Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 192 (26 Feb 2020)
Sequence version 4 (01 Dec 2000)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Aromatic-L-amino-acid decarboxylase

Gene

Ddc

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Catalyzes the decarboxylation of L-3,4-dihydroxyphenylalanine (DOPA) to dopamine, L-5-hydroxytryptophan to serotonin and L-tryptophan to tryptamine. Variation in the synthesis of bioamines may be a factor contributing to natural variation in life span.1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

pyridoxal 5'-phosphate

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei117SubstrateBy similarity1
Binding sitei183Pyridoxal phosphate; via amide nitrogenBy similarity1
Binding sitei184Pyridoxal phosphateBy similarity1
Binding sitei227SubstrateBy similarity1
Binding sitei280Pyridoxal phosphate; via carbonyl oxygenBy similarity1
Binding sitei334Pyridoxal phosphateBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDecarboxylase, Lyase
Biological processCatecholamine biosynthesis
LigandPyridoxal phosphate

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
4.1.1.28 1994

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-DME-209905 Catecholamine biosynthesis
R-DME-209931 Serotonin and melatonin biosynthesis

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Aromatic-L-amino-acid decarboxylase (EC:4.1.1.28)
Short name:
AADC
Alternative name(s):
DOPA decarboxylase
Short name:
DDC
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Ddc
ORF Names:CG10697
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiDrosophila melanogaster (Fruit fly)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7227 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraHolometabolaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000803 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2L

Organism-specific databases

Drosophila genome database

More...
FlyBasei
FBgn0000422 Ddc

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001469451 – 510Aromatic-L-amino-acid decarboxylaseAdd BLAST510

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei337N6-(pyridoxal phosphate)lysineBy similarity1

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P05031

PRoteomics IDEntifications database

More...
PRIDEi
P05031

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Hypoderm isoform is expressed only in hypodermal epithelium and the CNS isoform only in central nervous system.2 Publications

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Hypoderm isoform has high expression levels in hypoderm during late embryogenesis, late larval development, pupariation and adult eclosion. CNS isoform has constant expression level in CNS throughout the life cycle.2 Publications

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

By ecdysone. In larval epidermis, expression is rapidly induced. In adult epidermis expression responds to a pulse of hormone and there is a time lag between initial exposure and appearance of DDC.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
FBgn0000422 Expressed in adult organism and 24 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P05031 differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P05031 DM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer.

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
61175, 4 interactors

Database of interacting proteins

More...
DIPi
DIP-18733N

Protein interaction database and analysis system

More...
IntActi
P05031, 2 interactors

STRING: functional protein association networks

More...
STRINGi
7227.FBpp0080710

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1510
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P05031

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P05031

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the group II decarboxylase family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0628 Eukaryota
COG0076 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156004

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P05031

KEGG Orthology (KO)

More...
KOi
K01593

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P05031

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.640.10, 1 hit
3.90.1150.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR010977 Aromatic_deC
IPR002129 PyrdxlP-dep_de-COase
IPR015424 PyrdxlP-dep_Trfase
IPR015422 PyrdxlP-dep_Trfase_dom1
IPR015421 PyrdxlP-dep_Trfase_major
IPR021115 Pyridoxal-P_BS

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00282 Pyridoxal_deC, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00800 YHDCRBOXLASE

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF53383 SSF53383, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00392 DDC_GAD_HDC_YDC, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform CNS (identifier: P05031-1) [UniParc]FASTAAdd to basket
Also known as: Long, Brain, 56.7 kDa, C

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSHIPISNTI PTKQTDGNGK ANISPDKLDP KVSIDMEAPE FKDFAKTMVD
60 70 80 90 100
FIAEYLENIR ERRVLPEVKP GYLKPLIPDA APEKPEKWQD VMQDIERVIM
110 120 130 140 150
PGVTHWHSPK FHAYFPTANS YPAIVADMLS GAIACIGFTW IASPACTELE
160 170 180 190 200
VVMMDWLGKM LELPAEFLAC SGGKGGGVIQ GTASESTLVA LLGAKAKKLK
210 220 230 240 250
EVKELHPEWD EHTILGKLVG YCSDQAHSSV ERAGLLGGVK LRSVQSENHR
260 270 280 290 300
MRGAALEKAI EQDVAEGLIP FYAVVTLGTT NSCAFDYLDE CGPVGNKHNL
310 320 330 340 350
WIHVDAAYAG SAFICPEYRH LMKGIESADS FNFNPHKWML VNFDCSAMWL
360 370 380 390 400
KDPSWVVNAF NVDPLYLKHD MQGSAPDYRH WQIPLGRRFR ALKLWFVLRL
410 420 430 440 450
YGVENLQAHI RRHCNFAKQF GDLCVADSRF ELAAEINMGL VCFRLKGSNE
460 470 480 490 500
RNEALLKRIN GRGHIHLVPA KIKDVYFLRM AICSRFTQSE DMEYSWKEVS
510
AAADEMEQEQ
Length:510
Mass (Da):57,288
Last modified:December 1, 2000 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i0A850488D407D4BF
GO
Isoform Hypoderm (identifier: P05031-2) [UniParc]FASTAAdd to basket
Also known as: Short, B, D

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: Missing.

Show »
Length:475
Mass (Da):53,573
Checksum:iBFF4DB13EDF550A1
GO
Isoform 3 (identifier: P05031-3) [UniParc]FASTAAdd to basket
Also known as: Hypoderm, 56.2 kDa

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MSHIPISNTIPTKQTDGNGKANISPDKLDPKVS → MSIGFRYRANNYARLITKYFCIHIK

Show »
Length:502
Mass (Da):56,863
Checksum:iD112AA488D6D02E9
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti32 – 33Missing in CAB37087 (PubMed:3102230).Curated2
Sequence conflicti479R → A in CAB37087 (PubMed:3102230).Curated1
Sequence conflicti479R → A in CAB37088 (PubMed:3102230).Curated1
Isoform 3 (identifier: P05031-3)
Sequence conflicti13A → V in AAO16848 (PubMed:12881721).Curated1

<p>This subsection of the 'Sequence' section provides information on polymorphic variants. If the variant is associated with a disease state, the description of the latter can be found in the <a href="http://www.uniprot.org/manual/involvement%5Fin%5Fdisease">'Involvement in disease'</a> subsection.<p><a href='/help/polymorphism' target='_top'>More...</a></p>Polymorphismi

Three common molecular polymorphisms (2 in the promoter region and Phe-12) account for 15.5% of the genetic contribution to variance in life span, the polymorphisms are maintained by balancing selection.1 Publication

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural varianti12T → P in allele Ddc-R6, allele Ddc-R9, allele Ddc-R16, allele Ddc-R20, allele Ddc-R25 and allele Ddc-R30. 1 Publication1
Natural varianti197K → N in allele Ddc-R9. 1 Publication1
Natural varianti264V → M in allele Ddc-R11 and allele Ddc-R18. 1 Publication1
Natural varianti390R → M in allele Ddc-Ore. 1 Publication1
Natural varianti428S → F in allele Ddc-R33. 1 Publication1
Natural varianti489S → A in allele Ddc-2b. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0013051 – 35Missing in isoform Hypoderm. CuratedAdd BLAST35
Alternative sequenceiVSP_0013061 – 33MSHIP…DPKVS → MSIGFRYRANNYARLITKYF CIHIK in isoform 3. 1 PublicationAdd BLAST33

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X04661 Genomic DNA Translation: CAB37087.1
X04661 Genomic DNA Translation: CAB37088.1
X04426 Genomic DNA Translation: CAA28022.1
X04426 Genomic DNA Translation: CAA28023.1
AY197756 Genomic DNA Translation: AAO16831.1
AY197756 Genomic DNA Translation: AAO16832.1
AY197757 Genomic DNA Translation: AAO16833.1
AY197757 Genomic DNA Translation: AAO16834.1
AY197758 Genomic DNA Translation: AAO16835.1
AY197758 Genomic DNA Translation: AAO16836.1
AY197759 Genomic DNA Translation: AAO16837.1
AY197759 Genomic DNA Translation: AAO16838.1
AY197760 Genomic DNA Translation: AAO16839.1
AY197760 Genomic DNA Translation: AAO16840.1
AY197761 Genomic DNA Translation: AAO16841.1
AY197761 Genomic DNA Translation: AAO16842.1
AY197762 Genomic DNA Translation: AAO16843.1
AY197762 Genomic DNA Translation: AAO16844.1
AY197763 Genomic DNA Translation: AAO16845.1
AY197763 Genomic DNA Translation: AAO16846.1
AY197764 Genomic DNA Translation: AAO16847.1
AY197764 Genomic DNA Translation: AAO16848.1
AY197765 Genomic DNA Translation: AAO16849.1
AY197765 Genomic DNA Translation: AAO16850.1
AY197766 Genomic DNA Translation: AAO16851.1
AY197766 Genomic DNA Translation: AAO16852.1
AY197767 Genomic DNA Translation: AAO16853.1
AY197767 Genomic DNA Translation: AAO16854.1
AY197768 Genomic DNA Translation: AAO16855.1
AY197768 Genomic DNA Translation: AAO16856.1
AY197769 Genomic DNA Translation: AAO16857.1
AY197769 Genomic DNA Translation: AAO16858.1
AE014134 Genomic DNA Translation: AAF53762.1
AE014134 Genomic DNA Translation: AAF53763.1
AE014134 Genomic DNA Translation: AAF53764.3
AY060708 mRNA Translation: AAL28256.1
AF091328 Genomic DNA Translation: AAC67582.1
X05991 Genomic DNA Translation: CAA29409.2

Protein sequence database of the Protein Information Resource

More...
PIRi
A25697 DCFFD1
A25709 DCFFA
B25697 DCFFD2

NCBI Reference Sequences

More...
RefSeqi
NP_523600.5, NM_078876.5 [P05031-2]
NP_724163.1, NM_165279.2 [P05031-1]
NP_724164.1, NM_165280.2 [P05031-2]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
FBtr0081166; FBpp0080709; FBgn0000422 [P05031-2]
FBtr0081167; FBpp0080710; FBgn0000422 [P05031-1]
FBtr0290291; FBpp0288730; FBgn0000422 [P05031-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
35190

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
dme:Dmel_CG10697

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X04661 Genomic DNA Translation: CAB37087.1
X04661 Genomic DNA Translation: CAB37088.1
X04426 Genomic DNA Translation: CAA28022.1
X04426 Genomic DNA Translation: CAA28023.1
AY197756 Genomic DNA Translation: AAO16831.1
AY197756 Genomic DNA Translation: AAO16832.1
AY197757 Genomic DNA Translation: AAO16833.1
AY197757 Genomic DNA Translation: AAO16834.1
AY197758 Genomic DNA Translation: AAO16835.1
AY197758 Genomic DNA Translation: AAO16836.1
AY197759 Genomic DNA Translation: AAO16837.1
AY197759 Genomic DNA Translation: AAO16838.1
AY197760 Genomic DNA Translation: AAO16839.1
AY197760 Genomic DNA Translation: AAO16840.1
AY197761 Genomic DNA Translation: AAO16841.1
AY197761 Genomic DNA Translation: AAO16842.1
AY197762 Genomic DNA Translation: AAO16843.1
AY197762 Genomic DNA Translation: AAO16844.1
AY197763 Genomic DNA Translation: AAO16845.1
AY197763 Genomic DNA Translation: AAO16846.1
AY197764 Genomic DNA Translation: AAO16847.1
AY197764 Genomic DNA Translation: AAO16848.1
AY197765 Genomic DNA Translation: AAO16849.1
AY197765 Genomic DNA Translation: AAO16850.1
AY197766 Genomic DNA Translation: AAO16851.1
AY197766 Genomic DNA Translation: AAO16852.1
AY197767 Genomic DNA Translation: AAO16853.1
AY197767 Genomic DNA Translation: AAO16854.1
AY197768 Genomic DNA Translation: AAO16855.1
AY197768 Genomic DNA Translation: AAO16856.1
AY197769 Genomic DNA Translation: AAO16857.1
AY197769 Genomic DNA Translation: AAO16858.1
AE014134 Genomic DNA Translation: AAF53762.1
AE014134 Genomic DNA Translation: AAF53763.1
AE014134 Genomic DNA Translation: AAF53764.3
AY060708 mRNA Translation: AAL28256.1
AF091328 Genomic DNA Translation: AAC67582.1
X05991 Genomic DNA Translation: CAA29409.2
PIRiA25697 DCFFD1
A25709 DCFFA
B25697 DCFFD2
RefSeqiNP_523600.5, NM_078876.5 [P05031-2]
NP_724163.1, NM_165279.2 [P05031-1]
NP_724164.1, NM_165280.2 [P05031-2]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3K40X-ray1.75A/B36-510[»]
SMRiP05031
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi61175, 4 interactors
DIPiDIP-18733N
IntActiP05031, 2 interactors
STRINGi7227.FBpp0080710

Proteomic databases

PaxDbiP05031
PRIDEiP05031

Genome annotation databases

EnsemblMetazoaiFBtr0081166; FBpp0080709; FBgn0000422 [P05031-2]
FBtr0081167; FBpp0080710; FBgn0000422 [P05031-1]
FBtr0290291; FBpp0288730; FBgn0000422 [P05031-2]
GeneIDi35190
KEGGidme:Dmel_CG10697

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
1644
FlyBaseiFBgn0000422 Ddc

Phylogenomic databases

eggNOGiKOG0628 Eukaryota
COG0076 LUCA
GeneTreeiENSGT00940000156004
InParanoidiP05031
KOiK01593
PhylomeDBiP05031

Enzyme and pathway databases

BRENDAi4.1.1.28 1994
ReactomeiR-DME-209905 Catecholamine biosynthesis
R-DME-209931 Serotonin and melatonin biosynthesis

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Ddc fly
EvolutionaryTraceiP05031

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
35190

Protein Ontology

More...
PROi
PR:P05031

Gene expression databases

BgeeiFBgn0000422 Expressed in adult organism and 24 other tissues
ExpressionAtlasiP05031 differential
GenevisibleiP05031 DM

Family and domain databases

Gene3Di3.40.640.10, 1 hit
3.90.1150.10, 1 hit
InterProiView protein in InterPro
IPR010977 Aromatic_deC
IPR002129 PyrdxlP-dep_de-COase
IPR015424 PyrdxlP-dep_Trfase
IPR015422 PyrdxlP-dep_Trfase_dom1
IPR015421 PyrdxlP-dep_Trfase_major
IPR021115 Pyridoxal-P_BS
PfamiView protein in Pfam
PF00282 Pyridoxal_deC, 1 hit
PRINTSiPR00800 YHDCRBOXLASE
SUPFAMiSSF53383 SSF53383, 1 hit
PROSITEiView protein in PROSITE
PS00392 DDC_GAD_HDC_YDC, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDDC_DROME
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P05031
Secondary accession number(s): O18379
, P05032, Q24295, Q7YSJ0, Q7YSK5, Q7YSV6, Q7Z0E1, Q7Z0E2, Q7Z0E3, Q7Z0E4, Q7Z0E5, Q7Z0E6, Q7Z0E7, Q7Z0E8, Q7Z0E9, Q95SL9, Q9VIZ5, Q9VIZ6
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 13, 1987
Last sequence update: December 1, 2000
Last modified: February 26, 2020
This is version 192 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again