform 5 (identifier: P07288-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     211-260: GDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVAN → VSHPYSQDLEGKGEWG

Show »
Length:227
Mass (Da):25,116
Checksum:i2E9B482F3CC3BA12
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q8NCW4Q8NCW4_HUMAN
Prostate-specific antigen
KLK3
220Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0R1F0M0R1F0_HUMAN
Prostate-specific antigen
KLK3
262Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0QZF9M0QZF9_HUMAN
Prostate-specific antigen
KLK3
172Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0R1Z7M0R1Z7_HUMAN
Prostate-specific antigen
KLK3
172Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0R294M0R294_HUMAN
Kallikrein 3, (Prostate specific an...
KLK3 hCG_22929
195Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0QX57M0QX57_HUMAN
Kallikrein 3, (Prostate specific an...
KLK3 hCG_22929
124Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0B4J1X3A0A0B4J1X3_HUMAN
Kallikrein 3, (Prostate specific an...
KLK3 hCG_22929
90Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q8WTQ8Q8WTQ8_HUMAN
Kallikrein 3, (Prostate specific an...
KLK3 hCG_22929
104Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAD14185 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence CAA32124 differs from that shown.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti64A → T (PubMed:2456523).Curated1
Sequence conflicti69N → KC in AAA60193 (PubMed:2466464).Curated1
Sequence conflicti94H → T AA sequence (PubMed:2422647).Curated1
Sequence conflicti136V → M (PubMed:2456523).Curated1
Sequence conflicti165 – 168FLTP → HLLYDQM AA sequence (PubMed:2422647).Curated4
Sequence conflicti175D → Q AA sequence (PubMed:2422647).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_02194132E → K. Corresponds to variant dbSNP:rs2271092Ensembl.1
Natural variantiVAR_021942132L → I1 PublicationCorresponds to variant dbSNP:rs2003783Ensembl.1
Natural variantiVAR_051852179I → T. Corresponds to variant dbSNP:rs17632542Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04616969N → K in isoform 3 and isoform 4. 1 Publication1
Alternative sequenceiVSP_04617070 – 261Missing in isoform 4. 1 PublicationAdd BLAST192
Alternative sequenceiVSP_04617170 – 112Missing in isoform 3. 1 PublicationAdd BLAST43
Alternative sequenceiVSP_045786211 – 261GDSGG…IVANP → WVILITELTMPALPMVLHGS LVPWRGGV in isoform 2. 1 PublicationAdd BLAST51
Alternative sequenceiVSP_047643211 – 260GDSGG…TIVAN → VSHPYSQDLEGKGEWG in isoform 5. 1 PublicationAdd BLAST50

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
M21896 mRNA Translation: AAA59996.1
X05332 mRNA Translation: CAA28947.1
X13940 Genomic DNA Translation: CAA32123.1
X13941 Genomic DNA Translation: CAA32124.1 Sequence problems.
X13942 Genomic DNA Translation: CAB46487.1
X13943 Genomic DNA Translation: CAA32126.1
X13944 Genomic DNA Translation: CAA32127.1
X14810 Genomic DNA Translation: CAA32915.1
M27274 Genomic DNA Translation: AAA60192.1
M26663 mRNA Translation: AAA58802.1
M24543 Genomic DNA Translation: AAA60193.1
U17040 mRNA Translation: AAA56764.1
AF243527 Genomic DNA Translation: AAG33355.1
AJ512346 mRNA Translation: CAD54617.1
BT019862 mRNA Translation: AAV38665.1
AC011523 Genomic DNA No translation available.
CH471135 Genomic DNA Translation: EAW71929.1
CH471135 Genomic DNA Translation: EAW71930.1
CH471135 Genomic DNA Translation: EAW71936.1
BC005307 mRNA Translation: AAH05307.1
BC050595 mRNA Translation: AAH50595.2
BC056665 mRNA Translation: AAH56665.1
BF679511 mRNA No translation available.
BQ932072 mRNA No translation available.
S75755 mRNA Translation: AAD14185.1 Different initiation.
X07730 mRNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS12807.1 [P07288-1]
CCDS33083.1 [P07288-2]
CCDS46155.1 [P07288-3]

Protein sequence database of the Protein Information Resource

More...
PIRi
A32297

NCBI Reference Sequences

More...
RefSeqi
NP_001025218.1, NM_001030047.1 [P07288-2]
NP_001025219.1, NM_001030048.1 [P07288-3]
NP_001639.1, NM_001648.2 [P07288-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.171995

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000326003; ENSP00000314151; ENSG00000142515 [P07288-1]
ENST00000360617; ENSP00000353829; ENSG00000142515 [P07288-2]
ENST00000593997; ENSP00000472907; ENSG00000142515 [P07288-5]
ENST00000595952; ENSP00000471155; ENSG00000142515 [P07288-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
354

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:354

UCSC genome browser

More...
UCSCi
uc002ptr.2 human [P07288-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Wikipedia

Prostate-specific antigen entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M21896 mRNA Translation: AAA59996.1
X05332 mRNA Translation: CAA28947.1
X13940 Genomic DNA Translation: CAA32123.1
X13941 Genomic DNA Translation: CAA32124.1 Sequence problems.
X13942 Genomic DNA Translation: CAB46487.1
X13943 Genomic DNA Translation: CAA32126.1
X13944 Genomic DNA Translation: CAA32127.1
X14810 Genomic DNA Translation: CAA32915.1
M27274 Genomic DNA Translation: AAA60192.1
M26663 mRNA Translation: AAA58802.1
M24543 Genomic DNA Translation: AAA60193.1
U17040 mRNA Translation: AAA56764.1
AF243527 Genomic DNA Translation: AAG33355.1
AJ512346 mRNA Translation: CAD54617.1
BT019862 mRNA Translation: AAV38665.1
AC011523 Genomic DNA No translation available.
CH471135 Genomic DNA Translation: EAW71929.1
CH471135 Genomic DNA Translation: EAW71930.1
CH471135 Genomic DNA Translation: EAW71936.1
BC005307 mRNA Translation: AAH05307.1
BC050595 mRNA Translation: AAH50595.2
BC056665 mRNA Translation: AAH56665.1
BF679511 mRNA No translation available.
BQ932072 mRNA No translation available.
S75755 mRNA Translation: AAD14185.1 Different initiation.
X07730 mRNA No translation available.
CCDSiCCDS12807.1 [P07288-1]
CCDS33083.1 [P07288-2]
CCDS46155.1 [P07288-3]
PIRiA32297
RefSeqiNP_001025218.1, NM_001030047.1 [P07288-2]
NP_001025219.1, NM_001030048.1 [P07288-3]
NP_001639.1, NM_001648.2 [P07288-1]
UniGeneiHs.171995

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1PFAmodel-A10-261[»]
2PSAmodel-A25-261[»]
2ZCHX-ray2.83P25-261[»]
2ZCKX-ray3.10P25-261[»]
2ZCLX-ray3.25P25-261[»]
3QUMX-ray3.20P/Q25-261[»]
ProteinModelPortaliP07288
SMRiP07288
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi106850, 9 interactors
CORUMiP07288
IntActiP07288, 6 interactors
STRINGi9606.ENSP00000314151

Chemistry databases

BindingDBiP07288
ChEMBLiCHEMBL2099
GuidetoPHARMACOLOGYi2373

Protein family/group databases

Allergomei2836 Hom s PSA
MEROPSiS01.162

PTM databases

GlyConnecti790
iPTMnetiP07288
PhosphoSitePlusiP07288
UniCarbKBiP07288

Polymorphism and mutation databases

BioMutaiKLK3
DMDMi130989

Proteomic databases

PaxDbiP07288
PeptideAtlasiP07288
PRIDEiP07288
ProteomicsDBi51977

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
354
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000326003; ENSP00000314151; ENSG00000142515 [P07288-1]
ENST00000360617; ENSP00000353829; ENSG00000142515 [P07288-2]
ENST00000593997; ENSP00000472907; ENSG00000142515 [P07288-5]
ENST00000595952; ENSP00000471155; ENSG00000142515 [P07288-3]
GeneIDi354
KEGGihsa:354
UCSCiuc002ptr.2 human [P07288-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
354
DisGeNETi354
EuPathDBiHostDB:ENSG00000142515.14

GeneCards: human genes, protein and diseases

More...
GeneCardsi
KLK3
HGNCiHGNC:6364 KLK3
HPAiCAB000070
HPA000764
MIMi176820 gene
neXtProtiNX_P07288
OpenTargetsiENSG00000142515
PharmGKBiPA164741810

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3627 Eukaryota
COG5640 LUCA
GeneTreeiENSGT00940000153418
HOGENOMiHOG000251820
HOVERGENiHBG013304
InParanoidiP07288
KOiK01351
OrthoDBi1314811at2759
PhylomeDBiP07288
TreeFamiTF331065

Enzyme and pathway databases

BRENDAi3.4.21.77 2681
ReactomeiR-HSA-381426 Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
R-HSA-5625886 Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3
SIGNORiP07288

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
KLK3 human
EvolutionaryTraceiP07288

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
Prostate-specific_antigen

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
354
PMAP-CutDBiP07288

Protein Ontology

More...
PROi
PR:P07288

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000142515 Expressed in 122 organ(s), highest expression level in prostate gland
CleanExiHS_KLK3
ExpressionAtlasiP07288 baseline and differential
GenevisibleiP07288 HS

Family and domain databases

CDDicd00190 Tryp_SPc, 1 hit
InterProiView protein in InterPro
IPR009003 Peptidase_S1_PA
IPR001314 Peptidase_S1A
IPR001254 Trypsin_dom
IPR018114 TRYPSIN_HIS
IPR033116 TRYPSIN_SER
PfamiView protein in Pfam
PF00089 Trypsin, 1 hit
PRINTSiPR00722 CHYMOTRYPSIN
SMARTiView protein in SMART
SM00020 Tryp_SPc, 1 hit
SUPFAMiSSF50494 SSF50494, 1 hit
PROSITEiView protein in PROSITE
PS50240 TRYPSIN_DOM, 1 hit
PS00134 TRYPSIN_HIS, 1 hit
PS00135 TRYPSIN_SER, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiKLK3_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P07288
Secondary accession number(s): C9JXH3
, G3V0H4, G3XAE3, Q15096, Q16272, Q86TG8, Q8IXI4
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 1, 1988
Last sequence update: July 1, 1989
Last modified: January 16, 2019
This is version 202 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Peptidase families
    Classification of peptidase families and list of entries
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again