Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Myosin light chain 1/3, skeletal muscle isoform

Gene

MYL1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Regulatory light chain of myosin. Does not bind calcium.

GO - Molecular functioni

  • calcium ion binding Source: InterPro
  • structural constituent of muscle Source: BHF-UCL

GO - Biological processi

  • cardiac muscle contraction Source: Ensembl
  • muscle contraction Source: BHF-UCL
  • muscle filament sliding Source: Reactome

Keywordsi

Molecular functionMotor protein, Muscle protein, Myosin

Enzyme and pathway databases

ReactomeiR-HSA-390522 Striated Muscle Contraction
SIGNORiP05976

Names & Taxonomyi

Protein namesi
Recommended name:
Myosin light chain 1/3, skeletal muscle isoform
Short name:
MLC1/MLC3
Short name:
MLC1F/MLC3F
Alternative name(s):
Myosin light chain alkali 1/2
Short name:
Myosin light chain A1/A2
Gene namesi
Name:MYL1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000168530.15
HGNCiHGNC:7582 MYL1
MIMi160780 gene
neXtProtiNX_P05976

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

DisGeNETi4632
OpenTargetsiENSG00000168530
PharmGKBiPA31379

Polymorphism and mutation databases

BioMutaiMYL1
DMDMi127128

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedBy similarity
ChainiPRO_00001986812 – 194Myosin light chain 1/3, skeletal muscle isoformAdd BLAST193
Isoform MLC3 (identifier: P05976-2)
Initiator methionineiRemovedBy similarity

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N,N,N-trimethylalanineBy similarity1
Modified residuei71PhosphothreonineBy similarity1
Modified residuei73PhosphoserineBy similarity1
Modified residuei87PhosphothreonineBy similarity1
Modified residuei99PhosphoserineBy similarity1
Isoform MLC3 (identifier: P05976-2)
Modified residuei2N-acetylalanine By similarityBy similarity1

Post-translational modificationi

Isoform MLC3 is acetylated at position 2.By similarity

Keywords - PTMi

Acetylation, Methylation, Phosphoprotein

Proteomic databases

EPDiP05976
MaxQBiP05976
PaxDbiP05976
PeptideAtlasiP05976
PRIDEiP05976
ProteomicsDBi51863
51864 [P05976-2]

2D gel databases

SWISS-2DPAGEiP05976

PTM databases

iPTMnetiP05976
PhosphoSitePlusiP05976

Expressioni

Gene expression databases

BgeeiENSG00000168530 Expressed in 118 organ(s), highest expression level in quadriceps femoris
CleanExiHS_MYL1
GenevisibleiP05976 HS

Organism-specific databases

HPAiHPA046859
HPA063034

Interactioni

Subunit structurei

Myosin is a hexamer of 2 heavy chains and 4 light chains.

Protein-protein interaction databases

BioGridi110716, 18 interactors
IntActiP05976, 5 interactors
STRINGi9606.ENSP00000307280

Structurei

3D structure databases

ProteinModelPortaliP05976
SMRiP05976
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini50 – 85EF-hand 1PROSITE-ProRule annotationAdd BLAST36
Domaini127 – 162EF-hand 2PROSITE-ProRule annotationAdd BLAST36
Domaini162 – 194EF-hand 3PROSITE-ProRule annotationAdd BLAST33

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG0030 Eukaryota
COG5126 LUCA
GeneTreeiENSGT00590000082921
HOGENOMiHOG000233018
HOVERGENiHBG012180
InParanoidiP05976
KOiK05738
OMAiTNAEINK
OrthoDBiEOG091G0TQL
PhylomeDBiP05976
TreeFamiTF351553

Family and domain databases

CDDicd00051 EFh, 1 hit
InterProiView protein in InterPro
IPR011992 EF-hand-dom_pair
IPR002048 EF_hand_dom
PfamiView protein in Pfam
PF13405 EF-hand_6, 1 hit
SMARTiView protein in SMART
SM00054 EFh, 2 hits
SUPFAMiSSF47473 SSF47473, 1 hit
PROSITEiView protein in PROSITE
PS50222 EF_HAND_2, 3 hits

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform MLC1 (identifier: P05976-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAPKKDVKKP VAAAAAAPAP APAPAPAPAP AKPKEEKIDL SAIKIEFSKE
60 70 80 90 100
QQDEFKEAFL LFDRTGDSKI TLSQVGDVLR ALGTNPTNAE VRKVLGNPSN
110 120 130 140 150
EELNAKKIEF EQFLPMMQAI SNNKDQATYE DFVEGLRVFD KEGNGTVMGA
160 170 180 190
ELRHVLATLG EKMKEEEVEA LMAGQEDSNG CINYEAFVKH IMSI
Length:194
Mass (Da):21,145
Last modified:January 23, 2007 - v3
Checksum:iDA1F5C5E4C8A2124
GO
Isoform MLC3 (identifier: P05976-2) [UniParc] [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-53: MAPKKDVKKPVAAAAAAPAPAPAPAPAPAPAKPKEEKIDLSAIKIEFSKEQQD → MSFSADQIA

Show »
Length:150
Mass (Da):16,684
Checksum:i39D6FC3AD153483A
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti45I → M in CAB42646 (PubMed:3601661).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0386861 – 53MAPKK…KEQQD → MSFSADQIA in isoform MLC3. 4 PublicationsAdd BLAST53

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X05450 mRNA Translation: CAB42646.1
X05451 mRNA Translation: CAA29020.1
M20642 mRNA Translation: AAA59854.1
M20643 mRNA Translation: AAA59855.1
CR456869 mRNA Translation: CAG33150.1
AK311942 mRNA Translation: BAG34883.1
AK311892 mRNA Translation: BAG34833.1
CH471063 Genomic DNA Translation: EAW70483.1
CH471063 Genomic DNA Translation: EAW70484.1
BC005318 mRNA Translation: AAH05318.1
J05026 Genomic DNA Translation: AAA66960.1
CCDSiCCDS2390.1 [P05976-1]
CCDS2391.1 [P05976-2]
PIRiJS0431 MOHUA1
S07939 MOHUA2
RefSeqiNP_524144.1, NM_079420.2 [P05976-1]
NP_524146.1, NM_079422.2 [P05976-2]
UniGeneiHs.187338

Genome annotation databases

EnsembliENST00000341685; ENSP00000343321; ENSG00000168530 [P05976-2]
ENST00000352451; ENSP00000307280; ENSG00000168530 [P05976-1]
GeneIDi4632
KEGGihsa:4632
UCSCiuc002veb.4 human [P05976-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiMYL1_HUMAN
AccessioniPrimary (citable) accession number: P05976
Secondary accession number(s): B2R4N6
, B2R4T6, P06741, Q6IBD5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1988
Last sequence update: January 23, 2007
Last modified: September 12, 2018
This is version 167 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again