Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Integrin beta-1

Gene

ITGB1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Integrins alpha-1/beta-1, alpha-2/beta-1, alpha-10/beta-1 and alpha-11/beta-1 are receptors for collagen. Integrins alpha-1/beta-1 and alpha-2/beta-2 recognize the proline-hydroxylated sequence G-F-P-G-E-R in collagen. Integrins alpha-2/beta-1, alpha-3/beta-1, alpha-4/beta-1, alpha-5/beta-1, alpha-8/beta-1, alpha-10/beta-1, alpha-11/beta-1 and alpha-V/beta-1 are receptors for fibronectin. Alpha-4/beta-1 recognizes one or more domains within the alternatively spliced CS-1 and CS-5 regions of fibronectin. Integrin alpha-5/beta-1 is a receptor for fibrinogen. Integrin alpha-1/beta-1, alpha-2/beta-1, alpha-6/beta-1 and alpha-7/beta-1 are receptors for lamimin. Integrin alpha-6/beta-1 (ITGA6:ITGB1) is present in oocytes and is involved in sperm-egg fusion (By similarity). Integrin alpha-4/beta-1 is a receptor for VCAM1. It recognizes the sequence Q-I-D-S in VCAM1. Integrin alpha-9/beta-1 is a receptor for VCAM1, cytotactin and osteopontin. It recognizes the sequence A-E-I-D-G-I-E-L in cytotactin. Integrin alpha-3/beta-1 is a receptor for epiligrin, thrombospondin and CSPG4. Alpha-3/beta-1 may mediate with LGALS3 the stimulation by CSPG4 of endothelial cells migration. Integrin alpha-V/beta-1 is a receptor for vitronectin. Beta-1 integrins recognize the sequence R-G-D in a wide array of ligands. Isoform 2 interferes with isoform 1 resulting in a dominant negative effect on cell adhesion and migration (in vitro). When associated with alpha-7/beta-1 integrin, regulates cell adhesion and laminin matrix deposition. Involved in promoting endothelial cell motility and angiogenesis. Involved in osteoblast compaction through the fibronectin fibrillogenesis cell-mediated matrix assembly process and the formation of mineralized bone nodules. May be involved in up-regulation of the activity of kinases such as PKC via binding to KRT1. Together with KRT1 and RACK1, serves as a platform for SRC activation or inactivation. Plays a mechanistic adhesive role during telophase, required for the successful completion of cytokinesis. Integrin alpha-3/beta-1 provides a docking site for FAP (seprase) at invadopodia plasma membranes in a collagen-dependent manner and hence may participate in the adhesion, formation of invadopodia and matrix degradation processes, promoting cell invasion. ITGA4:ITGB1 binds to fractalkine (CX3CL1) and may act as its coreceptor in CX3CR1-dependent fractalkine signaling (PubMed:23125415, PubMed:24789099). ITGA4:ITGB1 and ITGA5:ITGB1 bind to PLA2G2A via a site (site 2) which is distinct from the classical ligand-binding site (site 1) and this induces integrin conformational changes and enhanced ligand binding to site 1 (PubMed:18635536, PubMed:25398877). ITGA5:ITGB1 acts as a receptor for fibrillin-1 (FBN1) and mediates R-G-D-dependent cell adhesion to FBN1 (PubMed:12807887, PubMed:17158881). ITGA5:ITGB1 is a receptor for IL1B and binding is essential for IL1B signaling (PubMed:29030430).By similarity14 Publications
Isoform 5: Isoform 5 displaces isoform 1 in striated muscles.By similarity
(Microbial infection) Integrin ITGA2:ITGB1 acts as a receptor for Human echoviruses 1 and 8.1 Publication
(Microbial infection) Acts as a receptor for Cytomegalovirus/HHV-5.1 Publication
(Microbial infection) Acts as a receptor for Epstein-Barr virus/HHV-4.1 Publication
(Microbial infection) Integrin ITGA5:ITGB1 acts as a receptor for Human parvovirus B19.1 Publication
(Microbial infection) Integrin ITGA2:ITGB1 acts as a receptor for Human rotavirus.1 Publication
(Microbial infection) Acts as a receptor for Mammalian reovirus.1 Publication
(Microbial infection) In case of HIV-1 infection, integrin ITGA5:ITGB1 binding to extracellular viral Tat protein seems to enhance angiogenesis in Kaposi's sarcoma lesions.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi152Magnesium1
Metal bindingi154Calcium 1; via carbonyl oxygen1
Metal bindingi156Calcium 11
Metal bindingi157Calcium 11
Metal bindingi189Calcium 21
Metal bindingi244Calcium 21
Metal bindingi246Calcium 21
Metal bindingi248Calcium 2; via carbonyl oxygen1
Metal bindingi249Calcium 21
Metal bindingi249Magnesium1
Metal bindingi362Calcium 1; via carbonyl oxygen1

GO - Molecular functioni

  • actin binding Source: BHF-UCL
  • cadherin binding Source: BHF-UCL
  • cell adhesion molecule binding Source: UniProtKB
  • collagen binding involved in cell-matrix adhesion Source: UniProtKB
  • coreceptor activity Source: UniProtKB
  • fibronectin binding Source: UniProtKB
  • integrin binding Source: GO_Central
  • laminin binding Source: Ensembl
  • metal ion binding Source: UniProtKB-KW
  • protease binding Source: UniProtKB
  • protein-containing complex binding Source: UniProtKB
  • protein heterodimerization activity Source: UniProtKB
  • virus receptor activity Source: UniProtKB-KW

GO - Biological processi

Keywordsi

Molecular functionHost cell receptor for virus entry, Integrin, Receptor
Biological processCell adhesion, Host-virus interaction
LigandCalcium, Magnesium, Metal-binding

Enzyme and pathway databases

ReactomeiR-HSA-1566948 Elastic fibre formation
R-HSA-1566977 Fibronectin matrix formation
R-HSA-198933 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
R-HSA-202733 Cell surface interactions at the vascular wall
R-HSA-210991 Basigin interactions
R-HSA-2129379 Molecules associated with elastic fibres
R-HSA-216083 Integrin cell surface interactions
R-HSA-3000157 Laminin interactions
R-HSA-3000170 Syndecan interactions
R-HSA-3000178 ECM proteoglycans
R-HSA-416700 Other semaphorin interactions
R-HSA-445144 Signal transduction by L1
R-HSA-446343 Localization of the PINCH-ILK-PARVIN complex to focal adhesions
R-HSA-447041 CHL1 interactions
R-HSA-5663220 RHO GTPases Activate Formins
R-HSA-6785807 Interleukin-4 and Interleukin-13 signaling
R-HSA-75892 Platelet Adhesion to exposed collagen
R-HSA-8874081 MET activates PTK2 signaling
R-HSA-8875513 MET interacts with TNS proteins
SABIO-RKiP05556
SignaLinkiP05556
SIGNORiP05556

Protein family/group databases

TCDBi9.B.87.1.8 the selenoprotein p receptor (selp-receptor) family

Names & Taxonomyi

Protein namesi
Recommended name:
Integrin beta-1
Alternative name(s):
Fibronectin receptor subunit beta
Glycoprotein IIa
Short name:
GPIIA
VLA-4 subunit beta
CD_antigen: CD29
Gene namesi
Name:ITGB1
Synonyms:FNRB, MDF2, MSK12
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

EuPathDBiHostDB:ENSG00000150093.18
HGNCiHGNC:6153 ITGB1
MIMi135630 gene
neXtProtiNX_P05556

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini21 – 728ExtracellularSequence analysisAdd BLAST708
Transmembranei729 – 751HelicalSequence analysisAdd BLAST23
Topological domaini752 – 798CytoplasmicSequence analysisAdd BLAST47

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Endosome, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi760 – 761RR → AA: No effect on interaction with ACAP1. 1 Publication2
Mutagenesisi762 – 767EFAKFE → AAAAAA: Strongly reduces interaction with ACAP1 and ability to recycle; does not affect heterodimerization with ITGA5. 1 Publication6
Mutagenesisi762 – 763EF → AA: Slightly reduces interaction with ACAP1. 2
Mutagenesisi765K → A: Reduces interaction with ACAP1. 1
Mutagenesisi766 – 767FE → AA: Slightly reduces interaction with ACAP1. 2
Mutagenesisi768 – 769KE → AA: No effect on interaction with ACAP1. 1 Publication2
Mutagenesisi778G → Q: Loss of beta-1A interaction with FLNA and FLNB. 1 Publication1
Mutagenesisi786 – 791AVTTVV → PINNFK: Does not interact with ITGB1BP1. 1 Publication6
Mutagenesisi786A → P: Loss of beta-1A interaction with FLNA and FLNB. 1 Publication1
Mutagenesisi787V → T: Reduces interaction with ITGB1BP1, but not with FERMT2 or TLN1. Inhibits fibronectin deposition and mineralized bone nodules formation. 1 Publication1
Mutagenesisi788T → D: Strongly reduces ITGB1BP1 binding; when associated with D-790. 1 Publication1
Mutagenesisi790V → D: Strongly reduces ITGB1BP1 binding; when associated with D-788. 1 Publication1
Mutagenesisi792N → A: Strongly reduces ITGB1BP1 binding; when associated with A-795. 1 Publication1
Mutagenesisi795Y → A: Strongly reduces ITGB1BP1 binding; when associated with A-792. 1 Publication1

Organism-specific databases

DisGeNETi3688
OpenTargetsiENSG00000150093
PharmGKBiPA29953

Chemistry databases

ChEMBLiCHEMBL1905
DrugBankiDB00098 Anti-thymocyte Globulin (Rabbit)
GuidetoPHARMACOLOGYi2455

Polymorphism and mutation databases

BioMutaiITGB1
DMDMi218563324

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 20Add BLAST20
ChainiPRO_000001633421 – 798Integrin beta-1Add BLAST778

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi27 ↔ 451 Publication
Disulfide bondi35 ↔ 4641 Publication
Disulfide bondi38 ↔ 641 Publication
Disulfide bondi48 ↔ 751 Publication
Glycosylationi50N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi94N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi97N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi207 ↔ 2131 Publication
Glycosylationi212N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi261 ↔ 3011 Publication
Glycosylationi269N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi363N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi401 ↔ 4151 Publication
Glycosylationi406N-linked (GlcNAc...) asparagine3 Publications1
Glycosylationi417N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi435 ↔ 4621 Publication
Disulfide bondi466 ↔ 6911 Publication
Disulfide bondi477 ↔ 489By similarity
Glycosylationi481N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi486 ↔ 525By similarity
Disulfide bondi491 ↔ 500By similarity
Disulfide bondi502 ↔ 516By similarity
Glycosylationi520N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi531 ↔ 536By similarity
Disulfide bondi533 ↔ 568By similarity
Disulfide bondi538 ↔ 553By similarity
Disulfide bondi555 ↔ 560By similarity
Disulfide bondi574 ↔ 579By similarity
Disulfide bondi576 ↔ 607By similarity
Disulfide bondi581 ↔ 590By similarity
Glycosylationi584N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi592 ↔ 599By similarity
Disulfide bondi613 ↔ 618By similarity
Disulfide bondi615 ↔ 661By similarity
Disulfide bondi620 ↔ 630By similarity
Disulfide bondi633 ↔ 636By similarity
Disulfide bondi640 ↔ 649By similarity
Disulfide bondi646 ↔ 723By similarity
Disulfide bondi665 ↔ 699By similarity
Glycosylationi669N-linked (GlcNAc...) asparagine1 Publication1
Modified residuei777PhosphothreonineCombined sources1
Modified residuei783PhosphotyrosineCombined sources1
Modified residuei785PhosphoserineCombined sources1
Modified residuei789PhosphothreonineCombined sources1
Modified residuei794N6-acetyllysine; alternateCombined sources1
Cross-linki794Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1); alternateCombined sources

Post-translational modificationi

The cysteine residues are involved in intrachain disulfide bonds.By similarity

Keywords - PTMi

Acetylation, Disulfide bond, Glycoprotein, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiP05556
MaxQBiP05556
PaxDbiP05556
PeptideAtlasiP05556
PRIDEiP05556
ProteomicsDBi51850
51851 [P05556-2]
51852 [P05556-3]
51853 [P05556-4]
51854 [P05556-5]

PTM databases

GlyConnecti1414
283
iPTMnetiP05556
PhosphoSitePlusiP05556
SwissPalmiP05556
UniCarbKBiP05556

Expressioni

Tissue specificityi

Isoform 1 is widely expressed, other isoforms are generally coexpressed with a more restricted distribution. Isoform 2 is expressed in skin, liver, skeletal muscle, cardiac muscle, placenta, umbilical vein endothelial cells, neuroblastoma cells, lymphoma cells, hepatoma cells and astrocytoma cells. Isoform 3 and isoform 4 are expressed in muscle, kidney, liver, placenta, cervical epithelium, umbilical vein endothelial cells, fibroblast cells, embryonal kidney cells, platelets and several blood cell lines. Isoform 4, rather than isoform 3, is selectively expressed in peripheral T-cells. Isoform 3 is expressed in non-proliferating and differentiated prostate gland epithelial cells and in platelets, on the surface of erythroleukemia cells and in various hematopoietic cell lines. Isoform 5 is expressed specifically in striated muscle (skeletal and cardiac muscle).6 Publications

Gene expression databases

BgeeiENSG00000150093 Expressed in 245 organ(s), highest expression level in visceral pleura
ExpressionAtlasiP05556 baseline and differential
GenevisibleiP05556 HS

Organism-specific databases

HPAiCAB003434
HPA059297
HPA069003

Interactioni

Subunit structurei

Heterodimer of an alpha and a beta subunit. Beta-1 associates with either alpha-1, alpha-2, alpha-3, alpha-4, alpha-5, alpha-6, alpha-7, alpha-8, alpha-9, alpha-10, alpha-11 or alpha-V. ITGA6:ITGB1 is found in a complex with CD9; interaction takes place in oocytes and is involved in sperm-egg fusion (By similarity). Interacts with seprase FAP (seprase); the interaction occurs at the cell surface of invadopodia membrane in a collagen-dependent manner. Binds LGALS3BP and NMRK2, when associated with alpha-7, but not with alpha-5. Interacts with FGR and HCK. Interacts (via the cytoplasmic region) with RAB25 (via the hypervariable C-terminal region). Interacts with RAB21. Interacts with KRT1 in the presence of RACK1 and SRC. Interacts with JAML; integrin alpha-4/beta-1 may regulate leukocyte to endothelial cells adhesion by controlling JAML homodimerization. Interacts with FLNA, FLNB and RANBP9. Isoform 5 interacts with ACE2. Isoform 1 interacts with the C-terminal region of FLNC. Interacts with MYO10. Interacts with DAB2. Interacts with FERMT2; the interaction is inhibited in presence of ITGB1BP1. Interacts with ITGB1BP1 (via C-terminal region); the interaction is a prerequisite for focal adhesion disassembly. Interacts with TLN1; the interaction is prevented by competitive binding of ITGB1BP1. Interacts with ACAP1; required for ITGB1 recycling. Interacts with ASAP3. Isoform 5 interacts with alpha-7A and alpha-7B in adult skeletal muscle. Isoform 5 interacts with alpha-7B in cardiomyocytes of adult heart. Interacts with EMP2; the interaction may be direct or indirect and ITGB1 has an heterodimer form (By similarity). ITGA5:ITGB1 interacts with NOV. ITGA4:ITGB1 is found in a ternary complex with CX3CR1 and CX3CL1 (PubMed:23125415). ITGA5:ITGB1 interacts with FBN1 (PubMed:12807887, PubMed:17158881). ITGA5:ITGB1 interacts with IL1B (PubMed:29030430).By similarity27 Publications
(Microbial infection) Integrin ITGA2:ITGB1 interacts with human echoviruses 1 and 8 capsid proteins.1 Publication
(Microbial infection) Interacts with human cytomegalovirus/HHV-5 envelope glycoprotein B/gB.1 Publication
(Microbial infection) Interacts with Epstein-Barr virus/HHV-4 gB protein.1 Publication
(Microbial infection) Integrin ITGA5:ITGB1 interacts with human parvovirus B19 capsid protein.1 Publication
(Microbial infection) Integrin ITGA2:ITGB1 interacts with human rotavirus VP4 protein.1 Publication
(Microbial infection) Interacts with mammalian reovirus capsid proteins.1 Publication
(Microbial infection) Integrin ITGA5:ITGB1 interacts with HIV-1 Tat.1 Publication

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi109894, 102 interactors
ComplexPortaliCPX-1794 Integrin alpha5-beta1 complex
CPX-1797 Integrin alpha3-beta1 complex
CPX-1798 Integrin alpha1-beta1 complex
CPX-1801 Integrin alpha2-beta1 complex
CPX-1802 Integrin alpha4-beta1 complex
CPX-1803 Integrin alpha6-beta1 complex
CPX-1804 Integrin alpha7-beta1 complex
CPX-1815 Integrin alpha8-beta1 complex
CPX-1816 Integrin alpha9-beta1 complex
CPX-1817 Integrin alpha10-beta1 complex
CPX-1818 Integrin alpha11-beta1 complex
CPX-1819 Integrin alphav-beta1 complex
CORUMiP05556
DIPiDIP-312N
ELMiP05556
IntActiP05556, 71 interactors
MINTiP05556
STRINGi9606.ENSP00000303351

Chemistry databases

BindingDBiP05556

Structurei

Secondary structure

1798
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliP05556
SMRiP05556
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP05556

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini140 – 378VWFAAdd BLAST239
Repeati466 – 515IAdd BLAST50
Repeati516 – 559IIAdd BLAST44
Repeati560 – 598IIIAdd BLAST39
Repeati599 – 635IVAdd BLAST37

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni207 – 213CX3CL1-binding1 Publication7
Regioni295 – 314CX3CL1-binding1 PublicationAdd BLAST20
Regioni466 – 635Cysteine-rich tandem repeatsAdd BLAST170
Regioni762 – 767Signal for sorting from recycling endosomes; interaction with ACAP16
Regioni785 – 792Interaction with ITGB1BP18

Sequence similaritiesi

Belongs to the integrin beta chain family.Curated

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG1226 Eukaryota
ENOG410XP60 LUCA
GeneTreeiENSGT00760000119064
HOVERGENiHBG006190
InParanoidiP05556
KOiK05719
OMAiVVETPEC
OrthoDBiEOG091G029W
PhylomeDBiP05556
TreeFamiTF105392

Family and domain databases

Gene3Di3.40.50.410, 1 hit
InterProiView protein in InterPro
IPR013111 EGF_extracell
IPR027071 Integrin_beta-1
IPR033760 Integrin_beta_N
IPR015812 Integrin_bsu
IPR014836 Integrin_bsu_cyt_dom
IPR012896 Integrin_bsu_tail
IPR036349 Integrin_bsu_tail_dom_sf
IPR002369 Integrin_bsu_VWA
IPR032695 Integrin_dom_sf
IPR016201 PSI
IPR036465 vWFA_dom_sf
PANTHERiPTHR10082 PTHR10082, 1 hit
PTHR10082:SF28 PTHR10082:SF28, 1 hit
PfamiView protein in Pfam
PF07974 EGF_2, 1 hit
PF08725 Integrin_b_cyt, 1 hit
PF07965 Integrin_B_tail, 1 hit
PF00362 Integrin_beta, 1 hit
PF17205 PSI_integrin, 1 hit
PIRSFiPIRSF002512 Integrin_B, 1 hit
PRINTSiPR01186 INTEGRINB
SMARTiView protein in SMART
SM00187 INB, 1 hit
SM01241 Integrin_b_cyt, 1 hit
SM01242 Integrin_B_tail, 1 hit
SM00423 PSI, 1 hit
SUPFAMiSSF53300 SSF53300, 1 hit
SSF69179 SSF69179, 1 hit
SSF69687 SSF69687, 1 hit
PROSITEiView protein in PROSITE
PS00022 EGF_1, 2 hits
PS00243 INTEGRIN_BETA, 3 hits

Sequences (5+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 13 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P05556-1) [UniParc]FASTAAdd to basket
Also known as: Beta-1A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNLQPIFWIG LISSVCCVFA QTDENRCLKA NAKSCGECIQ AGPNCGWCTN
60 70 80 90 100
STFLQEGMPT SARCDDLEAL KKKGCPPDDI ENPRGSKDIK KNKNVTNRSK
110 120 130 140 150
GTAEKLKPED ITQIQPQQLV LRLRSGEPQT FTLKFKRAED YPIDLYYLMD
160 170 180 190 200
LSYSMKDDLE NVKSLGTDLM NEMRRITSDF RIGFGSFVEK TVMPYISTTP
210 220 230 240 250
AKLRNPCTSE QNCTSPFSYK NVLSLTNKGE VFNELVGKQR ISGNLDSPEG
260 270 280 290 300
GFDAIMQVAV CGSLIGWRNV TRLLVFSTDA GFHFAGDGKL GGIVLPNDGQ
310 320 330 340 350
CHLENNMYTM SHYYDYPSIA HLVQKLSENN IQTIFAVTEE FQPVYKELKN
360 370 380 390 400
LIPKSAVGTL SANSSNVIQL IIDAYNSLSS EVILENGKLS EGVTISYKSY
410 420 430 440 450
CKNGVNGTGE NGRKCSNISI GDEVQFEISI TSNKCPKKDS DSFKIRPLGF
460 470 480 490 500
TEEVEVILQY ICECECQSEG IPESPKCHEG NGTFECGACR CNEGRVGRHC
510 520 530 540 550
ECSTDEVNSE DMDAYCRKEN SSEICSNNGE CVCGQCVCRK RDNTNEIYSG
560 570 580 590 600
KFCECDNFNC DRSNGLICGG NGVCKCRVCE CNPNYTGSAC DCSLDTSTCE
610 620 630 640 650
ASNGQICNGR GICECGVCKC TDPKFQGQTC EMCQTCLGVC AEHKECVQCR
660 670 680 690 700
AFNKGEKKDT CTQECSYFNI TKVESRDKLP QPVQPDPVSH CKEKDVDDCW
710 720 730 740 750
FYFTYSVNGN NEVMVHVVEN PECPTGPDII PIVAGVVAGI VLIGLALLLI
760 770 780 790
WKLLMIIHDR REFAKFEKEK MNAKWDTGEN PIYKSAVTTV VNPKYEGK
Length:798
Mass (Da):88,415
Last modified:December 16, 2008 - v2
Checksum:iDE35979C1625578C
GO
Isoform 2 (identifier: P05556-2) [UniParc]FASTAAdd to basket
Also known as: Beta-1B

The sequence of this isoform differs from the canonical sequence as follows:
     778-798: GENPIYKSAVTTVVNPKYEGK → VSYKTSKKQSGL

Show »
Length:789
Mass (Da):87,446
Checksum:i75834A92490CFBB0
GO
Isoform 3 (identifier: P05556-3) [UniParc]FASTAAdd to basket
Also known as: Beta-1C

The sequence of this isoform differs from the canonical sequence as follows:
     778-798: GENPIYKSAVTTVVNPKYEGK → SLSVAQPGVQWCDISSLQPLTSRFQQFSCLSLPSTWDYRVKILFIRVP

Show »
Length:825
Mass (Da):91,620
Checksum:iD5DCB510A049FBEC
GO
Isoform 4 (identifier: P05556-4) [UniParc]FASTAAdd to basket
Also known as: Beta-1C-2

The sequence of this isoform differs from the canonical sequence as follows:
     778-798: GENPIYKSAVTTVVNPKYEGK → PGVQWCDISSLQPLTSRFQQFSCLSLPSTWDYRVKILFIRVP

Show »
Length:819
Mass (Da):91,034
Checksum:i5838866B6DA6CECC
GO
Isoform 5 (identifier: P05556-5) [UniParc]FASTAAdd to basket
Also known as: Beta-1D

The sequence of this isoform differs from the canonical sequence as follows:
     778-798: GENPIYKSAVTTVVNPKYEGK → QENPIYKSPINNFKNPNYGRKAGL

Show »
Length:801
Mass (Da):88,884
Checksum:i5A2DA413650A16BE
GO

Computationally mapped potential isoform sequencesi

There are 13 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E7EQW5E7EQW5_HUMAN
Integrin beta
ITGB1
163Annotation score:
Q5T3E6Q5T3E6_HUMAN
Integrin beta-1
ITGB1
136Annotation score:
E7EUI6E7EUI6_HUMAN
Integrin beta-1
ITGB1
152Annotation score:
E9PLR6E9PLR6_HUMAN
Integrin beta-1
ITGB1
143Annotation score:
E9PQJ2E9PQJ2_HUMAN
Integrin beta-1
ITGB1
104Annotation score:
Q5T3E5Q5T3E5_HUMAN
Integrin beta-1
ITGB1
89Annotation score:
E7ERX5E7ERX5_HUMAN
Integrin beta-1
ITGB1
124Annotation score:
Q5T3E4Q5T3E4_HUMAN
Integrin beta-1
ITGB1
49Annotation score:
H7C4K3H7C4K3_HUMAN
Integrin beta-1
ITGB1
70Annotation score:
C9JPK5C9JPK5_HUMAN
Integrin beta-1
ITGB1
98Annotation score:
There are more potential isoformsShow all

Sequence cautioni

The sequence CAD97649 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti112T → H in CAA30790 (PubMed:2958481).Curated1
Sequence conflicti215S → T in CAA30790 (PubMed:2958481).Curated1
Sequence conflicti261 – 265CGSLI → VWMLL in AAI13902 (PubMed:15489334).Curated5
Sequence conflicti385 – 386EN → DG in AAI13902 (PubMed:15489334).Curated2
Sequence conflicti463E → V in BAF84386 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_002741778 – 798GENPI…KYEGK → VSYKTSKKQSGL in isoform 2. CuratedAdd BLAST21
Alternative sequenceiVSP_002742778 – 798GENPI…KYEGK → SLSVAQPGVQWCDISSLQPL TSRFQQFSCLSLPSTWDYRV KILFIRVP in isoform 3. CuratedAdd BLAST21
Alternative sequenceiVSP_002743778 – 798GENPI…KYEGK → PGVQWCDISSLQPLTSRFQQ FSCLSLPSTWDYRVKILFIR VP in isoform 4. CuratedAdd BLAST21
Alternative sequenceiVSP_002744778 – 798GENPI…KYEGK → QENPIYKSPINNFKNPNYGR KAGL in isoform 5. CuratedAdd BLAST21

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X07979 mRNA Translation: CAA30790.1
AK291697 mRNA Translation: BAF84386.1
BX537407 mRNA Translation: CAD97649.1 Different initiation.
AL365203 Genomic DNA No translation available.
CH471072 Genomic DNA Translation: EAW85948.1
CH471072 Genomic DNA Translation: EAW85949.1
CH471072 Genomic DNA Translation: EAW85950.1
CH471072 Genomic DNA Translation: EAW85951.1
CH471072 Genomic DNA Translation: EAW85952.1
CH471072 Genomic DNA Translation: EAW85953.1
CH471072 Genomic DNA Translation: EAW85954.1
CH471072 Genomic DNA Translation: EAW85955.1
CH471072 Genomic DNA Translation: EAW85957.1
CH471072 Genomic DNA Translation: EAW85958.1
CH471072 Genomic DNA Translation: EAW85959.1
BC020057 mRNA Translation: AAH20057.1
BC113901 mRNA Translation: AAI13902.1
U33879 Genomic DNA Translation: AAA79832.1
U33880, U33879 Genomic DNA Translation: AAA79833.1
U33882, U33879, U33881 Genomic DNA Translation: AAA79834.1
U33882, U33879 Genomic DNA Translation: AAA79835.1
M34189 mRNA Translation: AAA59182.1
M84237 mRNA Translation: AAA74402.1
M84237 mRNA Translation: AAA74403.1
U28252 mRNA Translation: AAA81366.1
CCDSiCCDS7174.1 [P05556-1]
PIRiB27079
RefSeqiNP_002202.2, NM_002211.3 [P05556-1]
NP_391988.1, NM_033668.2 [P05556-5]
NP_596867.1, NM_133376.2 [P05556-1]
UniGeneiHs.643813

Genome annotation databases

EnsembliENST00000302278; ENSP00000303351; ENSG00000150093 [P05556-1]
ENST00000396033; ENSP00000379350; ENSG00000150093 [P05556-1]
ENST00000423113; ENSP00000388694; ENSG00000150093 [P05556-5]
GeneIDi3688
KEGGihsa:3688
UCSCiuc001iwr.5 human [P05556-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Web resourcesi

Wikipedia

CD29 entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X07979 mRNA Translation: CAA30790.1
AK291697 mRNA Translation: BAF84386.1
BX537407 mRNA Translation: CAD97649.1 Different initiation.
AL365203 Genomic DNA No translation available.
CH471072 Genomic DNA Translation: EAW85948.1
CH471072 Genomic DNA Translation: EAW85949.1
CH471072 Genomic DNA Translation: EAW85950.1
CH471072 Genomic DNA Translation: EAW85951.1
CH471072 Genomic DNA Translation: EAW85952.1
CH471072 Genomic DNA Translation: EAW85953.1
CH471072 Genomic DNA Translation: EAW85954.1
CH471072 Genomic DNA Translation: EAW85955.1
CH471072 Genomic DNA Translation: EAW85957.1
CH471072 Genomic DNA Translation: EAW85958.1
CH471072 Genomic DNA Translation: EAW85959.1
BC020057 mRNA Translation: AAH20057.1
BC113901 mRNA Translation: AAI13902.1
U33879 Genomic DNA Translation: AAA79832.1
U33880, U33879 Genomic DNA Translation: AAA79833.1
U33882, U33879, U33881 Genomic DNA Translation: AAA79834.1
U33882, U33879 Genomic DNA Translation: AAA79835.1
M34189 mRNA Translation: AAA59182.1
M84237 mRNA Translation: AAA74402.1
M84237 mRNA Translation: AAA74403.1
U28252 mRNA Translation: AAA81366.1
CCDSiCCDS7174.1 [P05556-1]
PIRiB27079
RefSeqiNP_002202.2, NM_002211.3 [P05556-1]
NP_391988.1, NM_033668.2 [P05556-5]
NP_596867.1, NM_133376.2 [P05556-1]
UniGeneiHs.643813

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1K11model-B786-797[»]
1LHAmodel-A86-543[»]
3G9WX-ray2.16C/D752-785[»]
3T9KX-ray2.30A/B758-769[»]
3VI3X-ray2.90B/D21-465[»]
3VI4X-ray2.90B/D21-465[»]
4DX9X-ray3.006/7/8/9/B/D/F/H/J/L/N/P/R/T/V/X/Z/b/d/f/h/j/l/n/p/r/t/v/x/z784-798[»]
4WJKX-ray1.85B21-465[»]
4WK0X-ray1.78B21-465[»]
4WK2X-ray2.50B21-465[»]
4WK4X-ray2.50B21-465[»]
ProteinModelPortaliP05556
SMRiP05556
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi109894, 102 interactors
ComplexPortaliCPX-1794 Integrin alpha5-beta1 complex
CPX-1797 Integrin alpha3-beta1 complex
CPX-1798 Integrin alpha1-beta1 complex
CPX-1801 Integrin alpha2-beta1 complex
CPX-1802 Integrin alpha4-beta1 complex
CPX-1803 Integrin alpha6-beta1 complex
CPX-1804 Integrin alpha7-beta1 complex
CPX-1815 Integrin alpha8-beta1 complex
CPX-1816 Integrin alpha9-beta1 complex
CPX-1817 Integrin alpha10-beta1 complex
CPX-1818 Integrin alpha11-beta1 complex
CPX-1819 Integrin alphav-beta1 complex
CORUMiP05556
DIPiDIP-312N
ELMiP05556
IntActiP05556, 71 interactors
MINTiP05556
STRINGi9606.ENSP00000303351

Chemistry databases

BindingDBiP05556
ChEMBLiCHEMBL1905
DrugBankiDB00098 Anti-thymocyte Globulin (Rabbit)
GuidetoPHARMACOLOGYi2455

Protein family/group databases

TCDBi9.B.87.1.8 the selenoprotein p receptor (selp-receptor) family

PTM databases

GlyConnecti1414
283
iPTMnetiP05556
PhosphoSitePlusiP05556
SwissPalmiP05556
UniCarbKBiP05556

Polymorphism and mutation databases

BioMutaiITGB1
DMDMi218563324

Proteomic databases

EPDiP05556
MaxQBiP05556
PaxDbiP05556
PeptideAtlasiP05556
PRIDEiP05556
ProteomicsDBi51850
51851 [P05556-2]
51852 [P05556-3]
51853 [P05556-4]
51854 [P05556-5]

Protocols and materials databases

DNASUi3688
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000302278; ENSP00000303351; ENSG00000150093 [P05556-1]
ENST00000396033; ENSP00000379350; ENSG00000150093 [P05556-1]
ENST00000423113; ENSP00000388694; ENSG00000150093 [P05556-5]
GeneIDi3688
KEGGihsa:3688
UCSCiuc001iwr.5 human [P05556-1]

Organism-specific databases

CTDi3688
DisGeNETi3688
EuPathDBiHostDB:ENSG00000150093.18
GeneCardsiITGB1
HGNCiHGNC:6153 ITGB1
HPAiCAB003434
HPA059297
HPA069003
MIMi135630 gene
neXtProtiNX_P05556
OpenTargetsiENSG00000150093
PharmGKBiPA29953
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1226 Eukaryota
ENOG410XP60 LUCA
GeneTreeiENSGT00760000119064
HOVERGENiHBG006190
InParanoidiP05556
KOiK05719
OMAiVVETPEC
OrthoDBiEOG091G029W
PhylomeDBiP05556
TreeFamiTF105392

Enzyme and pathway databases

ReactomeiR-HSA-1566948 Elastic fibre formation
R-HSA-1566977 Fibronectin matrix formation
R-HSA-198933 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
R-HSA-202733 Cell surface interactions at the vascular wall
R-HSA-210991 Basigin interactions
R-HSA-2129379 Molecules associated with elastic fibres
R-HSA-216083 Integrin cell surface interactions
R-HSA-3000157 Laminin interactions
R-HSA-3000170 Syndecan interactions
R-HSA-3000178 ECM proteoglycans
R-HSA-416700 Other semaphorin interactions
R-HSA-445144 Signal transduction by L1
R-HSA-446343 Localization of the PINCH-ILK-PARVIN complex to focal adhesions
R-HSA-447041 CHL1 interactions
R-HSA-5663220 RHO GTPases Activate Formins
R-HSA-6785807 Interleukin-4 and Interleukin-13 signaling
R-HSA-75892 Platelet Adhesion to exposed collagen
R-HSA-8874081 MET activates PTK2 signaling
R-HSA-8875513 MET interacts with TNS proteins
SABIO-RKiP05556
SignaLinkiP05556
SIGNORiP05556

Miscellaneous databases

ChiTaRSiITGB1 human
EvolutionaryTraceiP05556
GeneWikiiCD29
GenomeRNAii3688
PROiPR:P05556
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000150093 Expressed in 245 organ(s), highest expression level in visceral pleura
ExpressionAtlasiP05556 baseline and differential
GenevisibleiP05556 HS

Family and domain databases

Gene3Di3.40.50.410, 1 hit
InterProiView protein in InterPro
IPR013111 EGF_extracell
IPR027071 Integrin_beta-1
IPR033760 Integrin_beta_N
IPR015812 Integrin_bsu
IPR014836 Integrin_bsu_cyt_dom
IPR012896 Integrin_bsu_tail
IPR036349 Integrin_bsu_tail_dom_sf
IPR002369 Integrin_bsu_VWA
IPR032695 Integrin_dom_sf
IPR016201 PSI
IPR036465 vWFA_dom_sf
PANTHERiPTHR10082 PTHR10082, 1 hit
PTHR10082:SF28 PTHR10082:SF28, 1 hit
PfamiView protein in Pfam
PF07974 EGF_2, 1 hit
PF08725 Integrin_b_cyt, 1 hit
PF07965 Integrin_B_tail, 1 hit
PF00362 Integrin_beta, 1 hit
PF17205 PSI_integrin, 1 hit
PIRSFiPIRSF002512 Integrin_B, 1 hit
PRINTSiPR01186 INTEGRINB
SMARTiView protein in SMART
SM00187 INB, 1 hit
SM01241 Integrin_b_cyt, 1 hit
SM01242 Integrin_B_tail, 1 hit
SM00423 PSI, 1 hit
SUPFAMiSSF53300 SSF53300, 1 hit
SSF69179 SSF69179, 1 hit
SSF69687 SSF69687, 1 hit
PROSITEiView protein in PROSITE
PS00022 EGF_1, 2 hits
PS00243 INTEGRIN_BETA, 3 hits
ProtoNetiSearch...

Entry informationi

Entry nameiITB1_HUMAN
AccessioniPrimary (citable) accession number: P05556
Secondary accession number(s): A8K6N2
, D3DRX9, D3DRY3, D3DRY4, D3DRY5, P78466, P78467, Q13089, Q13090, Q13091, Q13212, Q14622, Q14647, Q29RW2, Q7Z3V1, Q8WUM6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1988
Last sequence update: December 16, 2008
Last modified: November 7, 2018
This is version 233 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  5. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again