Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Acyl-CoA-binding protein

Gene

DBI

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei14Acyl-CoACombined sources1 Publication1
Binding sitei55Acyl-CoACombined sources1 Publication1
Binding sitei74Acyl-CoACombined sources1 Publication1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • benzodiazepine receptor binding Source: ProtInc
  • lipid binding Source: UniProtKB-KW
  • long-chain fatty acyl-CoA binding Source: UniProtKB
  • protein dimerization activity Source: UniProtKB

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processTransport
LigandLipid-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-77289 Mitochondrial Fatty Acid Beta-Oxidation

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P07108

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Acyl-CoA-binding protein
Short name:
ACBP
Alternative name(s):
Diazepam-binding inhibitor
Short name:
DBI
Endozepine
Short name:
EP
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:DBI
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000155368.16

Human Gene Nomenclature Database

More...
HGNCi
HGNC:2690 DBI

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
125950 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P07108

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Endoplasmic reticulum, Golgi apparatus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
1622

Open Targets

More...
OpenTargetsi
ENSG00000155368

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA27158

Chemistry databases

Drug and drug target database

More...
DrugBanki
DB01992 Coenzyme A
DB03381 Hexadecanal

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
DBI

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources1 Publication
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002140042 – 87Acyl-CoA-binding proteinAdd BLAST86

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylserineCombined sources1 Publication1
Modified residuei8N6-acetyllysine; alternateCombined sources1
Modified residuei8N6-succinyllysine; alternateBy similarity1
Modified residuei17N6-succinyllysineBy similarity1
Modified residuei19N6-acetyllysineCombined sources1
Modified residuei29PhosphotyrosineCombined sources1
Modified residuei55N6-acetyllysine; alternateCombined sources1
Modified residuei55N6-malonyllysine; alternate1 Publication1
Modified residuei55N6-succinyllysine; alternateBy similarity1
Modified residuei77N6-acetyllysine; alternateCombined sources1
Modified residuei77N6-succinyllysine; alternateBy similarity1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P07108

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P07108

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P07108

PeptideAtlas

More...
PeptideAtlasi
P07108

PRoteomics IDEntifications database

More...
PRIDEi
P07108

ProteomicsDB human proteome resource

More...
ProteomicsDBi
51954
51955 [P07108-2]
51956 [P07108-3]
51957 [P07108-4]
51958 [P07108-5]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
P07108-1 [P07108-1]
P07108-3 [P07108-3]
P07108-4 [P07108-4]
P07108-5 [P07108-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P07108

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P07108

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
P07108

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 1 is ubiquitous, with a moderate expression level. Isoform 2 is ubiquitous with high level in liver and adipose tissue. Isoform 3 is ubiquitous with strong expression in adipose tissue and heart.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000155368 Expressed in 239 organ(s), highest expression level in spinal cord

CleanEx database of gene expression profiles

More...
CleanExi
HS_DBI

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P07108 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P07108 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA051428

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Monomer.1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
107990, 20 interactors

Protein interaction database and analysis system

More...
IntActi
P07108, 17 interactors

Molecular INTeraction database

More...
MINTi
P07108

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000440698

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

187
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P07108

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P07108

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P07108

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini2 – 87ACBPROSITE-ProRule annotationAdd BLAST86

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni29 – 33Acyl-CoA bindingCombined sources1 Publication5

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the ACBP family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0817 Eukaryota
COG4281 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154846

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000261845

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG000398

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P07108

KEGG Orthology (KO)

More...
KOi
K08762

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0NXJ

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P07108

TreeFam database of animal gene trees

More...
TreeFami
TF335802

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00435 ACBP, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.80.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR022408 Acyl-CoA-binding_prot_CS
IPR000582 Acyl-CoA-binding_protein
IPR035984 Acyl-CoA-binding_sf
IPR014352 FERM/acyl-CoA-bd_prot_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00887 ACBP, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00689 ACOABINDINGP

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47027 SSF47027, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00880 ACB_1, 1 hit
PS51228 ACB_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative promoter usage and alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P07108-1) [UniParc]FASTAAdd to basket
Also known as: ACBP-1a, Short

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSQAEFEKAA EEVRHLKTKP SDEEMLFIYG HYKQATVGDI NTERPGMLDF
60 70 80
TGKAKWDAWN ELKGTSKEDA MKAYINKVEE LKKKYGI
Length:87
Mass (Da):10,044
Last modified:January 23, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB343A309F1B1AE28
GO
Isoform 2 (identifier: P07108-2) [UniParc]FASTAAdd to basket
Also known as: ACBP-1b, Long

The sequence of this isoform differs from the canonical sequence as follows:
     1-3: MSQ → MWGDLWLLPPASANPGTGTE

Show »
Length:104
Mass (Da):11,793
Checksum:i54D0238ABE40BCD2
GO
Isoform 3 (identifier: P07108-3) [UniParc]FASTAAdd to basket
Also known as: ACBP-1c

The sequence of this isoform differs from the canonical sequence as follows:
     1-3: MSQ → MPAF

Show »
Length:88
Mass (Da):10,145
Checksum:iF4FFCEBA6D9D4330
GO
Isoform 4 (identifier: P07108-4) [UniParc]FASTAAdd to basket
Also known as: ACBP-1a1-g

The sequence of this isoform differs from the canonical sequence as follows:
     1-3: MSQ → MSQHRAGRRGGVGKRGVRGRELGGQGKYGAGCSECGTRRIAARGE

Show »
Length:129
Mass (Da):14,367
Checksum:iA3985333C4BE1F8F
GO
Isoform 5 (identifier: P07108-5) [UniParc]FASTAAdd to basket
Also known as: ACBP-1g

The sequence of this isoform differs from the canonical sequence as follows:
     1-3: MSQ → MERWGKGLHGLEERGDSVPIPKHRAGRRGGVGKRGVRGRELGGQGKYGAGCSECGTRRIAARGE

Show »
Length:148
Mass (Da):16,495
Checksum:i29F51D3DA08F300B
GO
Isoform 6 (identifier: P07108-6) [UniParc]FASTAAdd to basket
Also known as: ACBP-1e

The sequence of this isoform differs from the canonical sequence as follows:
     43-87: ERPGMLDFTG...VEELKKKYGI → GMQSGGWKGI...YWPSPAATLY

Note: Predominantly expressed in adipose tissue and hippocampus.
Show »
Length:123
Mass (Da):13,911
Checksum:i61407128B4E7B1DD
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B8ZWD1B8ZWD1_HUMAN
Acyl-CoA-binding protein
DBI
97Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MTI5A0A0A0MTI5_HUMAN
Acyl-CoA-binding protein
DBI
143Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_04816039D → N. Corresponds to variant dbSNP:rs8192504Ensembl.1
Natural variantiVAR_04816171M → V. Corresponds to variant dbSNP:rs8192506Ensembl.1
Natural variantiVAR_04816286G → R. Corresponds to variant dbSNP:rs8192507Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0000681 – 3MSQ → MWGDLWLLPPASANPGTGTE in isoform 2. 3 Publications3
Alternative sequenceiVSP_0386801 – 3MSQ → MPAF in isoform 3. 1 Publication3
Alternative sequenceiVSP_0434371 – 3MSQ → MSQHRAGRRGGVGKRGVRGR ELGGQGKYGAGCSECGTRRI AARGE in isoform 4. 1 Publication3
Alternative sequenceiVSP_0434381 – 3MSQ → MERWGKGLHGLEERGDSVPI PKHRAGRRGGVGKRGVRGRE LGGQGKYGAGCSECGTRRIA ARGE in isoform 5. 1 Publication3
Alternative sequenceiVSP_04411443 – 87ERPGM…KKYGI → GMQSGGWKGICSSKQAQQLR LEVPGNFTLKLPEALLFRWG MVMVPEVEKTMFRILSVSSS NRIQILVLEGLYWPSPAATL Y in isoform 6. 1 PublicationAdd BLAST45

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
M14200 mRNA Translation: AAA52171.1
M15887 mRNA Translation: AAA35788.1
FM213123 mRNA Translation: CAR82405.1
FM213124 mRNA Translation: CAR82406.1
FM213125 mRNA Translation: CAR82407.1
FM213126 mRNA Translation: CAR82408.1
FM213127 mRNA Translation: CAR82409.1
FM213128 mRNA Translation: CAR82410.1
FM213131 mRNA Translation: CAR82414.1
CR456956 mRNA Translation: CAG33237.1
AC016736 Genomic DNA Translation: AAY14873.1
CH471103 Genomic DNA Translation: EAW95214.1
BC006466 mRNA No translation available.
BC062996 mRNA Translation: AAH62996.1
AM000001 mRNA Translation: CAJ00736.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS2126.1 [P07108-2]
CCDS42740.1 [P07108-1]
CCDS42741.1 [P07108-3]
CCDS54390.1 [P07108-4]
CCDS54391.1 [P07108-5]

Protein sequence database of the Protein Information Resource

More...
PIRi
B26448 NZHU

NCBI Reference Sequences

More...
RefSeqi
NP_001073331.1, NM_001079862.2 [P07108-1]
NP_001073332.1, NM_001079863.1 [P07108-3]
NP_001171488.1, NM_001178017.1 [P07108-5]
NP_001171512.1, NM_001178041.2 [P07108-4]
NP_001171513.1, NM_001178042.2 [P07108-2]
NP_001269562.1, NM_001282633.1 [P07108-2]
NP_001269563.1, NM_001282634.1 [P07108-2]
NP_001269564.1, NM_001282635.1 [P07108-2]
NP_065438.1, NM_020548.7 [P07108-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.78888

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000311521; ENSP00000311117; ENSG00000155368 [P07108-2]
ENST00000355857; ENSP00000348116; ENSG00000155368 [P07108-1]
ENST00000393103; ENSP00000376815; ENSG00000155368 [P07108-3]
ENST00000409094; ENSP00000386486; ENSG00000155368 [P07108-2]
ENST00000535757; ENSP00000439012; ENSG00000155368 [P07108-2]
ENST00000627093; ENSP00000486281; ENSG00000155368 [P07108-4]
ENST00000627305; ENSP00000486361; ENSG00000155368 [P07108-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
1622

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:1622

UCSC genome browser

More...
UCSCi
uc002tlv.5 human [P07108-1]

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M14200 mRNA Translation: AAA52171.1
M15887 mRNA Translation: AAA35788.1
FM213123 mRNA Translation: CAR82405.1
FM213124 mRNA Translation: CAR82406.1
FM213125 mRNA Translation: CAR82407.1
FM213126 mRNA Translation: CAR82408.1
FM213127 mRNA Translation: CAR82409.1
FM213128 mRNA Translation: CAR82410.1
FM213131 mRNA Translation: CAR82414.1
CR456956 mRNA Translation: CAG33237.1
AC016736 Genomic DNA Translation: AAY14873.1
CH471103 Genomic DNA Translation: EAW95214.1
BC006466 mRNA No translation available.
BC062996 mRNA Translation: AAH62996.1
AM000001 mRNA Translation: CAJ00736.1
CCDSiCCDS2126.1 [P07108-2]
CCDS42740.1 [P07108-1]
CCDS42741.1 [P07108-3]
CCDS54390.1 [P07108-4]
CCDS54391.1 [P07108-5]
PIRiB26448 NZHU
RefSeqiNP_001073331.1, NM_001079862.2 [P07108-1]
NP_001073332.1, NM_001079863.1 [P07108-3]
NP_001171488.1, NM_001178017.1 [P07108-5]
NP_001171512.1, NM_001178041.2 [P07108-4]
NP_001171513.1, NM_001178042.2 [P07108-2]
NP_001269562.1, NM_001282633.1 [P07108-2]
NP_001269563.1, NM_001282634.1 [P07108-2]
NP_001269564.1, NM_001282635.1 [P07108-2]
NP_065438.1, NM_020548.7 [P07108-2]
UniGeneiHs.78888

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2CB8X-ray1.40A/B2-87[»]
2FJ9X-ray1.60A2-87[»]
ProteinModelPortaliP07108
SMRiP07108
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107990, 20 interactors
IntActiP07108, 17 interactors
MINTiP07108
STRINGi9606.ENSP00000440698

Chemistry databases

DrugBankiDB01992 Coenzyme A
DB03381 Hexadecanal

PTM databases

iPTMnetiP07108
PhosphoSitePlusiP07108
SwissPalmiP07108

Polymorphism and mutation databases

BioMutaiDBI

Proteomic databases

EPDiP07108
MaxQBiP07108
PaxDbiP07108
PeptideAtlasiP07108
PRIDEiP07108
ProteomicsDBi51954
51955 [P07108-2]
51956 [P07108-3]
51957 [P07108-4]
51958 [P07108-5]
TopDownProteomicsiP07108-1 [P07108-1]
P07108-3 [P07108-3]
P07108-4 [P07108-4]
P07108-5 [P07108-5]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
1622
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000311521; ENSP00000311117; ENSG00000155368 [P07108-2]
ENST00000355857; ENSP00000348116; ENSG00000155368 [P07108-1]
ENST00000393103; ENSP00000376815; ENSG00000155368 [P07108-3]
ENST00000409094; ENSP00000386486; ENSG00000155368 [P07108-2]
ENST00000535757; ENSP00000439012; ENSG00000155368 [P07108-2]
ENST00000627093; ENSP00000486281; ENSG00000155368 [P07108-4]
ENST00000627305; ENSP00000486361; ENSG00000155368 [P07108-5]
GeneIDi1622
KEGGihsa:1622
UCSCiuc002tlv.5 human [P07108-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
1622
DisGeNETi1622
EuPathDBiHostDB:ENSG00000155368.16

GeneCards: human genes, protein and diseases

More...
GeneCardsi
DBI
HGNCiHGNC:2690 DBI
HPAiHPA051428
MIMi125950 gene
neXtProtiNX_P07108
OpenTargetsiENSG00000155368
PharmGKBiPA27158

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0817 Eukaryota
COG4281 LUCA
GeneTreeiENSGT00940000154846
HOGENOMiHOG000261845
HOVERGENiHBG000398
InParanoidiP07108
KOiK08762
OrthoDBiEOG091G0NXJ
PhylomeDBiP07108
TreeFamiTF335802

Enzyme and pathway databases

ReactomeiR-HSA-77289 Mitochondrial Fatty Acid Beta-Oxidation
SIGNORiP07108

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
DBI human
EvolutionaryTraceiP07108

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
Diazepam_binding_inhibitor

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
1622

Protein Ontology

More...
PROi
PR:P07108

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000155368 Expressed in 239 organ(s), highest expression level in spinal cord
CleanExiHS_DBI
ExpressionAtlasiP07108 baseline and differential
GenevisibleiP07108 HS

Family and domain databases

CDDicd00435 ACBP, 1 hit
Gene3Di1.20.80.10, 1 hit
InterProiView protein in InterPro
IPR022408 Acyl-CoA-binding_prot_CS
IPR000582 Acyl-CoA-binding_protein
IPR035984 Acyl-CoA-binding_sf
IPR014352 FERM/acyl-CoA-bd_prot_sf
PfamiView protein in Pfam
PF00887 ACBP, 1 hit
PRINTSiPR00689 ACOABINDINGP
SUPFAMiSSF47027 SSF47027, 1 hit
PROSITEiView protein in PROSITE
PS00880 ACB_1, 1 hit
PS51228 ACB_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiACBP_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P07108
Secondary accession number(s): B8ZWD2
, B8ZWD6, B8ZWD7, P08869, Q4VWZ6, Q53SQ7, Q6IB48, Q9UCI8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 1, 1988
Last sequence update: January 23, 2007
Last modified: December 5, 2018
This is version 189 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again