MYL1

Functionⁱ

Regulatory light chain of myosin. Does not bind calcium.

GO - Molecular functionⁱ

calcium ion binding Source: InterPro
structural constituent of muscle
Source: BHF-UCL
Non-traceable author statementⁱ
- 3904738

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

cardiac muscle contraction Source: Ensembl
muscle contraction
Source: BHF-UCL
Inferred from direct assayⁱ
- 8145163
muscle filament sliding Source: Reactome

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Motor protein, Muscle protein, Myosin

Molecular function

Motor protein, Muscle protein, Myosin

Enzyme and pathway databases

Reactomeⁱ	R-HSA-390522 Striated Muscle Contraction
SIGNORⁱ	P05976

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Myosin light chain 1/3, skeletal muscle isoform Short name: MLC1/MLC3 Short name: MLC1F/MLC3F Alternative name(s): Myosin light chain alkali 1/2 Short name: Myosin light chain A1/A2
Gene namesⁱ	Name:MYL1
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 2

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000168530.15
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:7582 MYL1
MIMⁱ	160780 gene
neXtProtⁱ	NX_P05976

Subcellular locationⁱ

GO - Cellular component

Pathology & Biotechⁱ

Organism-specific databases

DisGeNET More...DisGeNETⁱ	4632
Open Targets More...OpenTargetsⁱ	ENSG00000168530
PharmGKBⁱ	PA31379

Polymorphism and mutation databases

BioMutaⁱ	MYL1
DMDMⁱ	127128

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Length
Initiator methionineⁱ		RemovedBy similarity
ChainⁱPRO_0000198681	2 – 194	Myosin light chain 1/3, skeletal muscle isoformAdd BLAST	193
Isoform MLC3 (identifier: P05976-2)
Initiator methionineⁱ		RemovedBy similarity

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Length
Modified residueⁱ	2	N,N,N-trimethylalanineBy similarity	1
Modified residueⁱ	71	PhosphothreonineBy similarity	1
Modified residueⁱ	73	PhosphoserineBy similarity	1
Modified residueⁱ	87	PhosphothreonineBy similarity	1
Modified residueⁱ	99	PhosphoserineBy similarity	1
Isoform MLC3 (identifier: P05976-2)
Modified residueⁱ	2	N-acetylalanine By similarityBy similarity	1

Post-translational modificationⁱ

Isoform MLC3 is acetylated at position 2.By similarity

Keywords - PTMⁱ

Acetylation, Methylation, Phosphoprotein

Proteomic databases

EPDⁱ	P05976
MaxQB - The MaxQuant DataBase More...MaxQBⁱ	P05976
PaxDbⁱ	P05976
PeptideAtlas More...PeptideAtlasⁱ	P05976
PRIDEⁱ	P05976
ProteomicsDBⁱ	51863 51864 [P05976-2]

2D gel databases

SWISS-2DPAGEⁱ	P05976

SWISS-2DPAGEⁱ

P05976

PTM databases

iPTMnetⁱ	P05976
PhosphoSitePlusⁱ	P05976

Expressionⁱ

Gene expression databases

Bgeeⁱ	ENSG00000168530 Expressed in 118 organ(s), highest expression level in quadriceps femoris
CleanExⁱ	HS_MYL1
Genevisibleⁱ	P05976 HS

Organism-specific databases

Human Protein Atlas More...HPAⁱ	HPA046859 HPA063034

HPAⁱ

HPA046859
HPA063034

Interactionⁱ

Subunit structureⁱ

Myosin is a hexamer of 2 heavy chains and 4 light chains.

Protein-protein interaction databases

BioGridⁱ	110716, 18 interactors
IntActⁱ	P05976, 5 interactors
STRINGⁱ	9606.ENSP00000307280

Structureⁱ

3D structure databases

ProteinModelPortalⁱ	P05976
SMRⁱ	P05976
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Family & Domainsⁱ

Domains and Repeats

Feature key	Position(s)	DescriptionActions	Length
Domainⁱ	50 – 85	EF-hand 1PROSITE-ProRule annotationAdd BLAST	36
Domainⁱ	127 – 162	EF-hand 2PROSITE-ProRule annotationAdd BLAST	36
Domainⁱ	162 – 194	EF-hand 3PROSITE-ProRule annotationAdd BLAST	33

Keywords - Domainⁱ

Repeat

Phylogenomic databases

eggNOGⁱ	KOG0030 Eukaryota COG5126 LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00590000082921
HOGENOMⁱ	HOG000233018
HOVERGENⁱ	HBG012180
InParanoidⁱ	P05976
KEGG Orthology (KO) More...KOⁱ	K05738
OMAⁱ	TNAEINK
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G0TQL
PhylomeDBⁱ	P05976
TreeFamⁱ	TF351553

Family and domain databases

Conserved Domains Database More...CDDⁱ	cd00051 EFh, 1 hit
InterProⁱ	View protein in InterPro IPR011992 EF-hand-dom_pair IPR002048 EF_hand_dom
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF13405 EF-hand_6, 1 hit
SMARTⁱ	View protein in SMART SM00054 EFh, 2 hits
SUPFAMⁱ	SSF47473 SSF47473, 1 hit
PROSITEⁱ	View protein in PROSITE PS50222 EF_HAND_2, 3 hits

Sequences (2)ⁱ

Sequence statusⁱ: Complete.

Sequence processingⁱ: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsⁱ produced by alternative splicing. Align Add to basket

Isoform MLC1 (identifier: P05976-1) [UniParc]FASTA Add to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAPKKDVKKP VAAAAAAPAP APAPAPAPAP AKPKEEKIDL SAIKIEFSKE 
        60         70         80         90        100
QQDEFKEAFL LFDRTGDSKI TLSQVGDVLR ALGTNPTNAE VRKVLGNPSN 
       110        120        130        140        150
EELNAKKIEF EQFLPMMQAI SNNKDQATYE DFVEGLRVFD KEGNGTVMGA 
       160        170        180        190 
ELRHVLATLG EKMKEEEVEA LMAGQEDSNG CINYEAFVKH IMSI

Length:194

Mass (Da):21,145

Last modified:January 23, 2007 - v3

Checksum:ⁱDA1F5C5E4C8A2124

GO

Isoform MLC3 (identifier: P05976-2) [UniParc] [UniParc]FASTA Add to basket

The sequence of this isoform differs from the canonical sequence as follows:
1-53: MAPKKDVKKPVAAAAAAPAPAPAPAPAPAPAKPKEEKIDLSAIKIEFSKEQQD → MSFSADQIA

« Hide

        10         20         30         40         50
MSFSADQIAE FKEAFLLFDR TGDSKITLSQ VGDVLRALGT NPTNAEVRKV 
        60         70         80         90        100
LGNPSNEELN AKKIEFEQFL PMMQAISNNK DQATYEDFVE GLRVFDKEGN 
       110        120        130        140        150
GTVMGAELRH VLATLGEKMK EEEVEALMAG QEDSNGCINY EAFVKHIMSI

Show »

Length:150

Mass (Da):16,684

Checksum:ⁱ39D6FC3AD153483A

GO

Experimental Info

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Sequence conflictⁱ	45	I → M in CAB42646 (PubMed:3601661).Curated		1

Alternative sequence

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Alternative sequenceⁱVSP_038686	1 – 53	MAPKK…KEQQD → MSFSADQIA in isoform MLC3. 4 PublicationsAdd BLAST		53

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	X05450 mRNA Translation: CAB42646.1 X05451 mRNA Translation: CAA29020.1 M20642 mRNA Translation: AAA59854.1 M20643 mRNA Translation: AAA59855.1 CR456869 mRNA Translation: CAG33150.1 AK311942 mRNA Translation: BAG34883.1 AK311892 mRNA Translation: BAG34833.1 CH471063 Genomic DNA Translation: EAW70483.1 CH471063 Genomic DNA Translation: EAW70484.1 BC005318 mRNA Translation: AAH05318.1 J05026 Genomic DNA Translation: AAA66960.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS2390.1 [P05976-1] CCDS2391.1 [P05976-2]
PIRⁱ	JS0431 MOHUA1 S07939 MOHUA2
NCBI Reference Sequences More...RefSeqⁱ	NP_524144.1, NM_079420.2 [P05976-1] NP_524146.1, NM_079422.2 [P05976-2]
UniGeneⁱ	Hs.187338

Genome annotation databases

Ensemblⁱ	ENST00000341685; ENSP00000343321; ENSG00000168530 [P05976-2] ENST00000352451; ENSP00000307280; ENSG00000168530 [P05976-1]
GeneIDⁱ	4632
KEGGⁱ	hsa:4632
UCSC genome browser More...UCSCⁱ	uc002veb.4 human [P05976-1]

Keywords - Coding sequence diversityⁱ

Alternative splicing

Protein	Similar proteins		Species	Score	Length	Source
P05976	Uncharacterized protein MYL1 (Fragment)		HUMAN		140	UniRef100_P05976
Uncharacterized protein MYL1 (Fragment)		HUMAN		53
P05976-2	MYL1 isoform 1		PANTR		150	UniRef100_P05976-2
Myosin light chain 1		PANPA		150
Myosin light chain 1		GORGO		150

Protein	Similar proteins		Species	Score	Length	Source
P05976	Uncharacterized protein MYL1 (Fragment)		HUMAN		140	UniRef90_P05976
Myosin light chain 1		RHIRO		210
Myosin light chain 1		PAPAN		194
myosin light chain 1/3, skeletal muscle isoform isoform X1		TURTR		194
MYL1 isoform 1		PONAB		194
+20
P05976-2	MYL1 isoform 1		PANTR		150	UniRef90_P05976-2
Myosin light chain 1		PANPA		150
Myosin light chain 1		GORGO		150
myosin light chain 1/3, skeletal muscle isoform isoform X2		DELLE		150
Myosin light chain 1		SHEEP		150
+6

Protein	Similar proteins		Species	Score	Length	Source
P05976	Myosin light chain 3	)	HUMAN		195	UniRef50_P08590
Myosin light chain 3		PONAB		195
Myosin light chain 6B		MOUSE		207
Myosin light chain 3		RAT		200
MYL3 isoform 2		PANTR		195
+249
P05976-2	MYL1 isoform 1		PANTR		150	UniRef50_P05976-2
Myosin light chain 1		PANPA		150
Myosin light chain 1		GORGO		150
myosin light chain 1/3, skeletal muscle isoform		Florida manatee		150
Myosin light chain 1		SHEEP		150
+64

Entry informationⁱ

Entry nameⁱ	MYL1_HUMAN
Accessionⁱ	P05976Primary (citable) accession number: P05976 Secondary accession number(s): B2R4N6 , B2R4T6, P06741, Q6IBD5
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	November 1, 1988
	Last sequence update:	January 23, 2007
	Last modified:	September 12, 2018
	This is version 167 of the entry and version 3 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

Complete proteome, Reference proteome

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P05976 (MYL1_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Myosin light chain 1/3, skeletal muscle isoform

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Cytoskeleton

Cytosol

Other locations

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

2D gel databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Keywords - Domaini

Phylogenomic databases

Family and domain databases

Experimental Info

Alternative sequence

Sequence databases

Genome annotation databases

Keywords - Coding sequence diversityi

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Keywords - Domainⁱ

Keywords - Coding sequence diversityⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ