Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protamine-2

Gene

PRM2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Protamines substitute for histones in the chromatin of sperm during the haploid phase of spermatogenesis. They compact sperm DNA into a highly condensed, stable and inactive complex.By similarity

GO - Molecular functioni

  • cadmium ion binding Source: CAFA
  • DNA binding Source: ProtInc
  • zinc ion binding Source: CAFA

GO - Biological processi

Keywordsi

Molecular functionDevelopmental protein, DNA-binding
Biological processDifferentiation, DNA condensation, Spermatogenesis

Names & Taxonomyi

Protein namesi
Recommended name:
Protamine-2
Alternative name(s):
Sperm histone P2
Sperm protamine P2
Cleaved into the following 7 chains:
Alternative name(s):
Sperm protamine P4
Alternative name(s):
Sperm protamine P2
Short name:
P2'
Alternative name(s):
P2''
Sperm protamine P3
Gene namesi
Name:PRM2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

EuPathDBiHostDB:ENSG00000122304.10
HGNCiHGNC:9448 PRM2
MIMi182882 gene
182890 gene
neXtProtiNX_P04554

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Chromosome, Nucleosome core, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi5620
OpenTargetsiENSG00000122304
PharmGKBiPA33793

Polymorphism and mutation databases

DMDMi123700

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCurated
ChainiPRO_00000257582 – 102Basic nuclear protein HPI1Add BLAST101
ChainiPRO_000002575922 – 102Basic nuclear protein HPI2Add BLAST81
ChainiPRO_000002576034 – 102Basic nuclear protein HPS1Add BLAST69
ChainiPRO_000002576137 – 102Basic nuclear protein HPS2Add BLAST66
ChainiPRO_000002576245 – 102Sperm histone HP4Add BLAST58
ChainiPRO_000002576346 – 102Sperm histone HP2Add BLAST57
ChainiPRO_000002576449 – 102Sperm histone HP3Add BLAST54

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei8PhosphoserineBy similarity1
Modified residuei10PhosphoserineBy similarity1
Modified residuei37PhosphoserineBy similarity1

Post-translational modificationi

Proteolytic processing into mature chains is required for histone eviction during spermatogenesis. Transition proteins (TNP1 and TNP2) are required for processing.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiP04554
PeptideAtlasiP04554
PRIDEiP04554
ProteomicsDBi51717

PTM databases

iPTMnetiP04554
PhosphoSitePlusiP04554

Expressioni

Tissue specificityi

Testis.

Gene expression databases

BgeeiENSG00000122304 Expressed in 85 organ(s), highest expression level in testis
CleanExiHS_PRM2
ExpressionAtlasiP04554 baseline and differential
GenevisibleiP04554 HS

Organism-specific databases

HPAiCAB032738
HPA056386

Interactioni

Subunit structurei

Interacts with TDRP.By similarity

Protein-protein interaction databases

BioGridi111605, 41 interactors
IntActiP04554, 5 interactors
STRINGi9606.ENSP00000241808

Structurei

3D structure databases

ProteinModelPortaliP04554
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the protamine P2 family.Curated

Phylogenomic databases

eggNOGiENOG410KFYE Eukaryota
ENOG4110SVE LUCA
GeneTreeiENSGT00730000111973
HOGENOMiHOG000143619
HOVERGENiHBG082177
InParanoidiP04554
OMAiHRRGCRT
OrthoDBiEOG091G15QZ
TreeFamiTF338206

Family and domain databases

InterProiView protein in InterPro
IPR000492 PRM2
PANTHERiPTHR21341 PTHR21341, 1 hit
PfamiView protein in Pfam
PF00841 Protamine_P2, 1 hit

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: P04554-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVRYRVRSLS ERSHEVYRQQ LHGQEQGHHG QEEQGLSPEH VEVYERTHGQ
60 70 80 90 100
SHYRRRHCSR RRLHRIHRRQ HRSCRRRKRR SCRHRRRHRR GCRTRKRTCR

RH
Length:102
Mass (Da):13,051
Last modified:November 1, 1990 - v3
Checksum:iCBB8D6F2396F2F9C
GO
Isoform 2 (identifier: P04554-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     91-102: GCRTRKRTCRRH → ESLGDPLNQNFLSQKAAEPGREHAEGTKLPGPLTPSWKLRKSRPKHQVRP

Note: No experimental confirmation available.
Show »
Length:140
Mass (Da):17,106
Checksum:i03F307A0349E84F7
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti38 – 39PE → RM in CAA30710 (PubMed:3412906).Curated2
Sequence conflicti52H → Q in CAA30710 (PubMed:3412906).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_05478691 – 102GCRTR…TCRRH → ESLGDPLNQNFLSQKAAEPG REHAEGTKLPGPLTPSWKLR KSRPKHQVRP in isoform 2. 1 PublicationAdd BLAST12

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X07862 mRNA Translation: CAA30710.1
M60332 Genomic DNA Translation: AAA63250.1
Z46940 Genomic DNA Translation: CAA87066.1
U15422 Genomic DNA Translation: AAC50487.1
AF215713 Genomic DNA Translation: AAF34632.1
AK131573 mRNA Translation: BAD18705.1
AC009121 Genomic DNA No translation available.
BC005303 mRNA Translation: AAH05303.1
BC066338 mRNA Translation: AAH66338.1
CCDSiCCDS42118.1 [P04554-1]
CCDS66944.1 [P04554-2]
PIRiB38515 HSHUP2
RefSeqiNP_001273285.1, NM_001286356.1 [P04554-2]
NP_001273287.1, NM_001286358.1
NP_001273288.1, NM_001286359.1
NP_002753.2, NM_002762.3 [P04554-1]
UniGeneiHs.2324

Genome annotation databases

EnsembliENST00000241808; ENSP00000241808; ENSG00000122304 [P04554-1]
ENST00000435245; ENSP00000403681; ENSG00000122304 [P04554-2]
GeneIDi5620
KEGGihsa:5620
UCSCiuc032drg.2 human [P04554-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X07862 mRNA Translation: CAA30710.1
M60332 Genomic DNA Translation: AAA63250.1
Z46940 Genomic DNA Translation: CAA87066.1
U15422 Genomic DNA Translation: AAC50487.1
AF215713 Genomic DNA Translation: AAF34632.1
AK131573 mRNA Translation: BAD18705.1
AC009121 Genomic DNA No translation available.
BC005303 mRNA Translation: AAH05303.1
BC066338 mRNA Translation: AAH66338.1
CCDSiCCDS42118.1 [P04554-1]
CCDS66944.1 [P04554-2]
PIRiB38515 HSHUP2
RefSeqiNP_001273285.1, NM_001286356.1 [P04554-2]
NP_001273287.1, NM_001286358.1
NP_001273288.1, NM_001286359.1
NP_002753.2, NM_002762.3 [P04554-1]
UniGeneiHs.2324

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2AWRmodel-B46-102[»]
ProteinModelPortaliP04554
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111605, 41 interactors
IntActiP04554, 5 interactors
STRINGi9606.ENSP00000241808

PTM databases

iPTMnetiP04554
PhosphoSitePlusiP04554

Polymorphism and mutation databases

DMDMi123700

Proteomic databases

PaxDbiP04554
PeptideAtlasiP04554
PRIDEiP04554
ProteomicsDBi51717

Protocols and materials databases

DNASUi5620
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000241808; ENSP00000241808; ENSG00000122304 [P04554-1]
ENST00000435245; ENSP00000403681; ENSG00000122304 [P04554-2]
GeneIDi5620
KEGGihsa:5620
UCSCiuc032drg.2 human [P04554-1]

Organism-specific databases

CTDi5620
DisGeNETi5620
EuPathDBiHostDB:ENSG00000122304.10
GeneCardsiPRM2
HGNCiHGNC:9448 PRM2
HPAiCAB032738
HPA056386
MIMi182882 gene
182890 gene
neXtProtiNX_P04554
OpenTargetsiENSG00000122304
PharmGKBiPA33793
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410KFYE Eukaryota
ENOG4110SVE LUCA
GeneTreeiENSGT00730000111973
HOGENOMiHOG000143619
HOVERGENiHBG082177
InParanoidiP04554
OMAiHRRGCRT
OrthoDBiEOG091G15QZ
TreeFamiTF338206

Miscellaneous databases

GenomeRNAii5620
PROiPR:P04554
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000122304 Expressed in 85 organ(s), highest expression level in testis
CleanExiHS_PRM2
ExpressionAtlasiP04554 baseline and differential
GenevisibleiP04554 HS

Family and domain databases

InterProiView protein in InterPro
IPR000492 PRM2
PANTHERiPTHR21341 PTHR21341, 1 hit
PfamiView protein in Pfam
PF00841 Protamine_P2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiPRM2_HUMAN
AccessioniPrimary (citable) accession number: P04554
Secondary accession number(s): Q6ZMM0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 13, 1987
Last sequence update: November 1, 1990
Last modified: November 7, 2018
This is version 155 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again