Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Glucose-6-phosphate isomerase

Gene

GPI

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Besides it's role as a glycolytic enzyme, mammalian GPI can function as a tumor-secreted cytokine and an angiogenic factor (AMF) that stimulates endothelial cell motility. GPI is also a neurotrophic factor (Neuroleukin) for spinal and sensory neurons.2 Publications

Catalytic activityi

D-glucose 6-phosphate = D-fructose 6-phosphate.

Pathwayi: glycolysis

This protein is involved in step 2 of the subpathway that synthesizes D-glyceraldehyde 3-phosphate and glycerone phosphate from D-glucose.
Proteins known to be involved in the 4 steps of the subpathway in this organism are:
  1. no protein annotated in this organism
  2. Glucose-6-phosphate isomerase (GPI), Glucose-6-phosphate isomerase (GPI), Glucose-6-phosphate isomerase (GPI), Glucose-6-phosphate isomerase, Glucose-6-phosphate isomerase, Glucose-6-phosphate isomerase (GPI), Glucose-6-phosphate isomerase (pgi), Glucose-6-phosphate isomerase (GPI), Glucose-6-phosphate isomerase (GPI), Glucose-6-phosphate isomerase
  3. ATP-dependent 6-phosphofructokinase, muscle type (PFKM), ATP-dependent 6-phosphofructokinase, liver type (PFKL), ATP-dependent 6-phosphofructokinase, platelet type (PFKP), ATP-dependent 6-phosphofructokinase (PFKM), ATP-dependent 6-phosphofructokinase (PFKM)
  4. Fructose-bisphosphate aldolase B (ALDOB), Fructose-bisphosphate aldolase A (ALDOA), Fructose-bisphosphate aldolase C (ALDOC), Fructose-bisphosphate aldolase, Fructose-bisphosphate aldolase, Fructose-bisphosphate aldolase, Fructose-bisphosphate aldolase (ALDOC), Fructose-bisphosphate aldolase, Fructose-bisphosphate aldolase (ALDOB), Fructose-bisphosphate aldolase, Fructose-bisphosphate aldolase, Fructose-bisphosphate aldolase (BQ8482_350140), Fructose-bisphosphate aldolase (ALDOA), Fructose-bisphosphate aldolase (ALDOA), Fructose-bisphosphate aldolase, Fructose-bisphosphate aldolase, Fructose-bisphosphate aldolase, Fructose-bisphosphate aldolase, Fructose-bisphosphate aldolase (HEL-S-87p), Fructose-bisphosphate aldolase (ALDOC), Fructose-bisphosphate aldolase (ALDOB), Fructose-bisphosphate aldolase (ALDOA), Fructose-bisphosphate aldolase (ALDOA)
This subpathway is part of the pathway glycolysis, which is itself part of Carbohydrate degradation.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes D-glyceraldehyde 3-phosphate and glycerone phosphate from D-glucose, the pathway glycolysis and in Carbohydrate degradation.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei358Proton donor1
Active sitei3891
Active sitei5191

GO - Molecular functioni

  • cytokine activity Source: UniProtKB-KW
  • glucose-6-phosphate isomerase activity Source: GO_Central
  • growth factor activity Source: UniProtKB-KW
  • intramolecular transferase activity Source: GO_Central
  • monosaccharide binding Source: GO_Central
  • ubiquitin protein ligase binding Source: ParkinsonsUK-UCL

GO - Biological processi

Keywordsi

Molecular functionCytokine, Growth factor, Isomerase
Biological processGluconeogenesis, Glycolysis

Enzyme and pathway databases

BioCyciMetaCyc:HS02693-MONOMER
BRENDAi5.3.1.9 2681
ReactomeiR-HSA-5628897 TP53 Regulates Metabolic Genes
R-HSA-6798695 Neutrophil degranulation
R-HSA-70171 Glycolysis
R-HSA-70263 Gluconeogenesis
SABIO-RKiP06744
SIGNORiP06744
UniPathwayi
UPA00109;UER00181

Protein family/group databases

MoonDBiP06744 Curated

Names & Taxonomyi

Protein namesi
Recommended name:
Glucose-6-phosphate isomerase (EC:5.3.1.9)
Short name:
GPI
Alternative name(s):
Autocrine motility factor
Short name:
AMF
Neuroleukin
Short name:
NLK
Phosphoglucose isomerase
Short name:
PGI
Phosphohexose isomerase
Short name:
PHI
Sperm antigen 36
Short name:
SA-36
Gene namesi
Name:GPI
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

EuPathDBiHostDB:ENSG00000105220.14
HGNCiHGNC:4458 GPI
MIMi172400 gene
neXtProtiNX_P06744

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Secreted

Pathology & Biotechi

Involvement in diseasei

Hemolytic anemia, non-spherocytic, due to glucose phosphate isomerase deficiency (HA-GPID)6 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of anemia in which there is no abnormal hemoglobin or spherocytosis. It is caused by glucose phosphate isomerase deficiency.
See also OMIM:613470
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0025165T → I in HA-GPID; GPI Matsumoto. 1 PublicationCorresponds to variant dbSNP:rs267606852EnsemblClinVar.1
Natural variantiVAR_00251720H → P in HA-GPID; severe form with neurological deficits; GPI Homburg. 1 PublicationCorresponds to variant dbSNP:rs137853586EnsemblClinVar.1
Natural variantiVAR_00251875R → G in HA-GPID; GPI Elyria. 1 Publication1
Natural variantiVAR_00251983R → W in HA-GPID. 1 PublicationCorresponds to variant dbSNP:rs983725326Ensembl.1
Natural variantiVAR_002521101V → M in HA-GPID; GPI Sarcina. 1 PublicationCorresponds to variant dbSNP:rs757341382Ensembl.1
Natural variantiVAR_002520159G → S in HA-GPID. 1 PublicationCorresponds to variant dbSNP:rs137853582EnsemblClinVar.1
Natural variantiVAR_002522195T → I in HA-GPID; GPI Bari and Mola. 1 Publication1
Natural variantiVAR_002523224T → M in HA-GPID; GPI Iwate. 2 PublicationsCorresponds to variant dbSNP:rs61754634EnsemblClinVar.1
Natural variantiVAR_002524273R → H in HA-GPID. 1 Publication1
Natural variantiVAR_002525278S → L in HA-GPID. 1 PublicationCorresponds to variant dbSNP:rs34306618Ensembl.1
Natural variantiVAR_002526300A → P in HA-GPID. 1 Publication1
Natural variantiVAR_002527339L → P in HA-GPID; severe form with neurological deficits; GPI Homburg. 1 PublicationCorresponds to variant dbSNP:rs137853587EnsemblClinVar.1
Natural variantiVAR_002528343Q → R in HA-GPID; GPI Narita and Morcone. 2 PublicationsCorresponds to variant dbSNP:rs267606851EnsemblClinVar.1
Natural variantiVAR_002529347R → C in HA-GPID; GPI Mount Scopus. 2 PublicationsCorresponds to variant dbSNP:rs758132799Ensembl.1
Natural variantiVAR_002530347R → H in HA-GPID. 1 PublicationCorresponds to variant dbSNP:rs137853583EnsemblClinVar.1
Natural variantiVAR_002531375T → R in HA-GPID; GPI Kinki. 1 PublicationCorresponds to variant dbSNP:rs267606853EnsemblClinVar.1
Natural variantiVAR_002532389H → R in HA-GPID; severe form; GPI Calden. 1 PublicationCorresponds to variant dbSNP:rs139382538Ensembl.1
Natural variantiVAR_002533472R → H in HA-GPID. 1 PublicationCorresponds to variant dbSNP:rs148811525Ensembl.1
Natural variantiVAR_002534487L → F in HA-GPID. 1 PublicationCorresponds to variant dbSNP:rs374583873Ensembl.1
Natural variantiVAR_002535495E → K in HA-GPID. 1 PublicationCorresponds to variant dbSNP:rs900848255Ensembl.1
Natural variantiVAR_002536517L → V in HA-GPID; severe form; GPI Calden. 1 Publication1
Natural variantiVAR_002537525I → T in HA-GPID. 2 PublicationsCorresponds to variant dbSNP:rs137853584EnsemblClinVar.1
Natural variantiVAR_002538539D → N in HA-GPID; GPI Fukuoka and Kinki. 1 PublicationCorresponds to variant dbSNP:rs137853585EnsemblClinVar.1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi185S → A: Retained full enzymatic activity. 1 Publication1
Mutagenesisi185S → E: Decreased enzymatic activity. 1 Publication1

Keywords - Diseasei

Disease mutation, Hereditary hemolytic anemia

Organism-specific databases

DisGeNETi2821
MalaCardsiGPI
MIMi613470 phenotype
OpenTargetsiENSG00000105220
Orphaneti712 Hemolytic anemia due to glucophosphate isomerase deficiency
PharmGKBiPA28841

Chemistry databases

DrugBankiDB02093 5-Phospho-D-Arabinohydroxamic Acid
DB03042 5-Phosphoarabinonic Acid
DB02076 6-Phosphogluconic Acid
DB02007 alpha-D-glucose 6-phosphate
DB02548 D-glucitol 6-phosphate
DB03937 Erythose-4-Phosphate
DB04493 Fructose-6-Phosphate
DB03581 Glucose-6-Phosphate

Polymorphism and mutation databases

BioMutaiGPI
DMDMi17380385

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources1 Publication
ChainiPRO_00001805372 – 558Glucose-6-phosphate isomeraseAdd BLAST557

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1 Publication1
Modified residuei12N6-acetyllysineCombined sources1
Modified residuei107PhosphoserineCombined sources1
Modified residuei109PhosphothreonineCombined sources1
Modified residuei142N6-acetyllysineCombined sources1
Modified residuei185Phosphoserine; by CK22 Publications1
Modified residuei250PhosphothreonineBy similarity1
Modified residuei454N6-acetyllysine; alternateBy similarity1
Modified residuei454N6-malonyllysine; alternate1 Publication1
Modified residuei454N6-succinyllysine; alternateBy similarity1
Modified residuei455PhosphoserineCombined sources1

Post-translational modificationi

Phosphorylation at Ser-185 by CK2 has been shown to decrease enzymatic activity and may contribute to secretion by a non-classical secretory pathway.2 Publications
ISGylated.1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiP06744
MaxQBiP06744
PeptideAtlasiP06744
PRIDEiP06744
ProteomicsDBi51924
51925 [P06744-2]
TopDownProteomicsiP06744-1 [P06744-1]
P06744-2 [P06744-2]

PTM databases

GlyConnecti1268
iPTMnetiP06744
PhosphoSitePlusiP06744
SwissPalmiP06744

Expressioni

Gene expression databases

BgeeiENSG00000105220 Expressed in 223 organ(s), highest expression level in cerebellar vermis
CleanExiHS_GPI
ExpressionAtlasiP06744 baseline and differential
GenevisibleiP06744 HS

Organism-specific databases

HPAiCAB018655
CAB040563
HPA024305
HPA052171

Interactioni

Subunit structurei

Homodimer in the catalytically active form, monomer in the secreted form.3 Publications

GO - Molecular functioni

Protein-protein interaction databases

BioGridi109082, 69 interactors
IntActiP06744, 15 interactors
MINTiP06744

Structurei

Secondary structure

1558
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliP06744
SMRiP06744
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP06744

Family & Domainsi

Sequence similaritiesi

Belongs to the GPI family.Curated

Phylogenomic databases

GeneTreeiENSGT00390000000707
HOGENOMiHOG000261370
HOVERGENiHBG002877
InParanoidiP06744
KOiK01810
PhylomeDBiP06744
TreeFamiTF300436

Family and domain databases

CDDicd05015 SIS_PGI_1, 1 hit
cd05016 SIS_PGI_2, 1 hit
Gene3Di1.10.1390.10, 1 hit
HAMAPiMF_00473 G6P_isomerase, 1 hit
InterProiView protein in InterPro
IPR001672 G6P_Isomerase
IPR023096 G6P_Isomerase_C
IPR018189 Phosphoglucose_isomerase_CS
IPR035476 SIS_PGI_1
IPR035482 SIS_PGI_2
PANTHERiPTHR11469 PTHR11469, 1 hit
PfamiView protein in Pfam
PF00342 PGI, 1 hit
PRINTSiPR00662 G6PISOMERASE
PROSITEiView protein in PROSITE
PS00765 P_GLUCOSE_ISOMERASE_1, 1 hit
PS00174 P_GLUCOSE_ISOMERASE_2, 1 hit
PS51463 P_GLUCOSE_ISOMERASE_3, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 19 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P06744-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAALTRDPQF QKLQQWYREH RSELNLRRLF DANKDRFNHF SLTLNTNHGH
60 70 80 90 100
ILVDYSKNLV TEDVMRMLVD LAKSRGVEAA RERMFNGEKI NYTEGRAVLH
110 120 130 140 150
VALRNRSNTP ILVDGKDVMP EVNKVLDKMK SFCQRVRSGD WKGYTGKTIT
160 170 180 190 200
DVINIGIGGS DLGPLMVTEA LKPYSSGGPR VWYVSNIDGT HIAKTLAQLN
210 220 230 240 250
PESSLFIIAS KTFTTQETIT NAETAKEWFL QAAKDPSAVA KHFVALSTNT
260 270 280 290 300
TKVKEFGIDP QNMFEFWDWV GGRYSLWSAI GLSIALHVGF DNFEQLLSGA
310 320 330 340 350
HWMDQHFRTT PLEKNAPVLL ALLGIWYINC FGCETHAMLP YDQYLHRFAA
360 370 380 390 400
YFQQGDMESN GKYITKSGTR VDHQTGPIVW GEPGTNGQHA FYQLIHQGTK
410 420 430 440 450
MIPCDFLIPV QTQHPIRKGL HHKILLANFL AQTEALMRGK STEEARKELQ
460 470 480 490 500
AAGKSPEDLE RLLPHKVFEG NRPTNSIVFT KLTPFMLGAL VAMYEHKIFV
510 520 530 540 550
QGIIWDINSF DQWGVELGKQ LAKKIEPELD GSAQVTSHDA STNGLINFIK

QQREARVQ
Length:558
Mass (Da):63,147
Last modified:January 23, 2007 - v4
Checksum:i7C8E95277BDC79A6
GO
Isoform 2 (identifier: P06744-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MVALCSLQHLGSSDPRALPTLPTATSGQRPAKRRRKSPAM
     135-162: Missing.

Note: No experimental confirmation available.
Show »
Length:569
Mass (Da):64,325
Checksum:i65537AD376C4FDF1
GO

Computationally mapped potential isoform sequencesi

There are 19 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0A0MTS2A0A0A0MTS2_HUMAN
Glucose-6-phosphate isomerase
GPI
573Annotation score:
K7EQ48K7EQ48_HUMAN
Glucose-6-phosphate isomerase
GPI
447Annotation score:
A0A2U3TZU2A0A2U3TZU2_HUMAN
Glucose-6-phosphate isomerase
GPI
597Annotation score:
A0A0J9YYH3A0A0J9YYH3_HUMAN
Glucose-6-phosphate isomerase
GPI
283Annotation score:
A0A0J9YXP8A0A0J9YXP8_HUMAN
Glucose-6-phosphate isomerase
GPI
268Annotation score:
K7EP41K7EP41_HUMAN
Glucose-6-phosphate isomerase
GPI
159Annotation score:
K7ELR7K7ELR7_HUMAN
Glucose-6-phosphate isomerase
GPI
146Annotation score:
K7EPY4K7EPY4_HUMAN
Glucose-6-phosphate isomerase
GPI
166Annotation score:
K7ENA0K7ENA0_HUMAN
Glucose-6-phosphate isomerase
GPI
162Annotation score:
K7ERK8K7ERK8_HUMAN
Glucose-6-phosphate isomerase
GPI
139Annotation score:
There are more potential isoformsShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti158G → V in AAA36368 (Ref. 1) Curated1
Sequence conflicti426L → V in AAF22645 (PubMed:10727272).Curated1
Sequence conflicti436L → V in AAF22645 (PubMed:10727272).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0025165T → I in HA-GPID; GPI Matsumoto. 1 PublicationCorresponds to variant dbSNP:rs267606852EnsemblClinVar.1
Natural variantiVAR_00251720H → P in HA-GPID; severe form with neurological deficits; GPI Homburg. 1 PublicationCorresponds to variant dbSNP:rs137853586EnsemblClinVar.1
Natural variantiVAR_00251875R → G in HA-GPID; GPI Elyria. 1 Publication1
Natural variantiVAR_00251983R → W in HA-GPID. 1 PublicationCorresponds to variant dbSNP:rs983725326Ensembl.1
Natural variantiVAR_002521101V → M in HA-GPID; GPI Sarcina. 1 PublicationCorresponds to variant dbSNP:rs757341382Ensembl.1
Natural variantiVAR_002520159G → S in HA-GPID. 1 PublicationCorresponds to variant dbSNP:rs137853582EnsemblClinVar.1
Natural variantiVAR_002522195T → I in HA-GPID; GPI Bari and Mola. 1 Publication1
Natural variantiVAR_018816208I → T1 PublicationCorresponds to variant dbSNP:rs8191371EnsemblClinVar.1
Natural variantiVAR_002523224T → M in HA-GPID; GPI Iwate. 2 PublicationsCorresponds to variant dbSNP:rs61754634EnsemblClinVar.1
Natural variantiVAR_002524273R → H in HA-GPID. 1 Publication1
Natural variantiVAR_002525278S → L in HA-GPID. 1 PublicationCorresponds to variant dbSNP:rs34306618Ensembl.1
Natural variantiVAR_002526300A → P in HA-GPID. 1 Publication1
Natural variantiVAR_033943308R → H. Corresponds to variant dbSNP:rs2230294Ensembl.1
Natural variantiVAR_002527339L → P in HA-GPID; severe form with neurological deficits; GPI Homburg. 1 PublicationCorresponds to variant dbSNP:rs137853587EnsemblClinVar.1
Natural variantiVAR_002528343Q → R in HA-GPID; GPI Narita and Morcone. 2 PublicationsCorresponds to variant dbSNP:rs267606851EnsemblClinVar.1
Natural variantiVAR_002529347R → C in HA-GPID; GPI Mount Scopus. 2 PublicationsCorresponds to variant dbSNP:rs758132799Ensembl.1
Natural variantiVAR_002530347R → H in HA-GPID. 1 PublicationCorresponds to variant dbSNP:rs137853583EnsemblClinVar.1
Natural variantiVAR_002531375T → R in HA-GPID; GPI Kinki. 1 PublicationCorresponds to variant dbSNP:rs267606853EnsemblClinVar.1
Natural variantiVAR_002532389H → R in HA-GPID; severe form; GPI Calden. 1 PublicationCorresponds to variant dbSNP:rs139382538Ensembl.1
Natural variantiVAR_002533472R → H in HA-GPID. 1 PublicationCorresponds to variant dbSNP:rs148811525Ensembl.1
Natural variantiVAR_002534487L → F in HA-GPID. 1 PublicationCorresponds to variant dbSNP:rs374583873Ensembl.1
Natural variantiVAR_002535495E → K in HA-GPID. 1 PublicationCorresponds to variant dbSNP:rs900848255Ensembl.1
Natural variantiVAR_002536517L → V in HA-GPID; severe form; GPI Calden. 1 Publication1
Natural variantiVAR_002537525I → T in HA-GPID. 2 PublicationsCorresponds to variant dbSNP:rs137853584EnsemblClinVar.1
Natural variantiVAR_002538539D → N in HA-GPID; GPI Fukuoka and Kinki. 1 PublicationCorresponds to variant dbSNP:rs137853585EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0434751M → MVALCSLQHLGSSDPRALPT LPTATSGQRPAKRRRKSPAM in isoform 2. 1 Publication1
Alternative sequenceiVSP_043476135 – 162Missing in isoform 2. 1 PublicationAdd BLAST28

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
K03515 mRNA Translation: AAA36368.1
AF187554 mRNA Translation: AAF22645.1
AY324386 Genomic DNA Translation: AAP72966.1
AK294396 mRNA Translation: BAG57650.1
AC010504 Genomic DNA No translation available.
AC092073 Genomic DNA No translation available.
BC004982 mRNA Translation: AAH04982.1
AH002710 Genomic DNA Translation: AAA52593.1
CCDSiCCDS12437.1 [P06744-1]
CCDS54246.1 [P06744-2]
PIRiA35333
RefSeqiNP_000166.2, NM_000175.4 [P06744-1]
NP_001171651.1, NM_001184722.1 [P06744-2]
NP_001316838.1, NM_001329909.1 [P06744-1]
NP_001316839.1, NM_001329910.1 [P06744-1]
NP_001316840.1, NM_001329911.1
UniGeneiHs.466471
Hs.515344

Genome annotation databases

EnsembliENST00000356487; ENSP00000348877; ENSG00000105220 [P06744-1]
ENST00000588991; ENSP00000465858; ENSG00000105220 [P06744-2]
ENST00000644934; ENSP00000493517; ENSG00000105220 [P06744-1]
GeneIDi2821
KEGGihsa:2821
UCSCiuc002nvg.3 human [P06744-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Web resourcesi

SHMPD

The Singapore human mutation and polymorphism database

Wikipedia

Phosphoglucose isomerase entry

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
K03515 mRNA Translation: AAA36368.1
AF187554 mRNA Translation: AAF22645.1
AY324386 Genomic DNA Translation: AAP72966.1
AK294396 mRNA Translation: BAG57650.1
AC010504 Genomic DNA No translation available.
AC092073 Genomic DNA No translation available.
BC004982 mRNA Translation: AAH04982.1
AH002710 Genomic DNA Translation: AAA52593.1
CCDSiCCDS12437.1 [P06744-1]
CCDS54246.1 [P06744-2]
PIRiA35333
RefSeqiNP_000166.2, NM_000175.4 [P06744-1]
NP_001171651.1, NM_001184722.1 [P06744-2]
NP_001316838.1, NM_001329909.1 [P06744-1]
NP_001316839.1, NM_001329910.1 [P06744-1]
NP_001316840.1, NM_001329911.1
UniGeneiHs.466471
Hs.515344

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1IATX-ray1.62A2-558[»]
1IRIX-ray2.40A/B/C/D1-558[»]
1JIQX-ray1.90A/B/C/D1-558[»]
1JLHX-ray2.10A/B/C/D1-558[»]
1NUHX-ray2.51A1-558[»]
ProteinModelPortaliP06744
SMRiP06744
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi109082, 69 interactors
IntActiP06744, 15 interactors
MINTiP06744

Chemistry databases

DrugBankiDB02093 5-Phospho-D-Arabinohydroxamic Acid
DB03042 5-Phosphoarabinonic Acid
DB02076 6-Phosphogluconic Acid
DB02007 alpha-D-glucose 6-phosphate
DB02548 D-glucitol 6-phosphate
DB03937 Erythose-4-Phosphate
DB04493 Fructose-6-Phosphate
DB03581 Glucose-6-Phosphate

Protein family/group databases

MoonDBiP06744 Curated

PTM databases

GlyConnecti1268
iPTMnetiP06744
PhosphoSitePlusiP06744
SwissPalmiP06744

Polymorphism and mutation databases

BioMutaiGPI
DMDMi17380385

Proteomic databases

EPDiP06744
MaxQBiP06744
PeptideAtlasiP06744
PRIDEiP06744
ProteomicsDBi51924
51925 [P06744-2]
TopDownProteomicsiP06744-1 [P06744-1]
P06744-2 [P06744-2]

Protocols and materials databases

DNASUi2821
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000356487; ENSP00000348877; ENSG00000105220 [P06744-1]
ENST00000588991; ENSP00000465858; ENSG00000105220 [P06744-2]
ENST00000644934; ENSP00000493517; ENSG00000105220 [P06744-1]
GeneIDi2821
KEGGihsa:2821
UCSCiuc002nvg.3 human [P06744-1]

Organism-specific databases

CTDi2821
DisGeNETi2821
EuPathDBiHostDB:ENSG00000105220.14
GeneCardsiGPI
HGNCiHGNC:4458 GPI
HPAiCAB018655
CAB040563
HPA024305
HPA052171
MalaCardsiGPI
MIMi172400 gene
613470 phenotype
neXtProtiNX_P06744
OpenTargetsiENSG00000105220
Orphaneti712 Hemolytic anemia due to glucophosphate isomerase deficiency
PharmGKBiPA28841
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00390000000707
HOGENOMiHOG000261370
HOVERGENiHBG002877
InParanoidiP06744
KOiK01810
PhylomeDBiP06744
TreeFamiTF300436

Enzyme and pathway databases

UniPathwayi
UPA00109;UER00181

BioCyciMetaCyc:HS02693-MONOMER
BRENDAi5.3.1.9 2681
ReactomeiR-HSA-5628897 TP53 Regulates Metabolic Genes
R-HSA-6798695 Neutrophil degranulation
R-HSA-70171 Glycolysis
R-HSA-70263 Gluconeogenesis
SABIO-RKiP06744
SIGNORiP06744

Miscellaneous databases

ChiTaRSiGPI human
EvolutionaryTraceiP06744
GeneWikiiGlucose-6-phosphate_isomerase
GenomeRNAii2821
PROiPR:P06744
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000105220 Expressed in 223 organ(s), highest expression level in cerebellar vermis
CleanExiHS_GPI
ExpressionAtlasiP06744 baseline and differential
GenevisibleiP06744 HS

Family and domain databases

CDDicd05015 SIS_PGI_1, 1 hit
cd05016 SIS_PGI_2, 1 hit
Gene3Di1.10.1390.10, 1 hit
HAMAPiMF_00473 G6P_isomerase, 1 hit
InterProiView protein in InterPro
IPR001672 G6P_Isomerase
IPR023096 G6P_Isomerase_C
IPR018189 Phosphoglucose_isomerase_CS
IPR035476 SIS_PGI_1
IPR035482 SIS_PGI_2
PANTHERiPTHR11469 PTHR11469, 1 hit
PfamiView protein in Pfam
PF00342 PGI, 1 hit
PRINTSiPR00662 G6PISOMERASE
PROSITEiView protein in PROSITE
PS00765 P_GLUCOSE_ISOMERASE_1, 1 hit
PS00174 P_GLUCOSE_ISOMERASE_2, 1 hit
PS51463 P_GLUCOSE_ISOMERASE_3, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiG6PI_HUMAN
AccessioniPrimary (citable) accession number: P06744
Secondary accession number(s): B4DG39
, Q9BRD3, Q9BSK5, Q9UHE6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 1, 1988
Last sequence update: January 23, 2007
Last modified: November 7, 2018
This is version 211 of the entry and version 4 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  7. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again