Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Glucose-6-phosphate isomerase

Gene

GPI

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Besides it's role as a glycolytic enzyme, mammalian GPI can function as a tumor-secreted cytokine and an angiogenic factor (AMF) that stimulates endothelial cell motility. GPI is also a neurotrophic factor (Neuroleukin) for spinal and sensory neurons.2 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: glycolysis

This protein is involved in step 2 of the subpathway that synthesizes D-glyceraldehyde 3-phosphate and glycerone phosphate from D-glucose.
Proteins known to be involved in the 4 steps of the subpathway in this organism are:
  1. no protein annotated in this organism
  2. Glucose-6-phosphate isomerase (GPI), Glucose-6-phosphate isomerase (GPI), Glucose-6-phosphate isomerase (pgi), Glucose-6-phosphate isomerase (GPI), Glucose-6-phosphate isomerase, Glucose-6-phosphate isomerase (GPI), Glucose-6-phosphate isomerase, Glucose-6-phosphate isomerase, Glucose-6-phosphate isomerase (GPI), Glucose-6-phosphate isomerase (GPI)
  3. ATP-dependent 6-phosphofructokinase (PFKM), ATP-dependent 6-phosphofructokinase (PFKM), ATP-dependent 6-phosphofructokinase, platelet type (PFKP), ATP-dependent 6-phosphofructokinase, liver type (PFKL), ATP-dependent 6-phosphofructokinase, muscle type (PFKM)
  4. Fructose-bisphosphate aldolase (ALDOA), Fructose-bisphosphate aldolase (ALDOA), Fructose-bisphosphate aldolase (ALDOA), Fructose-bisphosphate aldolase, Fructose-bisphosphate aldolase, Fructose-bisphosphate aldolase (ALDOB), Fructose-bisphosphate aldolase, Fructose-bisphosphate aldolase, Fructose-bisphosphate aldolase, Fructose-bisphosphate aldolase, Fructose-bisphosphate aldolase, Fructose-bisphosphate aldolase (ALDOB), Fructose-bisphosphate aldolase (ALDOC), Fructose-bisphosphate aldolase, Fructose-bisphosphate aldolase (ALDOA), Fructose-bisphosphate aldolase (HEL-S-87p), Fructose-bisphosphate aldolase (ALDOC), Fructose-bisphosphate aldolase (BQ8482_350140), Fructose-bisphosphate aldolase, Fructose-bisphosphate aldolase, Fructose-bisphosphate aldolase A (ALDOA), Fructose-bisphosphate aldolase C (ALDOC), Fructose-bisphosphate aldolase B (ALDOB)
This subpathway is part of the pathway glycolysis, which is itself part of Carbohydrate degradation.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes D-glyceraldehyde 3-phosphate and glycerone phosphate from D-glucose, the pathway glycolysis and in Carbohydrate degradation.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei358Proton donor1
Active sitei3891
Active sitei5191

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • cytokine activity Source: UniProtKB-KW
  • glucose-6-phosphate isomerase activity Source: GO_Central
  • growth factor activity Source: UniProtKB-KW
  • intramolecular transferase activity Source: GO_Central
  • monosaccharide binding Source: GO_Central
  • ubiquitin protein ligase binding Source: ParkinsonsUK-UCL

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionCytokine, Growth factor, Isomerase
Biological processGluconeogenesis, Glycolysis

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...
BioCyci
MetaCyc:HS02693-MONOMER

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
5.3.1.9 2681

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-5628897 TP53 Regulates Metabolic Genes
R-HSA-6798695 Neutrophil degranulation
R-HSA-70171 Glycolysis
R-HSA-70263 Gluconeogenesis

SABIO-RK: Biochemical Reaction Kinetics Database

More...
SABIO-RKi
P06744

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P06744

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00109;UER00181

Protein family/group databases

MoonDB Database of extreme multifunctional and moonlighting proteins

More...
MoonDBi
P06744 Curated

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Glucose-6-phosphate isomerase (EC:5.3.1.9)
Short name:
GPI
Alternative name(s):
Autocrine motility factor
Short name:
AMF
Neuroleukin
Short name:
NLK
Phosphoglucose isomerase
Short name:
PGI
Phosphohexose isomerase
Short name:
PHI
Sperm antigen 36
Short name:
SA-36
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:GPI
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 19

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000105220.14

Human Gene Nomenclature Database

More...
HGNCi
HGNC:4458 GPI

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
172400 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P06744

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Hemolytic anemia, non-spherocytic, due to glucose phosphate isomerase deficiency (HA-GPID)6 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of anemia in which there is no abnormal hemoglobin or spherocytosis. It is caused by glucose phosphate isomerase deficiency.
See also OMIM:613470
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0025165T → I in HA-GPID; GPI Matsumoto. 1 PublicationCorresponds to variant dbSNP:rs267606852EnsemblClinVar.1
Natural variantiVAR_00251720H → P in HA-GPID; severe form with neurological deficits; GPI Homburg. 1 PublicationCorresponds to variant dbSNP:rs137853586EnsemblClinVar.1
Natural variantiVAR_00251875R → G in HA-GPID; GPI Elyria. 1 Publication1
Natural variantiVAR_00251983R → W in HA-GPID. 1 PublicationCorresponds to variant dbSNP:rs983725326Ensembl.1
Natural variantiVAR_002521101V → M in HA-GPID; GPI Sarcina. 1 PublicationCorresponds to variant dbSNP:rs757341382Ensembl.1
Natural variantiVAR_002520159G → S in HA-GPID. 1 PublicationCorresponds to variant dbSNP:rs137853582EnsemblClinVar.1
Natural variantiVAR_002522195T → I in HA-GPID; GPI Bari and Mola. 1 Publication1
Natural variantiVAR_002523224T → M in HA-GPID; GPI Iwate. 2 PublicationsCorresponds to variant dbSNP:rs61754634EnsemblClinVar.1
Natural variantiVAR_002524273R → H in HA-GPID. 1 Publication1
Natural variantiVAR_002525278S → L in HA-GPID. 1 PublicationCorresponds to variant dbSNP:rs34306618Ensembl.1
Natural variantiVAR_002526300A → P in HA-GPID. 1 Publication1
Natural variantiVAR_002527339L → P in HA-GPID; severe form with neurological deficits; GPI Homburg. 1 PublicationCorresponds to variant dbSNP:rs137853587EnsemblClinVar.1
Natural variantiVAR_002528343Q → R in HA-GPID; GPI Narita and Morcone. 2 PublicationsCorresponds to variant dbSNP:rs267606851EnsemblClinVar.1
Natural variantiVAR_002529347R → C in HA-GPID; GPI Mount Scopus. 2 PublicationsCorresponds to variant dbSNP:rs758132799Ensembl.1
Natural variantiVAR_002530347R → H in HA-GPID. 1 PublicationCorresponds to variant dbSNP:rs137853583EnsemblClinVar.1
Natural variantiVAR_002531375T → R in HA-GPID; GPI Kinki. 1 PublicationCorresponds to variant dbSNP:rs267606853EnsemblClinVar.1
Natural variantiVAR_002532389H → R in HA-GPID; severe form; GPI Calden. 1 PublicationCorresponds to variant dbSNP:rs139382538Ensembl.1
Natural variantiVAR_002533472R → H in HA-GPID. 1 PublicationCorresponds to variant dbSNP:rs148811525Ensembl.1
Natural variantiVAR_002534487L → F in HA-GPID. 1 PublicationCorresponds to variant dbSNP:rs374583873Ensembl.1
Natural variantiVAR_002535495E → K in HA-GPID. 1 PublicationCorresponds to variant dbSNP:rs900848255Ensembl.1
Natural variantiVAR_002536517L → V in HA-GPID; severe form; GPI Calden. 1 Publication1
Natural variantiVAR_002537525I → T in HA-GPID. 2 PublicationsCorresponds to variant dbSNP:rs137853584EnsemblClinVar.1
Natural variantiVAR_002538539D → N in HA-GPID; GPI Fukuoka and Kinki. 1 PublicationCorresponds to variant dbSNP:rs137853585EnsemblClinVar.1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi185S → A: Retained full enzymatic activity. 1 Publication1
Mutagenesisi185S → E: Decreased enzymatic activity. 1 Publication1

Keywords - Diseasei

Disease mutation, Hereditary hemolytic anemia

Organism-specific databases

DisGeNET

More...
DisGeNETi
2821

MalaCards human disease database

More...
MalaCardsi
GPI
MIMi613470 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000105220

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
712 Hemolytic anemia due to glucophosphate isomerase deficiency

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA28841

Chemistry databases

Drug and drug target database

More...
DrugBanki
DB02093 5-Phospho-D-Arabinohydroxamic Acid
DB03042 5-Phosphoarabinonic Acid
DB02076 6-Phosphogluconic Acid
DB02007 alpha-D-glucose 6-phosphate
DB02548 D-glucitol 6-phosphate
DB03937 Erythose-4-Phosphate
DB04493 Fructose-6-Phosphate
DB03581 Glucose-6-Phosphate

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
GPI

Domain mapping of disease mutations (DMDM)

More...
DMDMi
17380385

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources1 Publication
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001805372 – 558Glucose-6-phosphate isomeraseAdd BLAST557

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineCombined sources1 Publication1
Modified residuei12N6-acetyllysineCombined sources1
Modified residuei107PhosphoserineCombined sources1
Modified residuei109PhosphothreonineCombined sources1
Modified residuei142N6-acetyllysineCombined sources1
Modified residuei185Phosphoserine; by CK22 Publications1
Modified residuei250PhosphothreonineBy similarity1
Modified residuei454N6-acetyllysine; alternateBy similarity1
Modified residuei454N6-malonyllysine; alternate1 Publication1
Modified residuei454N6-succinyllysine; alternateBy similarity1
Modified residuei455PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylation at Ser-185 by CK2 has been shown to decrease enzymatic activity and may contribute to secretion by a non-classical secretory pathway.2 Publications
ISGylated.1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P06744

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P06744

PeptideAtlas

More...
PeptideAtlasi
P06744

PRoteomics IDEntifications database

More...
PRIDEi
P06744

ProteomicsDB human proteome resource

More...
ProteomicsDBi
51924
51925 [P06744-2]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
P06744-1 [P06744-1]
P06744-2 [P06744-2]

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
1268

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P06744

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P06744

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
P06744

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000105220 Expressed in 223 organ(s), highest expression level in cerebellar vermis

CleanEx database of gene expression profiles

More...
CleanExi
HS_GPI

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P06744 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P06744 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB018655
CAB040563
HPA024305
HPA052171

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer in the catalytically active form, monomer in the secreted form.3 Publications

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
109082, 73 interactors

Protein interaction database and analysis system

More...
IntActi
P06744, 15 interactors

Molecular INTeraction database

More...
MINTi
P06744

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1558
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P06744

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P06744

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P06744

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the GPI family.Curated

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000000707

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000261370

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG002877

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P06744

KEGG Orthology (KO)

More...
KOi
K01810

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P06744

TreeFam database of animal gene trees

More...
TreeFami
TF300436

Family and domain databases

Conserved Domains Database

More...
CDDi
cd05015 SIS_PGI_1, 1 hit
cd05016 SIS_PGI_2, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.1390.10, 1 hit

HAMAP database of protein families

More...
HAMAPi
MF_00473 G6P_isomerase, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001672 G6P_Isomerase
IPR023096 G6P_Isomerase_C
IPR018189 Phosphoglucose_isomerase_CS
IPR035476 SIS_PGI_1
IPR035482 SIS_PGI_2

The PANTHER Classification System

More...
PANTHERi
PTHR11469 PTHR11469, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00342 PGI, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00662 G6PISOMERASE

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00765 P_GLUCOSE_ISOMERASE_1, 1 hit
PS00174 P_GLUCOSE_ISOMERASE_2, 1 hit
PS51463 P_GLUCOSE_ISOMERASE_3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 19 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P06744-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAALTRDPQF QKLQQWYREH RSELNLRRLF DANKDRFNHF SLTLNTNHGH
60 70 80 90 100
ILVDYSKNLV TEDVMRMLVD LAKSRGVEAA RERMFNGEKI NYTEGRAVLH
110 120 130 140 150
VALRNRSNTP ILVDGKDVMP EVNKVLDKMK SFCQRVRSGD WKGYTGKTIT
160 170 180 190 200
DVINIGIGGS DLGPLMVTEA LKPYSSGGPR VWYVSNIDGT HIAKTLAQLN
210 220 230 240 250
PESSLFIIAS KTFTTQETIT NAETAKEWFL QAAKDPSAVA KHFVALSTNT
260 270 280 290 300
TKVKEFGIDP QNMFEFWDWV GGRYSLWSAI GLSIALHVGF DNFEQLLSGA
310 320 330 340 350
HWMDQHFRTT PLEKNAPVLL ALLGIWYINC FGCETHAMLP YDQYLHRFAA
360 370 380 390 400
YFQQGDMESN GKYITKSGTR VDHQTGPIVW GEPGTNGQHA FYQLIHQGTK
410 420 430 440 450
MIPCDFLIPV QTQHPIRKGL HHKILLANFL AQTEALMRGK STEEARKELQ
460 470 480 490 500
AAGKSPEDLE RLLPHKVFEG NRPTNSIVFT KLTPFMLGAL VAMYEHKIFV
510 520 530 540 550
QGIIWDINSF DQWGVELGKQ LAKKIEPELD GSAQVTSHDA STNGLINFIK

QQREARVQ
Length:558
Mass (Da):63,147
Last modified:January 23, 2007 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i7C8E95277BDC79A6
GO
Isoform 2 (identifier: P06744-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MVALCSLQHLGSSDPRALPTLPTATSGQRPAKRRRKSPAM
     135-162: Missing.

Note: No experimental confirmation available.
Show »
Length:569
Mass (Da):64,325
Checksum:i65537AD376C4FDF1
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 19 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0A0MTS2A0A0A0MTS2_HUMAN
Glucose-6-phosphate isomerase
GPI
573Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EQ48K7EQ48_HUMAN
Glucose-6-phosphate isomerase
GPI
447Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2U3TZU2A0A2U3TZU2_HUMAN
Glucose-6-phosphate isomerase
GPI
597Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0J9YYH3A0A0J9YYH3_HUMAN
Glucose-6-phosphate isomerase
GPI
283Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0J9YXP8A0A0J9YXP8_HUMAN
Glucose-6-phosphate isomerase
GPI
268Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EP41K7EP41_HUMAN
Glucose-6-phosphate isomerase
GPI
159Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7ELR7K7ELR7_HUMAN
Glucose-6-phosphate isomerase
GPI
146Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EPY4K7EPY4_HUMAN
Glucose-6-phosphate isomerase
GPI
166Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7ENA0K7ENA0_HUMAN
Glucose-6-phosphate isomerase
GPI
162Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7ERK8K7ERK8_HUMAN
Glucose-6-phosphate isomerase
GPI
139Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti158G → V in AAA36368 (Ref. 1) Curated1
Sequence conflicti426L → V in AAF22645 (PubMed:10727272).Curated1
Sequence conflicti436L → V in AAF22645 (PubMed:10727272).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0025165T → I in HA-GPID; GPI Matsumoto. 1 PublicationCorresponds to variant dbSNP:rs267606852EnsemblClinVar.1
Natural variantiVAR_00251720H → P in HA-GPID; severe form with neurological deficits; GPI Homburg. 1 PublicationCorresponds to variant dbSNP:rs137853586EnsemblClinVar.1
Natural variantiVAR_00251875R → G in HA-GPID; GPI Elyria. 1 Publication1
Natural variantiVAR_00251983R → W in HA-GPID. 1 PublicationCorresponds to variant dbSNP:rs983725326Ensembl.1
Natural variantiVAR_002521101V → M in HA-GPID; GPI Sarcina. 1 PublicationCorresponds to variant dbSNP:rs757341382Ensembl.1
Natural variantiVAR_002520159G → S in HA-GPID. 1 PublicationCorresponds to variant dbSNP:rs137853582EnsemblClinVar.1
Natural variantiVAR_002522195T → I in HA-GPID; GPI Bari and Mola. 1 Publication1
Natural variantiVAR_018816208I → T1 PublicationCorresponds to variant dbSNP:rs8191371EnsemblClinVar.1
Natural variantiVAR_002523224T → M in HA-GPID; GPI Iwate. 2 PublicationsCorresponds to variant dbSNP:rs61754634EnsemblClinVar.1
Natural variantiVAR_002524273R → H in HA-GPID. 1 Publication1
Natural variantiVAR_002525278S → L in HA-GPID. 1 PublicationCorresponds to variant dbSNP:rs34306618Ensembl.1
Natural variantiVAR_002526300A → P in HA-GPID. 1 Publication1
Natural variantiVAR_033943308R → H. Corresponds to variant dbSNP:rs2230294Ensembl.1
Natural variantiVAR_002527339L → P in HA-GPID; severe form with neurological deficits; GPI Homburg. 1 PublicationCorresponds to variant dbSNP:rs137853587EnsemblClinVar.1
Natural variantiVAR_002528343Q → R in HA-GPID; GPI Narita and Morcone. 2 PublicationsCorresponds to variant dbSNP:rs267606851EnsemblClinVar.1
Natural variantiVAR_002529347R → C in HA-GPID; GPI Mount Scopus. 2 PublicationsCorresponds to variant dbSNP:rs758132799Ensembl.1
Natural variantiVAR_002530347R → H in HA-GPID. 1 PublicationCorresponds to variant dbSNP:rs137853583EnsemblClinVar.1
Natural variantiVAR_002531375T → R in HA-GPID; GPI Kinki. 1 PublicationCorresponds to variant dbSNP:rs267606853EnsemblClinVar.1
Natural variantiVAR_002532389H → R in HA-GPID; severe form; GPI Calden. 1 PublicationCorresponds to variant dbSNP:rs139382538Ensembl.1
Natural variantiVAR_002533472R → H in HA-GPID. 1 PublicationCorresponds to variant dbSNP:rs148811525Ensembl.1
Natural variantiVAR_002534487L → F in HA-GPID. 1 PublicationCorresponds to variant dbSNP:rs374583873Ensembl.1
Natural variantiVAR_002535495E → K in HA-GPID. 1 PublicationCorresponds to variant dbSNP:rs900848255Ensembl.1
Natural variantiVAR_002536517L → V in HA-GPID; severe form; GPI Calden. 1 Publication1
Natural variantiVAR_002537525I → T in HA-GPID. 2 PublicationsCorresponds to variant dbSNP:rs137853584EnsemblClinVar.1
Natural variantiVAR_002538539D → N in HA-GPID; GPI Fukuoka and Kinki. 1 PublicationCorresponds to variant dbSNP:rs137853585EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0434751M → MVALCSLQHLGSSDPRALPT LPTATSGQRPAKRRRKSPAM in isoform 2. 1 Publication1
Alternative sequenceiVSP_043476135 – 162Missing in isoform 2. 1 PublicationAdd BLAST28

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
K03515 mRNA Translation: AAA36368.1
AF187554 mRNA Translation: AAF22645.1
AY324386 Genomic DNA Translation: AAP72966.1
AK294396 mRNA Translation: BAG57650.1
AC010504 Genomic DNA No translation available.
AC092073 Genomic DNA No translation available.
BC004982 mRNA Translation: AAH04982.1
AH002710 Genomic DNA Translation: AAA52593.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS12437.1 [P06744-1]
CCDS54246.1 [P06744-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
A35333

NCBI Reference Sequences

More...
RefSeqi
NP_000166.2, NM_000175.4 [P06744-1]
NP_001171651.1, NM_001184722.1 [P06744-2]
NP_001316838.1, NM_001329909.1 [P06744-1]
NP_001316839.1, NM_001329910.1 [P06744-1]
NP_001316840.1, NM_001329911.1

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.466471
Hs.515344

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000356487; ENSP00000348877; ENSG00000105220 [P06744-1]
ENST00000588991; ENSP00000465858; ENSG00000105220 [P06744-2]
ENST00000644934; ENSP00000493517; ENSG00000105220 [P06744-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
2821

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:2821

UCSC genome browser

More...
UCSCi
uc002nvg.3 human [P06744-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

SHMPD

The Singapore human mutation and polymorphism database

Wikipedia

Phosphoglucose isomerase entry

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
K03515 mRNA Translation: AAA36368.1
AF187554 mRNA Translation: AAF22645.1
AY324386 Genomic DNA Translation: AAP72966.1
AK294396 mRNA Translation: BAG57650.1
AC010504 Genomic DNA No translation available.
AC092073 Genomic DNA No translation available.
BC004982 mRNA Translation: AAH04982.1
AH002710 Genomic DNA Translation: AAA52593.1
CCDSiCCDS12437.1 [P06744-1]
CCDS54246.1 [P06744-2]
PIRiA35333
RefSeqiNP_000166.2, NM_000175.4 [P06744-1]
NP_001171651.1, NM_001184722.1 [P06744-2]
NP_001316838.1, NM_001329909.1 [P06744-1]
NP_001316839.1, NM_001329910.1 [P06744-1]
NP_001316840.1, NM_001329911.1
UniGeneiHs.466471
Hs.515344

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1IATX-ray1.62A2-558[»]
1IRIX-ray2.40A/B/C/D1-558[»]
1JIQX-ray1.90A/B/C/D1-558[»]
1JLHX-ray2.10A/B/C/D1-558[»]
1NUHX-ray2.51A1-558[»]
ProteinModelPortaliP06744
SMRiP06744
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi109082, 73 interactors
IntActiP06744, 15 interactors
MINTiP06744

Chemistry databases

DrugBankiDB02093 5-Phospho-D-Arabinohydroxamic Acid
DB03042 5-Phosphoarabinonic Acid
DB02076 6-Phosphogluconic Acid
DB02007 alpha-D-glucose 6-phosphate
DB02548 D-glucitol 6-phosphate
DB03937 Erythose-4-Phosphate
DB04493 Fructose-6-Phosphate
DB03581 Glucose-6-Phosphate

Protein family/group databases

MoonDBiP06744 Curated

PTM databases

GlyConnecti1268
iPTMnetiP06744
PhosphoSitePlusiP06744
SwissPalmiP06744

Polymorphism and mutation databases

BioMutaiGPI
DMDMi17380385

Proteomic databases

EPDiP06744
MaxQBiP06744
PeptideAtlasiP06744
PRIDEiP06744
ProteomicsDBi51924
51925 [P06744-2]
TopDownProteomicsiP06744-1 [P06744-1]
P06744-2 [P06744-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
2821
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000356487; ENSP00000348877; ENSG00000105220 [P06744-1]
ENST00000588991; ENSP00000465858; ENSG00000105220 [P06744-2]
ENST00000644934; ENSP00000493517; ENSG00000105220 [P06744-1]
GeneIDi2821
KEGGihsa:2821
UCSCiuc002nvg.3 human [P06744-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
2821
DisGeNETi2821
EuPathDBiHostDB:ENSG00000105220.14

GeneCards: human genes, protein and diseases

More...
GeneCardsi
GPI
HGNCiHGNC:4458 GPI
HPAiCAB018655
CAB040563
HPA024305
HPA052171
MalaCardsiGPI
MIMi172400 gene
613470 phenotype
neXtProtiNX_P06744
OpenTargetsiENSG00000105220
Orphaneti712 Hemolytic anemia due to glucophosphate isomerase deficiency
PharmGKBiPA28841

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

GeneTreeiENSGT00390000000707
HOGENOMiHOG000261370
HOVERGENiHBG002877
InParanoidiP06744
KOiK01810
PhylomeDBiP06744
TreeFamiTF300436

Enzyme and pathway databases

UniPathwayi
UPA00109;UER00181

BioCyciMetaCyc:HS02693-MONOMER
BRENDAi5.3.1.9 2681
ReactomeiR-HSA-5628897 TP53 Regulates Metabolic Genes
R-HSA-6798695 Neutrophil degranulation
R-HSA-70171 Glycolysis
R-HSA-70263 Gluconeogenesis
SABIO-RKiP06744
SIGNORiP06744

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
GPI human
EvolutionaryTraceiP06744

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
Glucose-6-phosphate_isomerase

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
2821

Protein Ontology

More...
PROi
PR:P06744

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000105220 Expressed in 223 organ(s), highest expression level in cerebellar vermis
CleanExiHS_GPI
ExpressionAtlasiP06744 baseline and differential
GenevisibleiP06744 HS

Family and domain databases

CDDicd05015 SIS_PGI_1, 1 hit
cd05016 SIS_PGI_2, 1 hit
Gene3Di1.10.1390.10, 1 hit
HAMAPiMF_00473 G6P_isomerase, 1 hit
InterProiView protein in InterPro
IPR001672 G6P_Isomerase
IPR023096 G6P_Isomerase_C
IPR018189 Phosphoglucose_isomerase_CS
IPR035476 SIS_PGI_1
IPR035482 SIS_PGI_2
PANTHERiPTHR11469 PTHR11469, 1 hit
PfamiView protein in Pfam
PF00342 PGI, 1 hit
PRINTSiPR00662 G6PISOMERASE
PROSITEiView protein in PROSITE
PS00765 P_GLUCOSE_ISOMERASE_1, 1 hit
PS00174 P_GLUCOSE_ISOMERASE_2, 1 hit
PS51463 P_GLUCOSE_ISOMERASE_3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiG6PI_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P06744
Secondary accession number(s): B4DG39
, Q9BRD3, Q9BSK5, Q9UHE6
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 1, 1988
Last sequence update: January 23, 2007
Last modified: December 5, 2018
This is version 212 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  7. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again