Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Acyl-CoA-binding protein

Gene

DBI

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei14Acyl-CoACombined sources1 Publication1
Binding sitei55Acyl-CoACombined sources1 Publication1
Binding sitei74Acyl-CoACombined sources1 Publication1

GO - Molecular functioni

  • benzodiazepine receptor binding Source: ProtInc
  • lipid binding Source: UniProtKB-KW
  • long-chain fatty acyl-CoA binding Source: UniProtKB
  • protein dimerization activity Source: UniProtKB

GO - Biological processi

Keywordsi

Biological processTransport
LigandLipid-binding

Enzyme and pathway databases

ReactomeiR-HSA-77289 Mitochondrial Fatty Acid Beta-Oxidation
SIGNORiP07108

Names & Taxonomyi

Protein namesi
Recommended name:
Acyl-CoA-binding protein
Short name:
ACBP
Alternative name(s):
Diazepam-binding inhibitor
Short name:
DBI
Endozepine
Short name:
EP
Gene namesi
Name:DBI
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000155368.16
HGNCiHGNC:2690 DBI
MIMi125950 gene
neXtProtiNX_P07108

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Endoplasmic reticulum, Golgi apparatus

Pathology & Biotechi

Organism-specific databases

DisGeNETi1622
OpenTargetsiENSG00000155368
PharmGKBiPA27158

Chemistry databases

DrugBankiDB01992 Coenzyme A
DB03381 Hexadecanal

Polymorphism and mutation databases

BioMutaiDBI

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources1 Publication
ChainiPRO_00002140042 – 87Acyl-CoA-binding proteinAdd BLAST86

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylserineCombined sources1 Publication1
Modified residuei8N6-acetyllysine; alternateCombined sources1
Modified residuei8N6-succinyllysine; alternateBy similarity1
Modified residuei17N6-succinyllysineBy similarity1
Modified residuei19N6-acetyllysineCombined sources1
Modified residuei29PhosphotyrosineCombined sources1
Modified residuei55N6-acetyllysine; alternateCombined sources1
Modified residuei55N6-malonyllysine; alternate1 Publication1
Modified residuei55N6-succinyllysine; alternateBy similarity1
Modified residuei77N6-acetyllysine; alternateCombined sources1
Modified residuei77N6-succinyllysine; alternateBy similarity1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiP07108
MaxQBiP07108
PaxDbiP07108
PeptideAtlasiP07108
PRIDEiP07108
ProteomicsDBi51954
51955 [P07108-2]
51956 [P07108-3]
51957 [P07108-4]
51958 [P07108-5]
TopDownProteomicsiP07108-1 [P07108-1]
P07108-3 [P07108-3]
P07108-4 [P07108-4]
P07108-5 [P07108-5]

PTM databases

iPTMnetiP07108
PhosphoSitePlusiP07108
SwissPalmiP07108

Expressioni

Tissue specificityi

Isoform 1 is ubiquitous, with a moderate expression level. Isoform 2 is ubiquitous with high level in liver and adipose tissue. Isoform 3 is ubiquitous with strong expression in adipose tissue and heart.2 Publications

Gene expression databases

BgeeiENSG00000155368 Expressed in 239 organ(s), highest expression level in spinal cord
CleanExiHS_DBI
ExpressionAtlasiP07108 baseline and differential
GenevisibleiP07108 HS

Organism-specific databases

HPAiHPA051428

Interactioni

Subunit structurei

Monomer.1 Publication

GO - Molecular functioni

Protein-protein interaction databases

BioGridi107990, 20 interactors
IntActiP07108, 17 interactors
MINTiP07108
STRINGi9606.ENSP00000440698

Structurei

Secondary structure

187
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliP07108
SMRiP07108
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP07108

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini2 – 87ACBPROSITE-ProRule annotationAdd BLAST86

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni29 – 33Acyl-CoA bindingCombined sources1 Publication5

Sequence similaritiesi

Belongs to the ACBP family.Curated

Phylogenomic databases

eggNOGiKOG0817 Eukaryota
COG4281 LUCA
GeneTreeiENSGT00840000129776
HOGENOMiHOG000261845
HOVERGENiHBG000398
InParanoidiP07108
KOiK08762
OrthoDBiEOG091G0NXJ
PhylomeDBiP07108
TreeFamiTF335802

Family and domain databases

CDDicd00435 ACBP, 1 hit
Gene3Di1.20.80.10, 1 hit
InterProiView protein in InterPro
IPR022408 Acyl-CoA-binding_prot_CS
IPR000582 Acyl-CoA-binding_protein
IPR035984 Acyl-CoA-binding_sf
IPR014352 FERM/acyl-CoA-bd_prot_sf
PfamiView protein in Pfam
PF00887 ACBP, 1 hit
PRINTSiPR00689 ACOABINDINGP
SUPFAMiSSF47027 SSF47027, 1 hit
PROSITEiView protein in PROSITE
PS00880 ACB_1, 1 hit
PS51228 ACB_2, 1 hit

Sequences (6+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 isoformsi produced by alternative promoter usage and alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P07108-1) [UniParc]FASTAAdd to basket
Also known as: ACBP-1a, Short

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSQAEFEKAA EEVRHLKTKP SDEEMLFIYG HYKQATVGDI NTERPGMLDF
60 70 80
TGKAKWDAWN ELKGTSKEDA MKAYINKVEE LKKKYGI
Length:87
Mass (Da):10,044
Last modified:January 23, 2007 - v2
Checksum:iB343A309F1B1AE28
GO
Isoform 2 (identifier: P07108-2) [UniParc]FASTAAdd to basket
Also known as: ACBP-1b, Long

The sequence of this isoform differs from the canonical sequence as follows:
     1-3: MSQ → MWGDLWLLPPASANPGTGTE

Show »
Length:104
Mass (Da):11,793
Checksum:i54D0238ABE40BCD2
GO
Isoform 3 (identifier: P07108-3) [UniParc]FASTAAdd to basket
Also known as: ACBP-1c

The sequence of this isoform differs from the canonical sequence as follows:
     1-3: MSQ → MPAF

Show »
Length:88
Mass (Da):10,145
Checksum:iF4FFCEBA6D9D4330
GO
Isoform 4 (identifier: P07108-4) [UniParc]FASTAAdd to basket
Also known as: ACBP-1a1-g

The sequence of this isoform differs from the canonical sequence as follows:
     1-3: MSQ → MSQHRAGRRGGVGKRGVRGRELGGQGKYGAGCSECGTRRIAARGE

Show »
Length:129
Mass (Da):14,367
Checksum:iA3985333C4BE1F8F
GO
Isoform 5 (identifier: P07108-5) [UniParc]FASTAAdd to basket
Also known as: ACBP-1g

The sequence of this isoform differs from the canonical sequence as follows:
     1-3: MSQ → MERWGKGLHGLEERGDSVPIPKHRAGRRGGVGKRGVRGRELGGQGKYGAGCSECGTRRIAARGE

Show »
Length:148
Mass (Da):16,495
Checksum:i29F51D3DA08F300B
GO
Isoform 6 (identifier: P07108-6) [UniParc]FASTAAdd to basket
Also known as: ACBP-1e

The sequence of this isoform differs from the canonical sequence as follows:
     43-87: ERPGMLDFTG...VEELKKKYGI → GMQSGGWKGI...YWPSPAATLY

Note: Predominantly expressed in adipose tissue and hippocampus.
Show »
Length:123
Mass (Da):13,911
Checksum:i61407128B4E7B1DD
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B8ZWD1B8ZWD1_HUMAN
Acyl-CoA-binding protein
DBI
97Annotation score:
A0A0A0MTI5A0A0A0MTI5_HUMAN
Acyl-CoA-binding protein
DBI
143Annotation score:

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_04816039D → N. Corresponds to variant dbSNP:rs8192504Ensembl.1
Natural variantiVAR_04816171M → V. Corresponds to variant dbSNP:rs8192506Ensembl.1
Natural variantiVAR_04816286G → R. Corresponds to variant dbSNP:rs8192507Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0000681 – 3MSQ → MWGDLWLLPPASANPGTGTE in isoform 2. 3 Publications3
Alternative sequenceiVSP_0386801 – 3MSQ → MPAF in isoform 3. 1 Publication3
Alternative sequenceiVSP_0434371 – 3MSQ → MSQHRAGRRGGVGKRGVRGR ELGGQGKYGAGCSECGTRRI AARGE in isoform 4. 1 Publication3
Alternative sequenceiVSP_0434381 – 3MSQ → MERWGKGLHGLEERGDSVPI PKHRAGRRGGVGKRGVRGRE LGGQGKYGAGCSECGTRRIA ARGE in isoform 5. 1 Publication3
Alternative sequenceiVSP_04411443 – 87ERPGM…KKYGI → GMQSGGWKGICSSKQAQQLR LEVPGNFTLKLPEALLFRWG MVMVPEVEKTMFRILSVSSS NRIQILVLEGLYWPSPAATL Y in isoform 6. 1 PublicationAdd BLAST45

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M14200 mRNA Translation: AAA52171.1
M15887 mRNA Translation: AAA35788.1
FM213123 mRNA Translation: CAR82405.1
FM213124 mRNA Translation: CAR82406.1
FM213125 mRNA Translation: CAR82407.1
FM213126 mRNA Translation: CAR82408.1
FM213127 mRNA Translation: CAR82409.1
FM213128 mRNA Translation: CAR82410.1
FM213131 mRNA Translation: CAR82414.1
CR456956 mRNA Translation: CAG33237.1
AC016736 Genomic DNA Translation: AAY14873.1
CH471103 Genomic DNA Translation: EAW95214.1
BC006466 mRNA No translation available.
BC062996 mRNA Translation: AAH62996.1
AM000001 mRNA Translation: CAJ00736.1
CCDSiCCDS2126.1 [P07108-2]
CCDS42740.1 [P07108-1]
CCDS42741.1 [P07108-3]
CCDS54390.1 [P07108-4]
CCDS54391.1 [P07108-5]
PIRiB26448 NZHU
RefSeqiNP_001073331.1, NM_001079862.2 [P07108-1]
NP_001073332.1, NM_001079863.1 [P07108-3]
NP_001171488.1, NM_001178017.1 [P07108-5]
NP_001171512.1, NM_001178041.2 [P07108-4]
NP_001171513.1, NM_001178042.2 [P07108-2]
NP_001269562.1, NM_001282633.1 [P07108-2]
NP_001269563.1, NM_001282634.1 [P07108-2]
NP_001269564.1, NM_001282635.1 [P07108-2]
NP_065438.1, NM_020548.7 [P07108-2]
UniGeneiHs.78888

Genome annotation databases

EnsembliENST00000311521; ENSP00000311117; ENSG00000155368 [P07108-2]
ENST00000355857; ENSP00000348116; ENSG00000155368 [P07108-1]
ENST00000393103; ENSP00000376815; ENSG00000155368 [P07108-3]
ENST00000409094; ENSP00000386486; ENSG00000155368 [P07108-2]
ENST00000535757; ENSP00000439012; ENSG00000155368 [P07108-2]
ENST00000627093; ENSP00000486281; ENSG00000155368 [P07108-4]
ENST00000627305; ENSP00000486361; ENSG00000155368 [P07108-5]
GeneIDi1622
KEGGihsa:1622
UCSCiuc002tlv.5 human [P07108-1]

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M14200 mRNA Translation: AAA52171.1
M15887 mRNA Translation: AAA35788.1
FM213123 mRNA Translation: CAR82405.1
FM213124 mRNA Translation: CAR82406.1
FM213125 mRNA Translation: CAR82407.1
FM213126 mRNA Translation: CAR82408.1
FM213127 mRNA Translation: CAR82409.1
FM213128 mRNA Translation: CAR82410.1
FM213131 mRNA Translation: CAR82414.1
CR456956 mRNA Translation: CAG33237.1
AC016736 Genomic DNA Translation: AAY14873.1
CH471103 Genomic DNA Translation: EAW95214.1
BC006466 mRNA No translation available.
BC062996 mRNA Translation: AAH62996.1
AM000001 mRNA Translation: CAJ00736.1
CCDSiCCDS2126.1 [P07108-2]
CCDS42740.1 [P07108-1]
CCDS42741.1 [P07108-3]
CCDS54390.1 [P07108-4]
CCDS54391.1 [P07108-5]
PIRiB26448 NZHU
RefSeqiNP_001073331.1, NM_001079862.2 [P07108-1]
NP_001073332.1, NM_001079863.1 [P07108-3]
NP_001171488.1, NM_001178017.1 [P07108-5]
NP_001171512.1, NM_001178041.2 [P07108-4]
NP_001171513.1, NM_001178042.2 [P07108-2]
NP_001269562.1, NM_001282633.1 [P07108-2]
NP_001269563.1, NM_001282634.1 [P07108-2]
NP_001269564.1, NM_001282635.1 [P07108-2]
NP_065438.1, NM_020548.7 [P07108-2]
UniGeneiHs.78888

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2CB8X-ray1.40A/B2-87[»]
2FJ9X-ray1.60A2-87[»]
ProteinModelPortaliP07108
SMRiP07108
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107990, 20 interactors
IntActiP07108, 17 interactors
MINTiP07108
STRINGi9606.ENSP00000440698

Chemistry databases

DrugBankiDB01992 Coenzyme A
DB03381 Hexadecanal

PTM databases

iPTMnetiP07108
PhosphoSitePlusiP07108
SwissPalmiP07108

Polymorphism and mutation databases

BioMutaiDBI

Proteomic databases

EPDiP07108
MaxQBiP07108
PaxDbiP07108
PeptideAtlasiP07108
PRIDEiP07108
ProteomicsDBi51954
51955 [P07108-2]
51956 [P07108-3]
51957 [P07108-4]
51958 [P07108-5]
TopDownProteomicsiP07108-1 [P07108-1]
P07108-3 [P07108-3]
P07108-4 [P07108-4]
P07108-5 [P07108-5]

Protocols and materials databases

DNASUi1622
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000311521; ENSP00000311117; ENSG00000155368 [P07108-2]
ENST00000355857; ENSP00000348116; ENSG00000155368 [P07108-1]
ENST00000393103; ENSP00000376815; ENSG00000155368 [P07108-3]
ENST00000409094; ENSP00000386486; ENSG00000155368 [P07108-2]
ENST00000535757; ENSP00000439012; ENSG00000155368 [P07108-2]
ENST00000627093; ENSP00000486281; ENSG00000155368 [P07108-4]
ENST00000627305; ENSP00000486361; ENSG00000155368 [P07108-5]
GeneIDi1622
KEGGihsa:1622
UCSCiuc002tlv.5 human [P07108-1]

Organism-specific databases

CTDi1622
DisGeNETi1622
EuPathDBiHostDB:ENSG00000155368.16
GeneCardsiDBI
HGNCiHGNC:2690 DBI
HPAiHPA051428
MIMi125950 gene
neXtProtiNX_P07108
OpenTargetsiENSG00000155368
PharmGKBiPA27158
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0817 Eukaryota
COG4281 LUCA
GeneTreeiENSGT00840000129776
HOGENOMiHOG000261845
HOVERGENiHBG000398
InParanoidiP07108
KOiK08762
OrthoDBiEOG091G0NXJ
PhylomeDBiP07108
TreeFamiTF335802

Enzyme and pathway databases

ReactomeiR-HSA-77289 Mitochondrial Fatty Acid Beta-Oxidation
SIGNORiP07108

Miscellaneous databases

ChiTaRSiDBI human
EvolutionaryTraceiP07108
GeneWikiiDiazepam_binding_inhibitor
GenomeRNAii1622
PROiPR:P07108
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000155368 Expressed in 239 organ(s), highest expression level in spinal cord
CleanExiHS_DBI
ExpressionAtlasiP07108 baseline and differential
GenevisibleiP07108 HS

Family and domain databases

CDDicd00435 ACBP, 1 hit
Gene3Di1.20.80.10, 1 hit
InterProiView protein in InterPro
IPR022408 Acyl-CoA-binding_prot_CS
IPR000582 Acyl-CoA-binding_protein
IPR035984 Acyl-CoA-binding_sf
IPR014352 FERM/acyl-CoA-bd_prot_sf
PfamiView protein in Pfam
PF00887 ACBP, 1 hit
PRINTSiPR00689 ACOABINDINGP
SUPFAMiSSF47027 SSF47027, 1 hit
PROSITEiView protein in PROSITE
PS00880 ACB_1, 1 hit
PS51228 ACB_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiACBP_HUMAN
AccessioniPrimary (citable) accession number: P07108
Secondary accession number(s): B8ZWD2
, B8ZWD6, B8ZWD7, P08869, Q4VWZ6, Q53SQ7, Q6IB48, Q9UCI8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 1, 1988
Last sequence update: January 23, 2007
Last modified: September 12, 2018
This is version 188 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again