Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 199 (02 Jun 2021)
Sequence version 4 (25 Jul 2006)
Previous versions | rss
Add a publicationFeedback
Protein

Myosin heavy chain, muscle

Gene

Mhc

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Muscle contraction.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi179 – 186ATPBy similarity8

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActin-binding, Calmodulin-binding, Motor protein, Muscle protein, Myosin
LigandATP-binding, Nucleotide-binding

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Myosin heavy chain, muscle
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Mhc
ORF Names:CG17927
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiDrosophila melanogaster (Fruit fly)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7227 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000803 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2L

Organism-specific databases

Drosophila genome database

More...
FlyBasei
FBgn0264695, Mhc

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm, Thick filament

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001233871 – 1962Myosin heavy chain, muscleAdd BLAST1962

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P05661

PeptideAtlas

More...
PeptideAtlasi
P05661

PRoteomics IDEntifications database

More...
PRIDEi
P05661

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in larval and adult muscles. Isoforms containing exon 9a are expressed in indirect flight muscles, exons 9a and 9b are expressed in jump muscles, exons 9b and 9c are expressed in other larval and adult muscles.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
FBgn0264695, Expressed in crop (Drosophila) and 45 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P05661, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P05661, DM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Muscle myosin is a hexameric protein that consists of 2 heavy chain subunits (MHC), 2 alkali light chain subunits (MLC) and 2 regulatory light chain subunits (MLC-2).

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
61014, 59 interactors

Protein interaction database and analysis system

More...
IntActi
P05661, 8 interactors

Molecular INTeraction database

More...
MINTi
P05661

STRING: functional protein association networks

More...
STRINGi
7227.FBpp0080452

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11962
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P05661

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini33 – 82Myosin N-terminal SH3-likePROSITE-ProRule annotationAdd BLAST50
Domaini86 – 777Myosin motorPROSITE-ProRule annotationAdd BLAST692
Domaini780 – 809IQPROSITE-ProRule annotationAdd BLAST30

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni656 – 678Actin-bindingPROSITE-ProRule annotationAdd BLAST23
Regioni1822 – 1862DisorderedSequence analysisAdd BLAST41
Regioni1922 – 1962DisorderedSequence analysisAdd BLAST41

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili802 – 1927Sequence analysisAdd BLAST1126

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Alternative splicing exons contribute to the specialized contractile activities of different muscle types. Exon 3 encodes the hydrophobic pocket adjacent to the ATP-binding site, exon 9 is adjacent to the actin-binding domain, exon 11 is involved in actin-binding, exon 15 in the S2 hinge and exons 18 and 19 the non-coiled tail region.
Limited proteolysis of myosin heavy chain produces 1 light meromyosin (LMM) and 1 heavy meromyosin (HMM). HMM can be further cleaved into 2 globular subfragments (S1) and 1 rod-shaped subfragment (S2).Curated

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0161, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000175738

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P05661

Identification of Orthologs from Complete Genome Data

More...
OMAi
VYPDFKM

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P05661

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.30.30.360, 1 hit
3.40.850.10, 1 hit
4.10.270.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000048, IQ_motif_EF-hand-BS
IPR036961, Kinesin_motor_dom_sf
IPR001609, Myosin_head_motor_dom
IPR027401, Myosin_IQ_contain_sf
IPR004009, Myosin_N
IPR008989, Myosin_S1_N
IPR002928, Myosin_tail
IPR027417, P-loop_NTPase

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00063, Myosin_head, 1 hit
PF02736, Myosin_N, 1 hit
PF01576, Myosin_tail_1, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00193, MYOSINHEAVY

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00242, MYSc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52540, SSF52540, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50096, IQ, 1 hit
PS51456, MYOSIN_MOTOR, 1 hit
PS51844, SH3_LIKE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (26+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 26 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist. Exons 3, 7, 9, 11 and 15 are mutually exclusive splicing exons and exon 18 is included or excluded.

This entry has 26 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform AAAAA (identifier: P05661-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPKPVANQED EDPTPYLFVS LEQRRIDQSK PYDSKKSCWI PDEKEGYLLG
60 70 80 90 100
EIKATKGDIV SVGLQGGEVR DIKSEKVEKV NPPKFEKIED MADMTVLNTP
110 120 130 140 150
CVLHNLRQRY YAKLIYTYSG LFCVAINPYK RYPVYTNRCA KMYRGKRRNE
160 170 180 190 200
VPPHIFAISD GAYVDMLTNH VNQSMLITGE SGAGKTENTK KVIAYFATVG
210 220 230 240 250
ASKKTDEAAK SKGSLEDQVV QTNPVLEAFG NAKTVRNDNS SRFGKFIRIH
260 270 280 290 300
FGPTGKLAGA DIETYLLEKA RVISQQSLER SYHIFYQIMS GSVPGVKDIC
310 320 330 340 350
LLTDNIYDYH IVSQGKVTVA SIDDAEEFSL TDQAFDILGF TKQEKEDVYR
360 370 380 390 400
ITAAVMHMGG MKFKQRGREE QAEQDGEEEG GRVSKLFGCD TAELYKNLLK
410 420 430 440 450
PRIKVGNEFV TQGRNVQQVT NSIGALCKGV FDRLFKWLVK KCNETLDTQQ
460 470 480 490 500
KRQHFIGVLD IAGFEIFEYN GFEQLCINFT NEKLQQFFNH IMFVMEQEEY
510 520 530 540 550
KKEGINWDFI DFGMDLLACI DLIEKPMGIL SILEEESMFP KATDQTFSEK
560 570 580 590 600
LTNTHLGKSA PFQKPKPPKP GQQAAHFAIA HYAGCVSYNI TGWLEKNKDP
610 620 630 640 650
LNDTVVDQFK KSQNKLLIEI FADHAGQSGG GEQAKGGRGK KGGGFATVSS
660 670 680 690 700
AYKEQLNSLM TTLRSTQPHF VRCIIPNEMK QPGVVDAHLV MHQLTCNGVL
710 720 730 740 750
EGIRICRKGF PNRMMYPDFK MRYQILNPRG IKDLDCPKKA SKVLIESTEL
760 770 780 790 800
NEDLYRLGHT KVFFRAGVLG QMEEFRDERL GKIMSWMQAW ARGYLSRKGF
810 820 830 840 850
KKLQEQRVAL KVVQRNLRKY LQLRTWPWYK LWQKVKPLLN VSRIEDEIAR
860 870 880 890 900
LEEKAKKAEE LHAAEVKVRK ELEALNAKLL AEKTALLDSL SGEKGALQDY
910 920 930 940 950
QERNAKLTAQ KNDLENQLRD IQERLTQEED ARNQLFQQKK KADQEISGLK
960 970 980 990 1000
KDIEDLELNV QKAEQDKATK DHQIRNLNDE IAHQDELINK LNKEKKMQGE
1010 1020 1030 1040 1050
TNQKTGEELQ AAEDKINHLN KVKAKLEQTL DELEDSLERE KKVRGDVEKS
1060 1070 1080 1090 1100
KRKVEGDLKL TQEAVADLER NKKELEQTIQ RKDKELSSIT AKLEDEQVVV
1110 1120 1130 1140 1150
LKHQRQIKEL QARIEELEEE VEAERQARAK AEKQRADLAR ELEELGERLE
1160 1170 1180 1190 1200
EAGGATSAQI ELNKKREAEL SKLRRDLEEA NIQHESTLAN LRKKHNDAVA
1210 1220 1230 1240 1250
EMAEQVDQLN KLKAKAEHDR QTCHNELNQT RTACDQLGRD KAAQEKIAKQ
1260 1270 1280 1290 1300
LQHTLNEVQS KLDETNRTLN DFDASKKKLS IENSDLLRQL EEAESQVSQL
1310 1320 1330 1340 1350
SKIKISLTTQ LEDTKRLADE ESRERATLLG KFRNLEHDLD NLREQVEEEA
1360 1370 1380 1390 1400
EGKADLQRQL SKANAEAQVW RSKYESDGVA RSEELEEAKR KLQARLAEAE
1410 1420 1430 1440 1450
ETIESLNQKC IGLEKTKQRL STEVEDLQLE VDRANAIANA AEKKQKAFDK
1460 1470 1480 1490 1500
IIGEWKLKVD DLAAELDASQ KECRNYSTEL FRLKGAYEEG QEQLEAVRRE
1510 1520 1530 1540 1550
NKNLADEVKD LLDQIGEGGR NIHEIEKARK RLEAEKDELQ AALEEAEAAL
1560 1570 1580 1590 1600
EQEENKVLRA QLELSQVRQE IDRRIQEKEE EFENTRKNHQ RALDSMQASL
1610 1620 1630 1640 1650
EAEAKGKAEA LRMKKKLEAD INELEIALDH ANKANAEAQK NIKRYQQQLK
1660 1670 1680 1690 1700
DIQTALEEEQ RARDDAREQL GISERRANAL QNELEESRTL LEQADRGRRQ
1710 1720 1730 1740 1750
AEQELADAHE QLNEVSAQNA SISAAKRKLE SELQTLHSDL DELLNEAKNS
1760 1770 1780 1790 1800
EEKAKKAMVD AARLADELRA EQDHAQTQEK LRKALEQQIK ELQVRLDEAE
1810 1820 1830 1840 1850
ANALKGGKKA IQKLEQRVRE LENELDGEQR RHADAQKNLR KSERRVKELS
1860 1870 1880 1890 1900
FQSEEDRKNH ERMQDLVDKL QQKIKTYKRQ IEEAEEIAAL NLAKFRKAQQ
1910 1920 1930 1940 1950
ELEEAEERAD LAEQAISKFR AKGRAGSVGR GASPAPRATS VRPQFDGLAF
1960
PPRFDLAPEN EF
Length:1,962
Mass (Da):224,465
Last modified:July 25, 2006 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC8010B7971BB9576
GO
Isoform BDBBA (identifier: P05661-2) [UniParc]FASTAAdd to basket
Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     69-116: VRDIKSEKVE...RQRYYAKLIY → TRDLKKDLLQ...RQRYYNKLIY
     298-332: DICLLTDNIYDYHIVSQGKVTVASIDDAEEFSLTD → EMCFLSDNIYDYYNVSQGKVTVPNMDDGEEFQLAD
     469-525: YNGFEQLCIN...LLACIDLIEK → YNGFEQLCIN...LLACIDLIEK
     723-761: YQILNPRGIK...EDLYRLGHTK → YQILNPAGIV...PDMYRIGHTK

Show »
Length:1,962
Mass (Da):224,410
Checksum:i092A1BEAEC61CC4F
GO
Isoform BABDB (identifier: P05661-3) [UniParc]FASTAAdd to basket
Also known as: A

The sequence of this isoform differs from the canonical sequence as follows:
     69-116: VRDIKSEKVE...RQRYYAKLIY → TRDLKKDLLQ...RQRYYNKLIY
     469-525: YNGFEQLCIN...LLACIDLIEK → YNGFEQLCIN...LLACIDLIEK
     723-761: YQILNPRGIK...EDLYRLGHTK → YKIMCPKLLQ...EDQYRLGNTK
     1216-1241: AEHDRQTCHNELNQTRTACDQLGRDK → AEKEKNEYYGQLNDLRAGVDHITNEK

Show »
Length:1,962
Mass (Da):224,609
Checksum:i8D3511F4B0CC336D
GO
Isoform 3b (identifier: P05661-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     69-116: VRDIKSEKVE...RQRYYAKLIY → TRDLKKDLLQ...RQRYYNKLIY

Show »
Length:1,962
Mass (Da):224,542
Checksum:iEB283C6D53A31744
GO
Isoform 7b (identifier: P05661-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     298-332: DICLLTDNIYDYHIVSQGKVTVASIDDAEEFSLTD → EYCLLSNNIYDYRIVSQGKTTIPSVNDGEEWVAVD

Show »
Length:1,962
Mass (Da):224,553
Checksum:iAAC2835D91C8368C
GO
Isoform 7c (identifier: P05661-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     298-332: DICLLTDNIYDYHIVSQGKVTVASIDDAEEFSLTD → EMVFLGQHIGDYPGICQGKTRIPGVNDGEEFELTD

Show »
Length:1,962
Mass (Da):224,427
Checksum:i5CCB39F649CED1EC
GO
Isoform 7d (identifier: P05661-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     298-332: DICLLTDNIYDYHIVSQGKVTVASIDDAEEFSLTD → EMCFLSDNIYDYYNVSQGKVTVPNMDDGEEFQLAD

Show »
Length:1,962
Mass (Da):224,612
Checksum:iA76784F6BF9F1674
GO
Isoform 9b (identifier: P05661-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     469-525: YNGFEQLCIN...LLACIDLIEK → YNGFEQLCIN...LLACIDLIEK

Show »
Length:1,962
Mass (Da):224,456
Checksum:i7C5946E3CEC0D5D9
GO
Isoform 9c (identifier: P05661-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     469-525: YNGFEQLCIN...LLACIDLIEK → YNGFEQLCIN...LQLCIDLIEK

Show »
Length:1,962
Mass (Da):224,557
Checksum:iC15E3B4BADD7F542
GO
Isoform 11b (identifier: P05661-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     723-761: YQILNPRGIK...EDLYRLGHTK → YQILNPAGIV...PDMYRIGHTK

Show »
Length:1,962
Mass (Da):224,195
Checksum:iF13DEEEBBF268DD0
GO
Isoform 11c (identifier: P05661-11) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     723-761: YQILNPRGIK...EDLYRLGHTK → YQILNPKGIK...DDQYRLGNTK

Show »
Length:1,962
Mass (Da):224,429
Checksum:i6E0B16281726DD33
GO
Isoform 11d (identifier: P05661-12) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     723-761: YQILNPRGIK...EDLYRLGHTK → YKIMCPKLLQ...EDQYRLGNTK

Show »
Length:1,962
Mass (Da):224,547
Checksum:i548FA7C10C2EFDC6
GO
Isoform 11e (identifier: P05661-13) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     723-761: YQILNPRGIK...EDLYRLGHTK → YMILAPAIMA...PDMYRIGHTK

Show »
Length:1,962
Mass (Da):224,127
Checksum:i00443D3DC35C2B2A
GO
Isoform 15b (identifier: P05661-14) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1216-1241: AEHDRQTCHNELNQTRTACDQLGRDK → AEKEKNEYYGQLNDLRAGVDHITNEK

Show »
Length:1,962
Mass (Da):224,460
Checksum:i86CAC7C2503A9940
GO
Isoform 18 (identifier: P05661-15) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1936-1936: P → I
     1937-1962: Missing.

Show »
Length:1,936
Mass (Da):221,521
Checksum:i4EA20E0ED59DDC16
GO
Isoform C (identifier: P05661-16) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     469-525: YNGFEQLCIN...LLACIDLIEK → YNGFEQLCIN...LLACIDLIEK
     723-761: YQILNPRGIK...EDLYRLGHTK → YQILNPKGIK...DDQYRLGNTK
     1216-1241: AEHDRQTCHNELNQTRTACDQLGRDK → AEKEKNEYYGQLNDLRAGVDHITNEK

Show »
Length:1,962
Mass (Da):224,415
Checksum:i9498970989DC91AA
GO
Isoform D (identifier: P05661-17) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     69-116: VRDIKSEKVE...RQRYYAKLIY → TRDLKKDLLQ...RQRYYNKLIY
     469-525: YNGFEQLCIN...LLACIDLIEK → YNGFEQLCIN...LLACIDLIEK
     723-761: YQILNPRGIK...EDLYRLGHTK → YQILNPKGIK...DDQYRLGNTK
     1216-1241: AEHDRQTCHNELNQTRTACDQLGRDK → AEKEKNEYYGQLNDLRAGVDHITNEK

Show »
Length:1,962
Mass (Da):224,492
Checksum:iB7B1A01DABC41398
GO
Isoform E (identifier: P05661-18) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     469-525: YNGFEQLCIN...LLACIDLIEK → YNGFEQLCIN...LQLCIDLIEK
     723-761: YQILNPRGIK...EDLYRLGHTK → YKIMCPKLLQ...EDQYRLGNTK
     1216-1241: AEHDRQTCHNELNQTRTACDQLGRDK → AEKEKNEYYGQLNDLRAGVDHITNEK

Show »
Length:1,962
Mass (Da):224,634
Checksum:i131B5B48F1C391C4
GO
Isoform F (identifier: P05661-19) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     69-116: VRDIKSEKVE...RQRYYAKLIY → TRDLKKDLLQ...RQRYYNKLIY
     469-525: YNGFEQLCIN...LLACIDLIEK → YNGFEQLCIN...LLACIDLIEK
     1216-1241: AEHDRQTCHNELNQTRTACDQLGRDK → AEKEKNEYYGQLNDLRAGVDHITNEK

Show »
Length:1,962
Mass (Da):224,528
Checksum:i11BBBD4CCD595BDD
GO
Isoform G (identifier: P05661-20) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     469-525: YNGFEQLCIN...LLACIDLIEK → YNGFEQLCIN...LLACIDLIEK
     723-761: YQILNPRGIK...EDLYRLGHTK → YKIMCPKLLQ...EDQYRLGNTK
     1216-1241: AEHDRQTCHNELNQTRTACDQLGRDK → AEKEKNEYYGQLNDLRAGVDHITNEK

Show »
Length:1,962
Mass (Da):224,533
Checksum:iAE1C26E092D4B15F
GO
Isoform H (identifier: P05661-21) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     69-116: VRDIKSEKVE...RQRYYAKLIY → TRDLKKDLLQ...RQRYYNKLIY
     469-525: YNGFEQLCIN...LLACIDLIEK → YNGFEQLCIN...LQLCIDLIEK
     723-761: YQILNPRGIK...EDLYRLGHTK → YKIMCPKLLQ...EDQYRLGNTK
     1216-1241: AEHDRQTCHNELNQTRTACDQLGRDK → AEKEKNEYYGQLNDLRAGVDHITNEK

Show »
Length:1,962
Mass (Da):224,711
Checksum:i30326C5CD3DB13F6
GO
Isoform I (identifier: P05661-22) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     69-116: VRDIKSEKVE...RQRYYAKLIY → TRDLKKDLLQ...RQRYYNKLIY
     469-525: YNGFEQLCIN...LLACIDLIEK → YNGFEQLCIN...LQLCIDLIEK
     723-761: YQILNPRGIK...EDLYRLGHTK → YQILNPKGIK...DDQYRLGNTK
     1216-1241: AEHDRQTCHNELNQTRTACDQLGRDK → AEKEKNEYYGQLNDLRAGVDHITNEK

Show »
Length:1,962
Mass (Da):224,593
Checksum:i0AB6DDB5C8D33303
GO
Isoform Q (identifier: P05661-23) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     298-332: DICLLTDNIYDYHIVSQGKVTVASIDDAEEFSLTD → EYCLLSNNIYDYRIVSQGKTTIPSVNDGEEWVAVD
     469-525: YNGFEQLCIN...LLACIDLIEK → YNGFEQLCIN...LLACIDLIEK
     723-761: YQILNPRGIK...EDLYRLGHTK → YKIMCPKLLQ...EDQYRLGNTK
     1216-1241: AEHDRQTCHNELNQTRTACDQLGRDK → AEKEKNEYYGQLNDLRAGVDHITNEK

Show »
Length:1,962
Mass (Da):224,621
Checksum:iCCDFAEC472A712A5
GO
Isoform K (identifier: P05661-24) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     69-116: VRDIKSEKVE...RQRYYAKLIY → TRDLKKDLLQ...RQRYYNKLIY
     298-332: DICLLTDNIYDYHIVSQGKVTVASIDDAEEFSLTD → EMCFLSDNIYDYYNVSQGKVTVPNMDDGEEFQLAD
     723-761: YQILNPRGIK...EDLYRLGHTK → YMILAPAIMA...PDMYRIGHTK
     1936-1936: P → I
     1937-1962: Missing.

Show »
Length:1,936
Mass (Da):221,407
Checksum:i2097C007C6F2CC8B
GO
Isoform L (identifier: P05661-25) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     69-116: VRDIKSEKVE...RQRYYAKLIY → TRDLKKDLLQ...RQRYYNKLIY
     298-332: DICLLTDNIYDYHIVSQGKVTVASIDDAEEFSLTD → EMCFLSDNIYDYYNVSQGKVTVPNMDDGEEFQLAD
     723-761: YQILNPRGIK...EDLYRLGHTK → YQILNPAGIV...PDMYRIGHTK
     1936-1936: P → I
     1937-1962: Missing.

Show »
Length:1,936
Mass (Da):221,475
Checksum:i5A7B2028DE9DB4EC
GO
Isoform M (identifier: P05661-26) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     69-116: VRDIKSEKVE...RQRYYAKLIY → TRDLKKDLLQ...RQRYYNKLIY
     298-332: DICLLTDNIYDYHIVSQGKVTVASIDDAEEFSLTD → EMCFLSDNIYDYYNVSQGKVTVPNMDDGEEFQLAD
     469-525: YNGFEQLCIN...LLACIDLIEK → YNGFEQLCIN...LLACIDLIEK
     723-761: YQILNPRGIK...EDLYRLGHTK → YQILNPAGIV...PDMYRIGHTK
     1936-1936: P → I
     1937-1962: Missing.

Show »
Length:1,936
Mass (Da):221,466
Checksum:iA3C51D7E61B5536A
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E1JHJ3E1JHJ3_DROME
Myosin heavy chain, isoform O
Mhc Bsh, chr2L:16765388..16765564, chr2L:16781880..16782040, Dm II, Dmel\CG17927
1,962Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E1JHJ4E1JHJ4_DROME
Myosin heavy chain, isoform N
Mhc Bsh, chr2L:16765388..16765564, chr2L:16781880..16782040, Dm II, Dmel\CG17927
1,949Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E1JHJ5E1JHJ5_DROME
Myosin heavy chain, isoform P
Mhc Bsh, chr2L:16765388..16765564, chr2L:16781880..16782040, Dm II, Dmel\CG17927
1,949Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9NCU7M9NCU7_DROME
Myosin heavy chain, isoform S
Mhc Bsh, chr2L:16765388..16765564, chr2L:16781880..16782040, Dm II, Dmel\CG17927
1,962Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9ND95M9ND95_DROME
Myosin heavy chain, isoform U
Mhc Bsh, chr2L:16765388..16765564, chr2L:16781880..16782040, Dm II, Dmel\CG17927
1,949Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9NEP1M9NEP1_DROME
Myosin heavy chain, isoform T
Mhc Bsh, chr2L:16765388..16765564, chr2L:16781880..16782040, Dm II, Dmel\CG17927
1,962Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9NF46M9NF46_DROME
Myosin heavy chain, isoform R
Mhc Bsh, chr2L:16765388..16765564, chr2L:16781880..16782040, Dm II, Dmel\CG17927
1,962Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0S0WIH4A0A0S0WIH4_DROME
Myosin heavy chain, isoform V
Mhc Bsh, chr2L:16765388..16765564, chr2L:16781880..16782040, Dm II, Dmel\CG17927
1,962Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti43 – 44EK → RE in AAA28706 (PubMed:3038896).Curated2
Sequence conflicti43 – 44EK → RE in AAA28707 (PubMed:3038896).Curated2
Sequence conflicti68E → K in AAA28706 (PubMed:3038896).Curated1
Sequence conflicti68E → K in AAA28707 (PubMed:3038896).Curated1
Sequence conflicti215L → M in AAA28706 (PubMed:3038896).Curated1
Sequence conflicti215L → M in AAA28707 (PubMed:3038896).Curated1
Sequence conflicti281S → C in AAA28686 (PubMed:2506434).Curated1
Sequence conflicti281S → C in AAA28687 (PubMed:2506434).Curated1
Sequence conflicti1922K → KFRAK AA sequence (Ref. 8) Curated1
Sequence conflicti1933 – 1938SPAPRA → GPAVSY AA sequence (Ref. 8) Curated6

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_00332969 – 116VRDIK…AKLIY → TRDLKKDLLQQVNPPKYEKA EDMSNLTYLNDASVLHNLRQ RYYNKLIY in isoform 3b, isoform BDBBA, isoform BABDB, isoform D, isoform F, isoform H, isoform I, isoform K, isoform L and isoform M. CuratedAdd BLAST48
Alternative sequenceiVSP_003330298 – 332DICLL…FSLTD → EYCLLSNNIYDYRIVSQGKT TIPSVNDGEEWVAVD in isoform 7b and isoform Q. CuratedAdd BLAST35
Alternative sequenceiVSP_003331298 – 332DICLL…FSLTD → EMVFLGQHIGDYPGICQGKT RIPGVNDGEEFELTD in isoform 7c. CuratedAdd BLAST35
Alternative sequenceiVSP_003332298 – 332DICLL…FSLTD → EMCFLSDNIYDYYNVSQGKV TVPNMDDGEEFQLAD in isoform 7d, isoform BDBBA, isoform K, isoform L and isoform M. CuratedAdd BLAST35
Alternative sequenceiVSP_003333469 – 525YNGFE…DLIEK → YNGFEQLCINFTNEKLQQFF NHHMFVLEQEEYKREGIDWA FIDFGMDLLACIDLIEK in isoform 9b, isoform BDBBA, isoform BABDB, isoform C, isoform D, isoform F, isoform G, isoform Q and isoform M. CuratedAdd BLAST57
Alternative sequenceiVSP_003334469 – 525YNGFE…DLIEK → YNGFEQLCINFTNEKLQQFF NHHMFVLEQEEYQREGIEWT FIDFGMDLQLCIDLIEK in isoform 9c, isoform E, isoform H and isoform I. CuratedAdd BLAST57
Alternative sequenceiVSP_003335723 – 761YQILN…LGHTK → YQILNPAGIVGVDDPKKCGS IILESTALDPDMYRIGHTK in isoform 11b, isoform BDBBA, isoform L and isoform M. CuratedAdd BLAST39
Alternative sequenceiVSP_003336723 – 761YQILN…LGHTK → YQILNPKGIKGIEDPKKCTK VLIESTELNDDQYRLGNTK in isoform 11c, isoform C, isoform D and isoform I. CuratedAdd BLAST39
Alternative sequenceiVSP_003337723 – 761YQILN…LGHTK → YKIMCPKLLQGVEKDKKATE IIIKFIDLPEDQYRLGNTK in isoform 11d, isoform BABDB, isoform E, isoform G, isoform H and isoform Q. CuratedAdd BLAST39
Alternative sequenceiVSP_003338723 – 761YQILN…LGHTK → YMILAPAIMAAEKVAKNAAG KCLEAVGLDPDMYRIGHTK in isoform 11e and isoform K. CuratedAdd BLAST39
Alternative sequenceiVSP_0033391216 – 1241AEHDR…LGRDK → AEKEKNEYYGQLNDLRAGVD HITNEK in isoform 15b, isoform BABDB, isoform C, isoform D, isoform E, isoform F, isoform G, isoform H, isoform I and isoform Q. CuratedAdd BLAST26
Alternative sequenceiVSP_0033401936P → I in isoform 18, isoform K, isoform L and isoform M. Curated1
Alternative sequenceiVSP_0033411937 – 1962Missing in isoform 18, isoform K, isoform L and isoform M. CuratedAdd BLAST26

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
M61229 Genomic DNA Translation: AAA28686.1
M61229 Genomic DNA Translation: AAA28687.1
X53155 Genomic DNA Translation: CAA37308.1
X53155 Genomic DNA Translation: CAA37309.1
X53155 Genomic DNA Translation: CAA37310.1
X53155 Genomic DNA Translation: CAA37311.1
AE014134 Genomic DNA Translation: AAF53566.4
AE014134 Genomic DNA Translation: AAN10959.1
AE014134 Genomic DNA Translation: AAN10960.1
AE014134 Genomic DNA Translation: AAN10961.1
AE014134 Genomic DNA Translation: AAN10962.1
AE014134 Genomic DNA Translation: AAN10963.1
AE014134 Genomic DNA Translation: AAN10964.1
AE014134 Genomic DNA Translation: AAN10965.1
AE014134 Genomic DNA Translation: AAN10966.1
AE014134 Genomic DNA Translation: AAN10967.1
AE014134 Genomic DNA Translation: AAN10968.1
AE014134 Genomic DNA Translation: AAN10969.1
AE014134 Genomic DNA Translation: AAN10970.1
J02788 Genomic DNA Translation: AAA28706.1
J02788 Genomic DNA Translation: AAA28707.1
X60196 Genomic DNA Translation: CAA42752.1
X60196 Genomic DNA Translation: CAA42753.1
X60196 Genomic DNA Translation: CAA42754.1
M13360 Genomic DNA Translation: AAA28708.1
M13360 Genomic DNA Translation: AAA28709.1

Protein sequence database of the Protein Information Resource

More...
PIRi
A18942
A25380
A28492
A32491
A35815
B25380
B32491
B35815
C35815
D35815
S16600
S16601
S16602

NCBI Reference Sequences

More...
RefSeqi
NP_001162991.1, NM_001169520.3 [P05661-20]
NP_523587.4, NM_078863.6 [P05661-21]
NP_723999.1, NM_165181.3 [P05661-16]
NP_724000.1, NM_165182.3 [P05661-20]
NP_724001.1, NM_165183.3 [P05661-18]
NP_724002.2, NM_165184.3 [P05661-23]
NP_724003.1, NM_165185.3 [P05661-19]
NP_724004.1, NM_165186.3 [P05661-17]
NP_724005.1, NM_165187.3 [P05661-3]
NP_724006.1, NM_165188.3 [P05661-22]
NP_724007.1, NM_165189.3 [P05661-2]
NP_724008.1, NM_165190.4 [P05661-24]
NP_724009.1, NM_165191.3 [P05661-25]
NP_724010.1, NM_165192.4 [P05661-26]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
FBtr0080895; FBpp0080452; FBgn0264695 [P05661-20]
FBtr0080896; FBpp0080453; FBgn0264695 [P05661-3]
FBtr0080897; FBpp0080454; FBgn0264695 [P05661-2]
FBtr0080898; FBpp0080455; FBgn0264695 [P05661-16]
FBtr0080899; FBpp0080456; FBgn0264695 [P05661-18]
FBtr0080900; FBpp0080457; FBgn0264695 [P05661-17]
FBtr0080901; FBpp0080458; FBgn0264695 [P05661-19]
FBtr0080902; FBpp0080459; FBgn0264695 [P05661-21]
FBtr0080903; FBpp0080460; FBgn0264695 [P05661-22]
FBtr0080905; FBpp0080462; FBgn0264695 [P05661-25]
FBtr0080906; FBpp0080463; FBgn0264695 [P05661-24]
FBtr0080907; FBpp0080464; FBgn0264695 [P05661-26]
FBtr0301828; FBpp0291042; FBgn0264695 [P05661-20]
FBtr0307492; FBpp0298827; FBgn0264695 [P05661-23]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
35007

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
dme:Dmel_CG17927

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M61229 Genomic DNA Translation: AAA28686.1
M61229 Genomic DNA Translation: AAA28687.1
X53155 Genomic DNA Translation: CAA37308.1
X53155 Genomic DNA Translation: CAA37309.1
X53155 Genomic DNA Translation: CAA37310.1
X53155 Genomic DNA Translation: CAA37311.1
AE014134 Genomic DNA Translation: AAF53566.4
AE014134 Genomic DNA Translation: AAN10959.1
AE014134 Genomic DNA Translation: AAN10960.1
AE014134 Genomic DNA Translation: AAN10961.1
AE014134 Genomic DNA Translation: AAN10962.1
AE014134 Genomic DNA Translation: AAN10963.1
AE014134 Genomic DNA Translation: AAN10964.1
AE014134 Genomic DNA Translation: AAN10965.1
AE014134 Genomic DNA Translation: AAN10966.1
AE014134 Genomic DNA Translation: AAN10967.1
AE014134 Genomic DNA Translation: AAN10968.1
AE014134 Genomic DNA Translation: AAN10969.1
AE014134 Genomic DNA Translation: AAN10970.1
J02788 Genomic DNA Translation: AAA28706.1
J02788 Genomic DNA Translation: AAA28707.1
X60196 Genomic DNA Translation: CAA42752.1
X60196 Genomic DNA Translation: CAA42753.1
X60196 Genomic DNA Translation: CAA42754.1
M13360 Genomic DNA Translation: AAA28708.1
M13360 Genomic DNA Translation: AAA28709.1
PIRiA18942
A25380
A28492
A32491
A35815
B25380
B32491
B35815
C35815
D35815
S16600
S16601
S16602
RefSeqiNP_001162991.1, NM_001169520.3 [P05661-20]
NP_523587.4, NM_078863.6 [P05661-21]
NP_723999.1, NM_165181.3 [P05661-16]
NP_724000.1, NM_165182.3 [P05661-20]
NP_724001.1, NM_165183.3 [P05661-18]
NP_724002.2, NM_165184.3 [P05661-23]
NP_724003.1, NM_165185.3 [P05661-19]
NP_724004.1, NM_165186.3 [P05661-17]
NP_724005.1, NM_165187.3 [P05661-3]
NP_724006.1, NM_165188.3 [P05661-22]
NP_724007.1, NM_165189.3 [P05661-2]
NP_724008.1, NM_165190.4 [P05661-24]
NP_724009.1, NM_165191.3 [P05661-25]
NP_724010.1, NM_165192.4 [P05661-26]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5W1AX-ray2.23A/C1-810[»]
A/C2-805[»]
SMRiP05661
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi61014, 59 interactors
IntActiP05661, 8 interactors
MINTiP05661
STRINGi7227.FBpp0080452

Proteomic databases

PaxDbiP05661
PeptideAtlasiP05661
PRIDEiP05661

Genome annotation databases

EnsemblMetazoaiFBtr0080895; FBpp0080452; FBgn0264695 [P05661-20]
FBtr0080896; FBpp0080453; FBgn0264695 [P05661-3]
FBtr0080897; FBpp0080454; FBgn0264695 [P05661-2]
FBtr0080898; FBpp0080455; FBgn0264695 [P05661-16]
FBtr0080899; FBpp0080456; FBgn0264695 [P05661-18]
FBtr0080900; FBpp0080457; FBgn0264695 [P05661-17]
FBtr0080901; FBpp0080458; FBgn0264695 [P05661-19]
FBtr0080902; FBpp0080459; FBgn0264695 [P05661-21]
FBtr0080903; FBpp0080460; FBgn0264695 [P05661-22]
FBtr0080905; FBpp0080462; FBgn0264695 [P05661-25]
FBtr0080906; FBpp0080463; FBgn0264695 [P05661-24]
FBtr0080907; FBpp0080464; FBgn0264695 [P05661-26]
FBtr0301828; FBpp0291042; FBgn0264695 [P05661-20]
FBtr0307492; FBpp0298827; FBgn0264695 [P05661-23]
GeneIDi35007
KEGGidme:Dmel_CG17927

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
35007
FlyBaseiFBgn0264695, Mhc

Phylogenomic databases

eggNOGiKOG0161, Eukaryota
GeneTreeiENSGT00940000175738
InParanoidiP05661
OMAiVYPDFKM
PhylomeDBiP05661

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
35007, 0 hits in 3 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Mhc, fly

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
35007

Protein Ontology

More...
PROi
PR:P05661

Gene expression databases

BgeeiFBgn0264695, Expressed in crop (Drosophila) and 45 other tissues
ExpressionAtlasiP05661, baseline and differential
GenevisibleiP05661, DM

Family and domain databases

Gene3Di2.30.30.360, 1 hit
3.40.850.10, 1 hit
4.10.270.10, 1 hit
InterProiView protein in InterPro
IPR000048, IQ_motif_EF-hand-BS
IPR036961, Kinesin_motor_dom_sf
IPR001609, Myosin_head_motor_dom
IPR027401, Myosin_IQ_contain_sf
IPR004009, Myosin_N
IPR008989, Myosin_S1_N
IPR002928, Myosin_tail
IPR027417, P-loop_NTPase
PfamiView protein in Pfam
PF00063, Myosin_head, 1 hit
PF02736, Myosin_N, 1 hit
PF01576, Myosin_tail_1, 1 hit
PRINTSiPR00193, MYOSINHEAVY
SMARTiView protein in SMART
SM00242, MYSc, 1 hit
SUPFAMiSSF52540, SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS50096, IQ, 1 hit
PS51456, MYOSIN_MOTOR, 1 hit
PS51844, SH3_LIKE, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMYSA_DROME
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P05661
Secondary accession number(s): O18392
, O18393, Q24412, Q7JN62, Q7JN63, Q7JQ08, Q7JQ09, Q7M4K4, Q8INZ9, Q8IP00, Q8IP01, Q8IP02, Q8IP03, Q8IP04, Q8IP05, Q8IP06, Q8IP07, Q8IP08, Q8IP09, Q8IP10, Q9TY21, Q9TY22, Q9TYD7, Q9VJI3
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1988
Last sequence update: July 25, 2006
Last modified: June 2, 2021
This is version 199 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Direct protein sequencing, Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again