Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Myosin light chain 1/3, skeletal muscle isoform

Gene

Myl1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Regulatory light chain of myosin. Does not bind calcium.

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionMotor protein, Muscle protein, Myosin

Enzyme and pathway databases

ReactomeiR-MMU-390522 Striated Muscle Contraction

Names & Taxonomyi

Protein namesi
Recommended name:
Myosin light chain 1/3, skeletal muscle isoform
Short name:
MLC1/MLC3
Short name:
MLC1F/MLC3F
Alternative name(s):
Myosin light chain alkali 1/2
Short name:
Myosin light chain A1/A2
Gene namesi
Name:Myl1
Synonyms:Mylf
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 1

Organism-specific databases

MGIiMGI:97269 Myl1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedBy similarity
ChainiPRO_00001986822 – 188Myosin light chain 1/3, skeletal muscle isoformAdd BLAST187
Isoform MLC3 (identifier: P05977-2)
Initiator methionineiRemovedBy similarity

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N,N,N-trimethylalanineBy similarity1
Modified residuei65PhosphothreonineBy similarity1
Modified residuei67PhosphoserineBy similarity1
Modified residuei81PhosphothreonineBy similarity1
Modified residuei93PhosphoserineBy similarity1
Isoform MLC3 (identifier: P05977-2)
Modified residuei2N-acetylalanine By similarityBy similarity1

Post-translational modificationi

Isoform MLC3 is acetylated at position 2.By similarity

Keywords - PTMi

Acetylation, Methylation, Phosphoprotein

Proteomic databases

PaxDbiP05977
PeptideAtlasiP05977
PRIDEiP05977

2D gel databases

SWISS-2DPAGEiP05977
UCD-2DPAGEiP05977

PTM databases

iPTMnetiP05977
PhosphoSitePlusiP05977

Expressioni

Gene expression databases

BgeeiENSMUSG00000061816 Expressed in 231 organ(s), highest expression level in quadriceps femoris
CleanExiMM_MYL1
ExpressionAtlasiP05977 baseline and differential
GenevisibleiP05977 MM

Interactioni

Subunit structurei

Myosin is a hexamer of 2 heavy chains and 4 light chains.

Protein-protein interaction databases

BioGridi201656, 5 interactors
IntActiP05977, 4 interactors
MINTiP05977
STRINGi10090.ENSMUSP00000027151

Structurei

3D structure databases

ProteinModelPortaliP05977
SMRiP05977
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini44 – 79EF-hand 1PROSITE-ProRule annotationAdd BLAST36
Domaini121 – 156EF-hand 2PROSITE-ProRule annotationAdd BLAST36
Domaini156 – 188EF-hand 3PROSITE-ProRule annotationAdd BLAST33

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG0030 Eukaryota
COG5126 LUCA
GeneTreeiENSGT00590000082921
HOGENOMiHOG000233018
HOVERGENiHBG012180
InParanoidiP05977
KOiK05738
OMAiNKMAPKK
OrthoDBiEOG091G0TQL
PhylomeDBiP05977
TreeFamiTF351553

Family and domain databases

CDDicd00051 EFh, 1 hit
InterProiView protein in InterPro
IPR011992 EF-hand-dom_pair
IPR002048 EF_hand_dom
SUPFAMiSSF47473 SSF47473, 1 hit
PROSITEiView protein in PROSITE
PS50222 EF_HAND_2, 3 hits

Sequences (2+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform MLC1 (identifier: P05977-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAPKKDVKKP AAAPAPAPAP APAPAKPKEE KIDLSAIKIE FSKEQQEDFK
60 70 80 90 100
EAFLLFDRTG ECKITLSQVG DVLRALGTNP TNAEVKKVLG NPSNEEMNAK
110 120 130 140 150
KIEFEQFLPM MQAISNNKDQ GGYEDFVEGL RVFDKEGNGT VMGAELRHVL
160 170 180
ATLGEKMKEE EVEALLAGQE DSNGCINYEA FVKHIMSV
Length:188
Mass (Da):20,595
Last modified:January 23, 2007 - v2
Checksum:i84C580DA22E25217
GO
Isoform MLC3 (identifier: P05977-2) [UniParc] [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-47: MAPKKDVKKPAAAPAPAPAPAPAPAKPKEEKIDLSAIKIEFSKEQQE → MSFSADQIA

Show »
Length:150
Mass (Da):16,600
Checksum:i5822D8DF0F994994
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PWG4E9PWG4_MOUSE
Myosin light chain 1/3, skeletal mu...
Myl1
161Annotation score:
E0CZ30E0CZ30_MOUSE
Myosin light chain 1/3, skeletal mu...
Myl1
124Annotation score:
A0A087WRZ7A0A087WRZ7_MOUSE
Myosin light chain 1/3, skeletal mu...
Myl1
92Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0386871 – 47MAPKK…KEQQE → MSFSADQIA in isoform MLC3. CuratedAdd BLAST47

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
K02241
, K02237, K02238, K02239, K02240 Genomic DNA Translation: AAA39718.1
K02241
, K02238, K02239, K02240 Genomic DNA Translation: AAA39719.1
X12973 Genomic DNA Translation: CAA31416.1
CCDSiCCDS15024.1 [P05977-1]
CCDS48284.1 [P05977-2]
PIRiA23253
B23253
RefSeqiNP_001106858.1, NM_001113387.1 [P05977-2]
NP_067260.1, NM_021285.3 [P05977-1]
XP_006495826.1, XM_006495763.1 [P05977-1]
UniGeneiMm.1000

Genome annotation databases

EnsembliENSMUST00000027151; ENSMUSP00000027151; ENSMUSG00000061816 [P05977-1]
ENSMUST00000119429; ENSMUSP00000112861; ENSMUSG00000061816 [P05977-2]
GeneIDi17901
KEGGimmu:17901
UCSCiuc007bit.2 mouse [P05977-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
K02241
, K02237, K02238, K02239, K02240 Genomic DNA Translation: AAA39718.1
K02241
, K02238, K02239, K02240 Genomic DNA Translation: AAA39719.1
X12973 Genomic DNA Translation: CAA31416.1
CCDSiCCDS15024.1 [P05977-1]
CCDS48284.1 [P05977-2]
PIRiA23253
B23253
RefSeqiNP_001106858.1, NM_001113387.1 [P05977-2]
NP_067260.1, NM_021285.3 [P05977-1]
XP_006495826.1, XM_006495763.1 [P05977-1]
UniGeneiMm.1000

3D structure databases

ProteinModelPortaliP05977
SMRiP05977
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi201656, 5 interactors
IntActiP05977, 4 interactors
MINTiP05977
STRINGi10090.ENSMUSP00000027151

PTM databases

iPTMnetiP05977
PhosphoSitePlusiP05977

2D gel databases

SWISS-2DPAGEiP05977
UCD-2DPAGEiP05977

Proteomic databases

PaxDbiP05977
PeptideAtlasiP05977
PRIDEiP05977

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000027151; ENSMUSP00000027151; ENSMUSG00000061816 [P05977-1]
ENSMUST00000119429; ENSMUSP00000112861; ENSMUSG00000061816 [P05977-2]
GeneIDi17901
KEGGimmu:17901
UCSCiuc007bit.2 mouse [P05977-1]

Organism-specific databases

CTDi4632
MGIiMGI:97269 Myl1

Phylogenomic databases

eggNOGiKOG0030 Eukaryota
COG5126 LUCA
GeneTreeiENSGT00590000082921
HOGENOMiHOG000233018
HOVERGENiHBG012180
InParanoidiP05977
KOiK05738
OMAiNKMAPKK
OrthoDBiEOG091G0TQL
PhylomeDBiP05977
TreeFamiTF351553

Enzyme and pathway databases

ReactomeiR-MMU-390522 Striated Muscle Contraction

Miscellaneous databases

ChiTaRSiMyl1 mouse
PROiPR:P05977
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000061816 Expressed in 231 organ(s), highest expression level in quadriceps femoris
CleanExiMM_MYL1
ExpressionAtlasiP05977 baseline and differential
GenevisibleiP05977 MM

Family and domain databases

CDDicd00051 EFh, 1 hit
InterProiView protein in InterPro
IPR011992 EF-hand-dom_pair
IPR002048 EF_hand_dom
SUPFAMiSSF47473 SSF47473, 1 hit
PROSITEiView protein in PROSITE
PS50222 EF_HAND_2, 3 hits
ProtoNetiSearch...

Entry informationi

Entry nameiMYL1_MOUSE
AccessioniPrimary (citable) accession number: P05977
Secondary accession number(s): P05978
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1988
Last sequence update: January 23, 2007
Last modified: November 7, 2018
This is version 155 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again