The new UniProt website is here!
Take me to UniProt BETA
UniProtKB - P04439 (HLAA_HUMAN)
(max 400 entries)
Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the 'basket' to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>
Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)
>sp|P04439|HLAA_HUMAN HLA class I histocompatibility antigen, A alpha chain OS=Homo sapiens OX=9606 GN=HLA-A PE=1 SV=2 MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRF DSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQ IMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQL RAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLT WQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEL SSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDSAQGSDVSL TACKVCommunity curation ()Add a publicationFeedback
Protein
HLA class I histocompatibility antigen, A alpha chain
Gene
HLA-A
Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:
Annotation score:5 out of 5
<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>Select a section on the left to see content.
<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni
Antigen-presenting major histocompatibility complex class I (MHCI) molecule. In complex with B2M/beta 2 microglobulin displays primarily viral and tumor-derived peptides on antigen-presenting cells for recognition by alpha-beta T cell receptor (TCR) on HLA-A-restricted CD8-positive T cells, guiding antigen-specific T cell immune response to eliminate infected or transformed cells (PubMed:2456340, PubMed:2784196, PubMed:1402688, PubMed:7504010, PubMed:9862734, PubMed:10449296, PubMed:12138174, PubMed:12393434, PubMed:15893615, PubMed:17189421, PubMed:19543285, PubMed:21498667, PubMed:24192765, PubMed:7694806, PubMed:24395804, PubMed:28250417).
May also present self-peptides derived from the signal sequence of secreted or membrane proteins, although T cells specific for these peptides are usually inactivated to prevent autoreactivity (PubMed:25880248, PubMed:7506728, PubMed:7679507).
Both the peptide and the MHC molecule are recognized by TCR, the peptide is responsible for the fine specificity of antigen recognition and MHC residues account for the MHC restriction of T cells (PubMed:12796775, PubMed:18275829, PubMed:19542454, PubMed:28250417).
Typically presents intracellular peptide antigens of 8 to 13 amino acids that arise from cytosolic proteolysis via IFNG-induced immunoproteasome or via endopeptidase IDE/insulin-degrading enzyme (PubMed:17189421, PubMed:20364150, PubMed:17079320, PubMed:26929325, PubMed:27049119).
Can bind different peptides containing allele-specific binding motifs, which are mainly defined by anchor residues at position 2 and 9 (PubMed:7504010, PubMed:9862734).
26 Publications<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.37"Analysis of the molecular basis of HLA-A3 recognition by cytotoxic T cells using defined mutants of the HLA-A3 molecule."
Jelachich M.L., Cowan E.P., Turner R.V., Coligan J.E., Biddison W.E.
J. Immunol. 141:1108-1113(1988) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*03:01), CHARACTERIZATION OF VARIANT VAL-176. - Ref.38"Polymorphism in the alpha 3 domain of HLA-A molecules affects binding to CD8."
Salter R.D., Norment A.M., Chen B.P., Clayberger C., Krensky A.M., Littman D.R., Parham P.
Nature 338:345-347(1989) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELES A*02:01 AND A*68:01), INTERACTION WITH CD8A, DOMAIN, CHARACTERIZATION OF VARIANT VAL-269. - Ref.39"A nonapeptide encoded by human gene MAGE-1 is recognized on HLA-A1 by cytolytic T lymphocytes directed against tumor antigen MZ2-E."
Traversari C., van der Bruggen P., Luescher I.F., Lurquin C., Chomez P., Van Pel A., De Plaen E., Amar-Costesec A., Boon T.
J. Exp. Med. 176:1453-1457(1992) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*01:01). - Ref.40"HLA-A1 and HLA-A3 T cell epitopes derived from influenza virus proteins predicted from peptide binding motifs."
DiBrino M., Tsuchida T., Turner R.V., Parker K.C., Coligan J.E., Biddison W.E.
J. Immunol. 151:5930-5935(1993) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELES A*01:01 AND A*03:01), INTERACTION WITH B2M AND PEPTIDE. - Ref.41"Endogenous peptides bound to HLA-A3 possess a specific combination of anchor residues that permit identification of potential antigenic peptides."
DiBrino M., Parker K.C., Shiloach J., Knierman M., Lukszo J., Turner R.V., Biddison W.E., Coligan J.E.
Proc. Natl. Acad. Sci. U.S.A. 90:1508-1512(1993) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*03:01), INTERACTION WITH B2M AND PEPTIDE. - Ref.42"Endogenous peptides with distinct amino acid anchor residue motifs bind to HLA-A1 and HLA-B8."
DiBrino M., Parker K.C., Shiloach J., Turner R.V., Tsuchida T., Garfield M., Biddison W.E., Coligan J.E.
J. Immunol. 152:620-631(1994) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*01:01), INTERACTION WITH B2M AND PEPTIDE. - Ref.47"Identification of new melanoma epitopes on melanosomal proteins recognized by tumor infiltrating T lymphocytes restricted by HLA-A1, -A2, and -A3 alleles."
Kawakami Y., Robbins P.F., Wang X., Tupesis J.P., Parkhurst M.R., Kang X., Sakaguchi K., Appella E., Rosenberg S.A.
J. Immunol. 161:6985-6992(1998) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*03:01). - Ref.48"HLA-A*1101-restricted cytotoxic T lymphocyte recognition of HIV-1 Pol protein."
Fukada K., Chujoh Y., Tomiyama H., Miwa K., Kaneko Y., Oka S., Takiguchi M.
AIDS 13:1413-1414(1999) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*11:01). - Ref.51"Differential presentation of a soluble exogenous tumor antigen, NY-ESO-1, by distinct human dendritic cell populations."
Nagata Y., Ono S., Matsuo M., Gnjatic S., Valmori D., Ritter G., Garrett W., Old L.J., Mellman I.
Proc. Natl. Acad. Sci. U.S.A. 99:10629-10634(2002) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*02:01). - Ref.52"Tetramer-assisted identification and characterization of epitopes recognized by HLA A*2402-restricted Epstein-Barr virus-specific CD8+ T cells."
Kuzushima K., Hayashi N., Kudoh A., Akatsuka Y., Tsujimura K., Morishima Y., Tsurumi T.
Blood 101:1460-1468(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*24:02). - Ref.53"Identification and characterization of HIV-1-specific CD8+ T cell epitopes presented by HLA-A*2601."
Satoh M., Takamiya Y., Oka S., Tokunaga K., Takiguchi M.
Vaccine 23:3783-3790(2005) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*26:01). - Ref.54"Identification of a highly immunogenic HLA-A*01-binding T cell epitope of WT1."
Asemissen A.M., Keilholz U., Tenzer S., Mueller M., Walter S., Stevanovic S., Schild H., Letsch A., Thiel E., Rammensee H.G., Scheibenbogen C.
Clin. Cancer Res. 12:7476-7482(2006) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*01:01). - Ref.56"Role of immunoproteasome catalytic subunits in the immune response to hepatitis B virus."
Robek M.D., Garcia M.L., Boyd B.S., Chisari F.V.
J. Virol. 81:483-491(2007) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*02:01). - Ref.60"Parallel detection of antigen-specific T-cell responses by multidimensional encoding of MHC multimers."
Hadrup S.R., Bakker A.H., Shu C.J., Andersen R.S., van Veluw J., Hombrink P., Castermans E., Thor Straten P., Blank C., Haanen J.B., Heemskerk M.H., Schumacher T.N.
Nat. Methods 6:520-526(2009) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*03:01). - Ref.61"Production of an antigenic peptide by insulin-degrading enzyme."
Parmentier N., Stroobant V., Colau D., de Diesbach P., Morel S., Chapiro J., van Endert P., Van den Eynde B.J.
Nat. Immunol. 11:449-454(2010) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*01:01). - Ref.64"HLA-A*7401-mediated control of HIV viremia is independent of its linkage disequilibrium with HLA-B*5703."
Matthews P.C., Adland E., Listgarten J., Leslie A., Mkhwanazi N., Carlson J.M., Harndahl M., Stryhn A., Payne R.P., Ogwu A., Huang K.H., Frater J., Paioni P., Kloverpris H., Jooste P., Goedhals D., van Vuuren C., Steyn D. , Riddell L., Chen F., Luzzi G., Balachandran T., Ndung'u T., Buus S., Carrington M., Shapiro R., Heckerman D., Goulder P.J.
J. Immunol. 186:5675-5686(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*74:01). - Ref.66"Structure of TCR and antigen complexes at an immunodominant CTL epitope in HIV-1 infection."
Shimizu A., Kawana-Tachikawa A., Yamagata A., Han C., Zhu D., Sato Y., Nakamura H., Koibuchi T., Carlson J., Martin E., Brumme C.J., Shi Y., Gao G.F., Brumme Z.L., Fukai S., Iwamoto A.
Sci. Rep. 3:3097-3097(2013) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*24:02). - Ref.69"A comprehensive analysis of peptides presented by HLA-A1."
Giam K., Ayala-Perez R., Illing P.T., Schittenhelm R.B., Croft N.P., Purcell A.W., Dudek N.L.
Tissue Antigens 85:492-496(2015) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*01:01), SUBCELLULAR LOCATION. - Ref.71"Immunoproteasome deficiency is a feature of non-small cell lung cancer with a mesenchymal phenotype and is associated with a poor outcome."
Tripathi S.C., Peters H.L., Taguchi A., Katayama H., Wang H., Momin A., Jolly M.K., Celiktas M., Rodriguez-Canales J., Liu H., Behrens C., Wistuba I.I., Ben-Jacob E., Levine H., Molldrem J.J., Hanash S.M., Ostrin E.J.
Proc. Natl. Acad. Sci. U.S.A. 113:E1555-E1564(2016) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*02:01). - Ref.72"Proteasomes generate spliced epitopes by two different mechanisms and as efficiently as non-spliced epitopes."
Ebstein F., Textoris-Taube K., Keller C., Golnik R., Vigneron N., Van den Eynde B.J., Schuler-Thurner B., Schadendorf D., Lorenz F.K., Uckert W., Urban S., Lehmann A., Albrecht-Koepke N., Janek K., Henklein P., Niewienda A., Kloetzel P.M., Mishto M.
Sci. Rep. 6:24032-24032(2016) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*03:01). - Ref.77"The antigenic identity of peptide-MHC complexes: a comparison of the conformations of five viral peptides presented by HLA-A2."
Madden D.R., Garboczi D.N., Wiley D.C.
Cell 75:693-708(1993) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.50 ANGSTROMS) OF 25-299 (ALLELE A*02:01) IN COMPLEX WITH B2M AND PEPTIDE, FUNCTION (ALLELE A*02:01), DISULFIDE BOND, DOMAIN. - Ref.82"A structural basis for immunodominant human T cell receptor recognition."
Stewart-Jones G.B.E., McMichael A.J., Bell J.I., Stuart D.I., Jones E.Y.
Nat. Immunol. 4:657-663(2003) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (1.40 ANGSTROMS) OF 25-300 (ALLELE A*02:01) IN COMPLEX WITH B2M AND PEPTIDE, INTERACTION WITH TCR, FUNCTION (ALLELE A*02:01). - Ref.84"The structural dynamics and energetics of an immunodominant T cell receptor are programmed by its Vbeta domain."
Ishizuka J., Stewart-Jones G.B., van der Merwe A., Bell J.I., McMichael A.J., Jones E.Y.
Immunity 28:171-182(2008) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (1.60 ANGSTROMS) OF 25-300 (ALLELE A*02:01) IN COMPLEX WITH B2M AND PEPTIDE, INTERACTION WITH TCR, FUNCTION (ALLELE A*02:01). - Ref.85"Structural bases for the affinity-driven selection of a public TCR against a dominant human cytomegalovirus epitope."
Gras S., Saulquin X., Reiser J.B., Debeaupuis E., Echasserieau K., Kissenpfennig A., Legoux F., Chouquet A., Le Gorrec M., Machillot P., Neveu B., Thielens N., Malissen B., Bonneville M., Housset D.
J. Immunol. 183:430-437(2009) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (1.60 ANGSTROMS) OF 25-298 (ALLELE A*02:01) IN COMPLEX WITH B2M AND PEPTIDE, FUNCTION (ALLELE A*02:01), DOMAIN. - Ref.92"Preexisting CD8+ T-cell immunity to the H7N9 influenza A virus varies across ethnicities."
Quinones-Parra S., Grant E., Loh L., Nguyen T.H., Campbell K.A., Tong S.Y., Miller A., Doherty P.C., Vijaykrishna D., Rossjohn J., Gras S., Kedzierska K.
Proc. Natl. Acad. Sci. U.S.A. 111:1049-1054(2014) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.00 ANGSTROMS) OF 25-308 (ALLELE A*01:01) IN COMPLEX WITH B2M AND PEPTIDE, FUNCTION (ALLELE A*01:01), DOMAIN. - Ref.94"Broad TCR repertoire and diverse structural solutions for recognition of an immunodominant CD8+ T cell epitope."
Song I., Gil A., Mishra R., Ghersi D., Selin L.K., Stern L.J.
Nat. Struct. Mol. Biol. 24:395-406(2017) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.06 ANGSTROMS) OF 25-299 (ALLELE A*02:01) IN COMPLEX WITH B2M AND PEPTIDE, FUNCTION (ALLELE A*02:01), DOMAIN, DISULFIDE BOND.
Allele A*01:01: Presents a restricted peptide repertoire including viral epitopes derived from IAV NP/nucleoprotein (CTELKLSDY), IAV PB1/polymerase basic protein 1 (VSDGGPNLY), HAdV-11 capsid L3/hexon protein (LTDLGQNLLY), SARS-CoV-2 3a/ORF3a (FTSDYYQLY) as well as tumor peptide antigens including MAGE1 (EADPTGHSY), MAGEA3 (EVDPIGHLY) and WT1 (TSEKRPFMCAY), all having in common a canonical motif with a negatively charged Asp or Glu residue at position 3 and a Tyr anchor residue at the C-terminus (PubMed:1402688, PubMed:7504010, PubMed:17189421, PubMed:20364150, PubMed:25880248, PubMed:30530481, PubMed:19177349, PubMed:24395804, PubMed:26758806, PubMed:32887977).
A number of HLA-A*01:01-restricted peptides carry a post-translational modification with oxidation and N-terminal acetylation being the most frequent (PubMed:25880248).
Fails to present highly immunogenic peptides from the EBV latent antigens (PubMed:18779413).
10 PublicationsManual assertion based on experiment ini
- Ref.39"A nonapeptide encoded by human gene MAGE-1 is recognized on HLA-A1 by cytolytic T lymphocytes directed against tumor antigen MZ2-E."
Traversari C., van der Bruggen P., Luescher I.F., Lurquin C., Chomez P., Van Pel A., De Plaen E., Amar-Costesec A., Boon T.
J. Exp. Med. 176:1453-1457(1992) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*01:01). - Ref.40"HLA-A1 and HLA-A3 T cell epitopes derived from influenza virus proteins predicted from peptide binding motifs."
DiBrino M., Tsuchida T., Turner R.V., Parker K.C., Coligan J.E., Biddison W.E.
J. Immunol. 151:5930-5935(1993) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELES A*01:01 AND A*03:01), INTERACTION WITH B2M AND PEPTIDE. - Ref.54"Identification of a highly immunogenic HLA-A*01-binding T cell epitope of WT1."
Asemissen A.M., Keilholz U., Tenzer S., Mueller M., Walter S., Stevanovic S., Schild H., Letsch A., Thiel E., Rammensee H.G., Scheibenbogen C.
Clin. Cancer Res. 12:7476-7482(2006) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*01:01). - Ref.58"A mechanism for the HLA-A*01-associated risk for EBV+ Hodgkin lymphoma and infectious mononucleosis."
Brennan R.M., Burrows S.R.
Blood 112:2589-2590(2008) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*01:01). - Ref.61"Production of an antigenic peptide by insulin-degrading enzyme."
Parmentier N., Stroobant V., Colau D., de Diesbach P., Morel S., Chapiro J., van Endert P., Van den Eynde B.J.
Nat. Immunol. 11:449-454(2010) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*01:01). - Ref.69"A comprehensive analysis of peptides presented by HLA-A1."
Giam K., Ayala-Perez R., Illing P.T., Schittenhelm R.B., Croft N.P., Purcell A.W., Dudek N.L.
Tissue Antigens 85:492-496(2015) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*01:01), SUBCELLULAR LOCATION. - Ref.73"Measuring Antiviral Capacity of T Cell Responses to Adenovirus."
Keib A., Mei Y.F., Cicin-Sain L., Busch D.H., Dennehy K.M.
J. Immunol. 202:618-624(2019) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*01:01). - Ref.86"Conformational changes within the HLA-A1:MAGE-A1 complex induced by binding of a recombinant antibody fragment with TCR-like specificity."
Kumar P., Vahedi-Faridi A., Saenger W., Ziegler A., Uchanska-Ziegler B.
Protein Sci. 18:37-49(2009) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (1.80 ANGSTROMS) OF 25-298 (ALLELE A*01:01) IN COMPLEX WITH B2M AND PEPTIDE, FUNCTION (ALLELE A*01:01), DOMAIN, DISULFIDE BOND. - Ref.92"Preexisting CD8+ T-cell immunity to the H7N9 influenza A virus varies across ethnicities."
Quinones-Parra S., Grant E., Loh L., Nguyen T.H., Campbell K.A., Tong S.Y., Miller A., Doherty P.C., Vijaykrishna D., Rossjohn J., Gras S., Kedzierska K.
Proc. Natl. Acad. Sci. U.S.A. 111:1049-1054(2014) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.00 ANGSTROMS) OF 25-308 (ALLELE A*01:01) IN COMPLEX WITH B2M AND PEPTIDE, FUNCTION (ALLELE A*01:01), DOMAIN. - Ref.93"Direct molecular mimicry enables off-target cardiovascular toxicity by an enhanced affinity TCR designed for cancer immunotherapy."
Raman M.C., Rizkallah P.J., Simmons R., Donnellan Z., Dukes J., Bossi G., Le Provost G.S., Todorov P., Baston E., Hickman E., Mahon T., Hassan N., Vuidepot A., Sami M., Cole D.K., Jakobsen B.K.
Sci. Rep. 6:18851-18851(2016) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.40 ANGSTROMS) OF 25-298 (ALLELE A*01:01) IN COMPLEX WITH B2M AND PEPTIDE, FUNCTION (ALLELE A*01:01), DOMAIN, DISULFIDE BOND.
Allele A*02:01: A major allele in human populations, presents immunodominant viral epitopes derived from IAV M/matrix protein 1 (GILGFVFTL), HIV-1 env (TLTSCNTSV), HIV-1 gag-pol (ILKEPVHGV), HTLV-1 Tax (LLFGYPVYV), HBV C/core antigen (FLPSDFFPS), HCMV UL83/pp65 (NLVPMVATV) as well as tumor peptide antigens including MAGEA4 (GVYDGREHTV), WT1 (RMFPNAPYL) and CTAG1A/NY-ESO-1 (SLLMWITQC), all having in common hydrophobic amino acids at position 2 and at the C-terminal anchors.
17 PublicationsManual assertion based on experiment ini
- Ref.38"Polymorphism in the alpha 3 domain of HLA-A molecules affects binding to CD8."
Salter R.D., Norment A.M., Chen B.P., Clayberger C., Krensky A.M., Littman D.R., Parham P.
Nature 338:345-347(1989) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELES A*02:01 AND A*68:01), INTERACTION WITH CD8A, DOMAIN, CHARACTERIZATION OF VARIANT VAL-269. - Ref.43"Point mutations in the alpha 2 domain of HLA-A2.1 define a functionally relevant interaction with TAP."
Lewis J.W., Neisig A., Neefjes J., Elliott T.
Curr. Biol. 6:873-883(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*02:01), MUTAGENESIS OF SER-156 AND THR-158, DOMAIN, INTERACTION WITH B2M, INTERACTION WITH TAP1-TAP2 COMPLEX, SUBCELLULAR LOCATION. - Ref.44"A point mutation in HLA-A*0201 results in failure to bind the TAP complex and to present virus-derived peptides to CTL."
Peace-Brewer A.L., Tussey L.G., Matsui M., Li G., Quinn D.G., Frelinger J.A.
Immunity 4:505-514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*02:01), INTERACTION WITH TAP1-TAP2 COMPLEX, MUTAGENESIS OF THR-158. - Ref.51"Differential presentation of a soluble exogenous tumor antigen, NY-ESO-1, by distinct human dendritic cell populations."
Nagata Y., Ono S., Matsuo M., Gnjatic S., Valmori D., Ritter G., Garrett W., Old L.J., Mellman I.
Proc. Natl. Acad. Sci. U.S.A. 99:10629-10634(2002) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*02:01). - Ref.56"Role of immunoproteasome catalytic subunits in the immune response to hepatitis B virus."
Robek M.D., Garcia M.L., Boyd B.S., Chisari F.V.
J. Virol. 81:483-491(2007) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*02:01). - Ref.71"Immunoproteasome deficiency is a feature of non-small cell lung cancer with a mesenchymal phenotype and is associated with a poor outcome."
Tripathi S.C., Peters H.L., Taguchi A., Katayama H., Wang H., Momin A., Jolly M.K., Celiktas M., Rodriguez-Canales J., Liu H., Behrens C., Wistuba I.I., Ben-Jacob E., Levine H., Molldrem J.J., Hanash S.M., Ostrin E.J.
Proc. Natl. Acad. Sci. U.S.A. 113:E1555-E1564(2016) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*02:01). - Ref.77"The antigenic identity of peptide-MHC complexes: a comparison of the conformations of five viral peptides presented by HLA-A2."
Madden D.R., Garboczi D.N., Wiley D.C.
Cell 75:693-708(1993) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.50 ANGSTROMS) OF 25-299 (ALLELE A*02:01) IN COMPLEX WITH B2M AND PEPTIDE, FUNCTION (ALLELE A*02:01), DISULFIDE BOND, DOMAIN. - Ref.78"Three-dimensional structure of a peptide extending from one end of a class I MHC binding site."
Collins E.J., Garboczi D.N., Wiley D.C.
Nature 371:626-629(1994) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.00 ANGSTROMS) OF 25-299 (ALLELE A*02:01) IN COMPLEX WITH B2M AND PEPTIDE, FUNCTION (ALLELE A*02:01). - Ref.79"Structure of the complex between human T-cell receptor, viral peptide and HLA-A2."
Garboczi D.N., Ghosh P., Utz U., Fan Q.R., Biddison W.E., Wiley D.C.
Nature 384:134-141(1996) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.60 ANGSTROMS) OF 25-299 (ALLELE A*02:01) IN COMPLEX WITH B2M AND PEPTIDE, FUNCTION (ALLELE A*02:01), DOMAIN. - Ref.80"Crystal structure of the complex between human CD8alpha(alpha) and HLA-A2."
Gao G.F., Tormo J., Gerth U.C., Wyer J.R., McMichael A.J., Stuart D.I., Bell J.I., Jones E.Y., Jakobsen B.K.
Nature 387:630-634(1997) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.65 ANGSTROMS) OF 25-300 (ALLELE A*02:01) IN COMPLEX WITH B2M AND PEPTIDE, INTERACTION WITH CD8A, FUNCTION (ALLELE A*02:01). - Ref.81"High-resolution structure of HLA-A*0201 in complex with a tumour-specific antigenic peptide encoded by the MAGE-A4 gene."
Hillig R.C., Coulie P.G., Stroobant V., Saenger W., Ziegler A., Hulsmeyer M.
J. Mol. Biol. 310:1167-1176(2001) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (1.40 ANGSTROMS) OF 25-299 (ALLELE A*02:01) IN COMPLEX WITH B2M AND PEPTIDE, FUNCTION (ALLELE A*02:01). - Ref.82"A structural basis for immunodominant human T cell receptor recognition."
Stewart-Jones G.B.E., McMichael A.J., Bell J.I., Stuart D.I., Jones E.Y.
Nat. Immunol. 4:657-663(2003) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (1.40 ANGSTROMS) OF 25-300 (ALLELE A*02:01) IN COMPLEX WITH B2M AND PEPTIDE, INTERACTION WITH TCR, FUNCTION (ALLELE A*02:01). - Ref.84"The structural dynamics and energetics of an immunodominant T cell receptor are programmed by its Vbeta domain."
Ishizuka J., Stewart-Jones G.B., van der Merwe A., Bell J.I., McMichael A.J., Jones E.Y.
Immunity 28:171-182(2008) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (1.60 ANGSTROMS) OF 25-300 (ALLELE A*02:01) IN COMPLEX WITH B2M AND PEPTIDE, INTERACTION WITH TCR, FUNCTION (ALLELE A*02:01). - Ref.85"Structural bases for the affinity-driven selection of a public TCR against a dominant human cytomegalovirus epitope."
Gras S., Saulquin X., Reiser J.B., Debeaupuis E., Echasserieau K., Kissenpfennig A., Legoux F., Chouquet A., Le Gorrec M., Machillot P., Neveu B., Thielens N., Malissen B., Bonneville M., Housset D.
J. Immunol. 183:430-437(2009) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (1.60 ANGSTROMS) OF 25-298 (ALLELE A*02:01) IN COMPLEX WITH B2M AND PEPTIDE, FUNCTION (ALLELE A*02:01), DOMAIN. - Ref.88"Structures of native and affinity-enhanced WT1 epitopes bound to HLA-A*0201: implications for WT1-based cancer therapeutics."
Borbulevych O.Y., Do P., Baker B.M.
Mol. Immunol. 47:2519-2524(2010) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (1.89 ANGSTROMS) OF 25-299 (ALLELE A*02:01) IN COMPLEX WITH B2M AND PEPTIDE, FUNCTION (ALLELE A*02:01), DOMAIN. - Ref.91"Structural basis for the killing of human beta cells by CD8(+) T cells in type 1 diabetes."
Bulek A.M., Cole D.K., Skowera A., Dolton G., Gras S., Madura F., Fuller A., Miles J.J., Gostick E., Price D.A., Drijfhout J.W., Knight R.R., Huang G.C., Lissin N., Molloy P.E., Wooldridge L., Jakobsen B.K., Rossjohn J. , Peakman M., Rizkallah P.J., Sewell A.K.
Nat. Immunol. 13:283-289(2012) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (1.67 ANGSTROMS) OF 25-300 (ALLELE A*02:01) IN COMPLEX WITH B2M AND PEPTIDE, INTERACTION WITH TCR, FUNCTION (ALLELE A*02:01), DOMAIN, INDUCTION BY CYTOKINES, INVOLVEMENT IN IDDM (ALLELE A*02:01). - Ref.94"Broad TCR repertoire and diverse structural solutions for recognition of an immunodominant CD8+ T cell epitope."
Song I., Gil A., Mishra R., Ghersi D., Selin L.K., Stern L.J.
Nat. Struct. Mol. Biol. 24:395-406(2017) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.06 ANGSTROMS) OF 25-299 (ALLELE A*02:01) IN COMPLEX WITH B2M AND PEPTIDE, FUNCTION (ALLELE A*02:01), DOMAIN, DISULFIDE BOND.
Allele A*03:01: Presents viral epitopes derived from IAV NP (ILRGSVAHK), HIV-1 nef (QVPLRPMTYK), HIV-1 gag-pol (AIFQSSMTK), SARS-CoV-2 N/nucleoprotein (KTFPPTEPK) as well as tumor peptide antigens including PMEL (LIYRRRLMK), NODAL (HAYIQSLLK), TRP-2 (RMYNMVPFF), all having in common hydrophobic amino acids at position 2 and Lys or Arg anchor residues at the C-terminus (PubMed:7504010, PubMed:7679507, PubMed:9862734, PubMed:19543285, PubMed:21943705, PubMed:2456340, PubMed:32887977).
May also display spliced peptides resulting from the ligation of two separate proteasomal cleavage products that are not contiguous in the parental protein (PubMed:27049119).
7 PublicationsManual assertion based on experiment ini
- Ref.37"Analysis of the molecular basis of HLA-A3 recognition by cytotoxic T cells using defined mutants of the HLA-A3 molecule."
Jelachich M.L., Cowan E.P., Turner R.V., Coligan J.E., Biddison W.E.
J. Immunol. 141:1108-1113(1988) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*03:01), CHARACTERIZATION OF VARIANT VAL-176. - Ref.40"HLA-A1 and HLA-A3 T cell epitopes derived from influenza virus proteins predicted from peptide binding motifs."
DiBrino M., Tsuchida T., Turner R.V., Parker K.C., Coligan J.E., Biddison W.E.
J. Immunol. 151:5930-5935(1993) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELES A*01:01 AND A*03:01), INTERACTION WITH B2M AND PEPTIDE. - Ref.41"Endogenous peptides bound to HLA-A3 possess a specific combination of anchor residues that permit identification of potential antigenic peptides."
DiBrino M., Parker K.C., Shiloach J., Knierman M., Lukszo J., Turner R.V., Biddison W.E., Coligan J.E.
Proc. Natl. Acad. Sci. U.S.A. 90:1508-1512(1993) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*03:01), INTERACTION WITH B2M AND PEPTIDE. - Ref.47"Identification of new melanoma epitopes on melanosomal proteins recognized by tumor infiltrating T lymphocytes restricted by HLA-A1, -A2, and -A3 alleles."
Kawakami Y., Robbins P.F., Wang X., Tupesis J.P., Parkhurst M.R., Kang X., Sakaguchi K., Appella E., Rosenberg S.A.
J. Immunol. 161:6985-6992(1998) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*03:01). - Ref.60"Parallel detection of antigen-specific T-cell responses by multidimensional encoding of MHC multimers."
Hadrup S.R., Bakker A.H., Shu C.J., Andersen R.S., van Veluw J., Hombrink P., Castermans E., Thor Straten P., Blank C., Haanen J.B., Heemskerk M.H., Schumacher T.N.
Nat. Methods 6:520-526(2009) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*03:01). - Ref.72"Proteasomes generate spliced epitopes by two different mechanisms and as efficiently as non-spliced epitopes."
Ebstein F., Textoris-Taube K., Keller C., Golnik R., Vigneron N., Van den Eynde B.J., Schuler-Thurner B., Schadendorf D., Lorenz F.K., Uckert W., Urban S., Lehmann A., Albrecht-Koepke N., Janek K., Henklein P., Niewienda A., Kloetzel P.M., Mishto M.
Sci. Rep. 6:24032-24032(2016) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*03:01). - Ref.90"Structural basis of cross-allele presentation by HLA-A*0301 and HLA-A*1101 revealed by two HIV-derived peptide complexes."
Zhang S., Liu J., Cheng H., Tan S., Qi J., Yan J., Gao G.F.
Mol. Immunol. 49:395-401(2011) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.00 ANGSTROMS) OF 25-298 (ALLELE A*03:01) IN COMPLEX WITH B2M AND PEPTIDE, DISULFIDE BOND, DOMAIN, FUNCTION (ALLELE A*03:01).
Allele A*11:01: Presents several immunodominant epitopes derived from HIV-1 gag-pol and HHV-4 EBNA4, containing the peptide motif with Val, Ile, Thr, Leu, Tyr or Phe at position 2 and Lys anchor residue at the C-terminus. Important in the control of HIV-1, EBV and HBV infections (PubMed:10449296).
Presents an immunodominant epitope derived from SARS-CoV-2 N/nucleoprotein (KTFPPTEPK) (PubMed:32887977).
2 PublicationsManual assertion based on experiment ini
- Ref.48"HLA-A*1101-restricted cytotoxic T lymphocyte recognition of HIV-1 Pol protein."
Fukada K., Chujoh Y., Tomiyama H., Miwa K., Kaneko Y., Oka S., Takiguchi M.
AIDS 13:1413-1414(1999) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*11:01). - Ref.74"Broad and strong memory CD4+ and CD8+ T cells induced by SARS-CoV-2 in UK convalescent individuals following COVID-19."
Oxford Immunology Network Covid-19 Response T cell Consortium, ISARIC4C Investigators
Peng Y., Mentzer A.J., Liu G., Yao X., Yin Z., Dong D., Dejnirattisai W., Rostron T., Supasa P., Liu C., Lopez-Camacho C., Slon-Campos J., Zhao Y., Stuart D.I., Paesen G.C., Grimes J.M., Antson A.A., Bayfield O.W. , Hawkins D.E.D.P., Ker D.S., Wang B., Turtle L., Subramaniam K., Thomson P., Zhang P., Dold C., Ratcliff J., Simmonds P., de Silva T., Sopp P., Wellington D., Rajapaksa U., Chen Y.L., Salio M., Napolitani G., Paes W., Borrow P., Kessler B.M., Fry J.W., Schwabe N.F., Semple M.G., Baillie J.K., Moore S.C., Openshaw P.J.M., Ansari M.A., Dunachie S., Barnes E., Frater J., Kerr G., Goulder P., Lockett T., Levin R., Zhang Y., Jing R., Ho L.P., Cornall R.J., Conlon C.P., Klenerman P., Screaton G.R., Mongkolsapaya J., McMichael A., Knight J.C., Ogg G., Dong T.
Nat. Immunol. 21:1336-1345(2020) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELES A*01:01; A*03:01 AND A*11:01).
Allele A*23:01: Interacts with natural killer (NK) cell receptor KIR3DL1 and may contribute to functional maturation of NK cells and self-nonself discrimination during innate immune response.
1 PublicationManual assertion based on experiment ini
- Ref.55"Cutting Edge: Allele-specific and peptide-dependent interactions between KIR3DL1 and HLA-A and HLA-B."
Thananchai H., Gillespie G., Martin M.P., Bashirova A., Yawata N., Yawata M., Easterbrook P., McVicar D.W., Maenaka K., Parham P., Carrington M., Dong T., Rowland-Jones S.
J. Immunol. 178:33-37(2007) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELES A*23:01; A*24:02 AND A*32:01), INTERACTION WITH KIR3DL1.
Allele A*24:02: Presents viral epitopes derived from HIV-1 nef (RYPLTFGWCF), EBV lytic- and latent-cycle antigens BRLF1 (TYPVLEEMF), BMLF1 (DYNFVKQLF) and LMP2 (IYVLVMLVL), SARS-CoV nucleocapsid/N (QFKDNVILL), as well as tumor peptide antigens including PRAME (LYVDSLFFL), all sharing a common signature motif, namely an aromatic residue Tyr or Phe at position 2 and a nonhydrophobic anchor residue Phe, Leu or Iso at the C-terminus (PubMed:9047241, PubMed:12393434, PubMed:24192765, PubMed:20844028).
Interacts with natural killer (NK) cell receptor KIR3DL1 and may contribute to functional maturation of NK cells and self-nonself discrimination during innate immune response (PubMed:17182537, PubMed:18502829).
6 PublicationsManual assertion based on experiment ini
- Ref.46"Characterization of an antigen that is recognized on a melanoma showing partial HLA loss by CTL expressing an NK inhibitory receptor."
Ikeda H., Lethe B.G., Lehmann F., van Baren N., Baurain J.-F., de Smet C., Chambost H., Vitale M., Moretta A., Boon T., Coulie P.G.
Immunity 6:199-208(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*24:02). - Ref.52"Tetramer-assisted identification and characterization of epitopes recognized by HLA A*2402-restricted Epstein-Barr virus-specific CD8+ T cells."
Kuzushima K., Hayashi N., Kudoh A., Akatsuka Y., Tsujimura K., Morishima Y., Tsurumi T.
Blood 101:1460-1468(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*24:02). - Ref.55"Cutting Edge: Allele-specific and peptide-dependent interactions between KIR3DL1 and HLA-A and HLA-B."
Thananchai H., Gillespie G., Martin M.P., Bashirova A., Yawata N., Yawata M., Easterbrook P., McVicar D.W., Maenaka K., Parham P., Carrington M., Dong T., Rowland-Jones S.
J. Immunol. 178:33-37(2007) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELES A*23:01; A*24:02 AND A*32:01), INTERACTION WITH KIR3DL1. - Ref.57"Human leukocyte antigens A23, A24, and A32 but not A25 are ligands for KIR3DL1."
Stern M., Ruggeri L., Capanni M., Mancusi A., Velardi A.
Blood 112:708-710(2008) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*24:02), INTERACTION WITH KIR3DL1. - Ref.66"Structure of TCR and antigen complexes at an immunodominant CTL epitope in HIV-1 infection."
Shimizu A., Kawana-Tachikawa A., Yamagata A., Han C., Zhu D., Sato Y., Nakamura H., Koibuchi T., Carlson J., Martin E., Brumme C.J., Shi Y., Gao G.F., Brumme Z.L., Fukai S., Iwamoto A.
Sci. Rep. 3:3097-3097(2013) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*24:02). - Ref.87"Novel immunodominant peptide presentation strategy: a featured HLA-A*2402-restricted cytotoxic T-lymphocyte epitope stabilized by intrachain hydrogen bonds from severe acute respiratory syndrome coronavirus nucleocapsid protein."
Liu J., Wu P., Gao F., Qi J., Kawana-Tachikawa A., Xie J., Vavricka C.J., Iwamoto A., Li T., Gao G.F.
J. Virol. 84:11849-11857(2010) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.4 ANGSTROMS) OF 25-298 (ALLELE A*24:02) IN COMPLEX WITH B2M AND WITH SARS NUCLEOCAPSID PEPTIDE, DISULFIDE BONDS, FUNCTION (ALLELE A*24:02), DOMAIN.
Allele A*26:01: Presents several epitopes derived from HIV-1 gag-pol (EVIPMFSAL, ETKLGKAGY) and env (LVSDGGPNLY), carrying as anchor residues preferentially Glu at position 1, Val or Thr at position 2 and Tyr at the C-terminus.
1 PublicationManual assertion based on experiment ini
- Ref.53"Identification and characterization of HIV-1-specific CD8+ T cell epitopes presented by HLA-A*2601."
Satoh M., Takamiya Y., Oka S., Tokunaga K., Takiguchi M.
Vaccine 23:3783-3790(2005) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*26:01).
Allele A*29:02: Presents peptides having a common motif, namely a Glu residue at position 2 and Tyr or Leu anchor residues at the C-terminus.
1 PublicationManual assertion based on experiment ini
- Ref.45"Definition of the HLA-A29 peptide ligand motif allows prediction of potential T-cell epitopes from the retinal soluble antigen, a candidate autoantigen in birdshot retinopathy."
Boisgerault F., Khalil I., Tieng V., Connan F., Tabary T., Cohen J.H., Choppin J., Charron D., Toubert A.
Proc. Natl. Acad. Sci. U.S.A. 93:3466-3470(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*29:02).
Allele A*32:01: Interacts with natural killer (NK) cell receptor KIR3DL1 and may contribute to functional maturation of NK cells and self-nonself discrimination during innate immune response.
1 PublicationManual assertion based on experiment ini
- Ref.55"Cutting Edge: Allele-specific and peptide-dependent interactions between KIR3DL1 and HLA-A and HLA-B."
Thananchai H., Gillespie G., Martin M.P., Bashirova A., Yawata N., Yawata M., Easterbrook P., McVicar D.W., Maenaka K., Parham P., Carrington M., Dong T., Rowland-Jones S.
J. Immunol. 178:33-37(2007) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELES A*23:01; A*24:02 AND A*32:01), INTERACTION WITH KIR3DL1.
Allele A*68:01: Presents viral epitopes derived from IAV NP (KTGGPIYKR) and HIV-1 tat (ITKGLGISYGR), having a common signature motif namely, Val or Thr at position 2 and positively charged residues Arg or Lys at the C-terminal anchor.
3 PublicationsManual assertion based on experiment ini
- Ref.38"Polymorphism in the alpha 3 domain of HLA-A molecules affects binding to CD8."
Salter R.D., Norment A.M., Chen B.P., Clayberger C., Krensky A.M., Littman D.R., Parham P.
Nature 338:345-347(1989) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELES A*02:01 AND A*68:01), INTERACTION WITH CD8A, DOMAIN, CHARACTERIZATION OF VARIANT VAL-269. - Ref.75"Different length peptides bind to HLA-Aw68 similarly at their ends but bulge out in the middle."
Guo H.-C., Jardetzky T.S., Garrett T.P.J., Lane W.S., Strominger J.L., Wiley D.C.
Nature 360:364-366(1992) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (1.9 ANGSTROMS) OF 25-294 (ALLELE A*68:01), FUNCTION (ALLELE A*68:01). - Ref.76"Atomic structure of a human MHC molecule presenting an influenza virus peptide."
Silver M.L., Guo H.-C., Strominger J.L., Wiley D.C.
Nature 360:367-369(1992) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (1.9 ANGSTROMS) OF 25-294 (ALLELE A*68:01), FUNCTION (ALLELE A*68:01).
Allele A*74:01: Presents immunodominant HIV-1 epitopes derived from gag-pol (GQMVHQAISPR, QIYPGIKVR) and rev (RQIHSISER), carrying an aliphatic residue at position 2 and Arg anchor residue at the C-terminus. May contribute to viral load control in chronic HIV-1 infection.
1 PublicationManual assertion based on experiment ini
- Ref.64"HLA-A*7401-mediated control of HIV viremia is independent of its linkage disequilibrium with HLA-B*5703."
Matthews P.C., Adland E., Listgarten J., Leslie A., Mkhwanazi N., Carlson J.M., Harndahl M., Stryhn A., Payne R.P., Ogwu A., Huang K.H., Frater J., Paioni P., Kloverpris H., Jooste P., Goedhals D., van Vuuren C., Steyn D. , Riddell L., Chen F., Luzzi G., Balachandran T., Ndung'u T., Buus S., Carrington M., Shapiro R., Heckerman D., Goulder P.J.
J. Immunol. 186:5675-5686(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*74:01).
Sites
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei | 31 | Peptide antigen; pathogen-derived peptide antigen1 Publication Manual assertion based on experiment ini
| 1 | |
| Binding sitei | 97 | Peptide antigen; pathogen-derived peptide antigen1 Publication Manual assertion based on experiment ini
| 1 | |
| Binding sitei | 108 | Peptide antigen; pathogen-derived peptide antigen1 Publication Manual assertion based on experiment ini
| 1 | |
| Binding sitei | 140 | Peptide antigen; self-peptide antigen1 Publication Manual assertion based on experiment ini
| 1 | |
| Binding sitei | 167 | Peptide antigen; pathogen-derived peptide antigen1 Publication Manual assertion based on experiment ini
| 1 | |
| Binding sitei | 170 | Peptide antigen; pathogen-derived peptide antigen1 Publication Manual assertion based on experiment ini
| 1 | |
| Binding sitei | 183 | Peptide antigen; self- and pathogen-derived peptide antigen2 Publications Manual assertion based on experiment ini
| 1 | |
| Binding sitei | 195 | Peptide antigen; pathogen-derived peptide antigen1 Publication Manual assertion based on experiment ini
| 1 |
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni
- beta-2-microglobulin binding Source: UniProtKB
<p>Inferred from Direct Assay</p>
<p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p>
<p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p>
Inferred from direct assayi
- "Structure of the human class I histocompatibility antigen, HLA-A2."
Bjorkman P.J., Saper M.A., Samraoui B., Bennett W.S., Strominger J.L., Wiley D.C.
Nature 329:506-512(1987) [PubMed] [Europe PMC] [Abstract] - Ref.77"The antigenic identity of peptide-MHC complexes: a comparison of the conformations of five viral peptides presented by HLA-A2."
Madden D.R., Garboczi D.N., Wiley D.C.
Cell 75:693-708(1993) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.50 ANGSTROMS) OF 25-299 (ALLELE A*02:01) IN COMPLEX WITH B2M AND PEPTIDE, FUNCTION (ALLELE A*02:01), DISULFIDE BOND, DOMAIN. - Ref.43"Point mutations in the alpha 2 domain of HLA-A2.1 define a functionally relevant interaction with TAP."
Lewis J.W., Neisig A., Neefjes J., Elliott T.
Curr. Biol. 6:873-883(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*02:01), MUTAGENESIS OF SER-156 AND THR-158, DOMAIN, INTERACTION WITH B2M, INTERACTION WITH TAP1-TAP2 COMPLEX, SUBCELLULAR LOCATION. - Ref.79"Structure of the complex between human T-cell receptor, viral peptide and HLA-A2."
Garboczi D.N., Ghosh P., Utz U., Fan Q.R., Biddison W.E., Wiley D.C.
Nature 384:134-141(1996) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.60 ANGSTROMS) OF 25-299 (ALLELE A*02:01) IN COMPLEX WITH B2M AND PEPTIDE, FUNCTION (ALLELE A*02:01), DOMAIN.
- CD8 receptor binding Source: UniProtKBInferred from direct assayi
- Ref.38"Polymorphism in the alpha 3 domain of HLA-A molecules affects binding to CD8."
Salter R.D., Norment A.M., Chen B.P., Clayberger C., Krensky A.M., Littman D.R., Parham P.
Nature 338:345-347(1989) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELES A*02:01 AND A*68:01), INTERACTION WITH CD8A, DOMAIN, CHARACTERIZATION OF VARIANT VAL-269.
- peptide antigen binding Source: UniProtKBInferred from direct assayi
- "Four A6-TCR/peptide/HLA-A2 structures that generate very different T cell signals are nearly identical."
Ding Y.H., Baker B.M., Garboczi D.N., Biddison W.E., Wiley D.C.
Immunity 11:45-56(1999) [PubMed] [Europe PMC] [Abstract] - Ref.39"A nonapeptide encoded by human gene MAGE-1 is recognized on HLA-A1 by cytolytic T lymphocytes directed against tumor antigen MZ2-E."
Traversari C., van der Bruggen P., Luescher I.F., Lurquin C., Chomez P., Van Pel A., De Plaen E., Amar-Costesec A., Boon T.
J. Exp. Med. 176:1453-1457(1992) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*01:01). - Ref.54"Identification of a highly immunogenic HLA-A*01-binding T cell epitope of WT1."
Asemissen A.M., Keilholz U., Tenzer S., Mueller M., Walter S., Stevanovic S., Schild H., Letsch A., Thiel E., Rammensee H.G., Scheibenbogen C.
Clin. Cancer Res. 12:7476-7482(2006) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*01:01). - Ref.61"Production of an antigenic peptide by insulin-degrading enzyme."
Parmentier N., Stroobant V., Colau D., de Diesbach P., Morel S., Chapiro J., van Endert P., Van den Eynde B.J.
Nat. Immunol. 11:449-454(2010) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*01:01). - "Multiple viral ligands naturally presented by different class I molecules in transporter antigen processing-deficient vaccinia virus-infected cells."
Lorente E., Infantes S., Barnea E., Beer I., Garcia R., Lasala F., Jimenez M., Vilches C., Lemonnier F.A., Admon A., Lopez D.
J Virol 86:527-541(2012) [PubMed] [Europe PMC] [Abstract] - "Human CD8 T lymphocytes recognize Mycobacterium tuberculosis antigens presented by HLA-E during active tuberculosis and express type 2 cytokines."
Caccamo N., Pietra G., Sullivan L.C., Brooks A.G., Prezzemolo T., La Manna M.P., Di Liberto D., Joosten S.A., van Meijgaarden K.E., Di Carlo P., Titone L., Moretta L., Mingari M.C., Ottenhoff T.H., Dieli F.
Eur J Immunol 45:1069-1081(2015) [PubMed] [Europe PMC] [Abstract] - Ref.40"HLA-A1 and HLA-A3 T cell epitopes derived from influenza virus proteins predicted from peptide binding motifs."
DiBrino M., Tsuchida T., Turner R.V., Parker K.C., Coligan J.E., Biddison W.E.
J. Immunol. 151:5930-5935(1993) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELES A*01:01 AND A*03:01), INTERACTION WITH B2M AND PEPTIDE. - Ref.77"The antigenic identity of peptide-MHC complexes: a comparison of the conformations of five viral peptides presented by HLA-A2."
Madden D.R., Garboczi D.N., Wiley D.C.
Cell 75:693-708(1993) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.50 ANGSTROMS) OF 25-299 (ALLELE A*02:01) IN COMPLEX WITH B2M AND PEPTIDE, FUNCTION (ALLELE A*02:01), DISULFIDE BOND, DOMAIN. - Ref.43"Point mutations in the alpha 2 domain of HLA-A2.1 define a functionally relevant interaction with TAP."
Lewis J.W., Neisig A., Neefjes J., Elliott T.
Curr. Biol. 6:873-883(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*02:01), MUTAGENESIS OF SER-156 AND THR-158, DOMAIN, INTERACTION WITH B2M, INTERACTION WITH TAP1-TAP2 COMPLEX, SUBCELLULAR LOCATION. - "HLA-A11-mediated protection from NK cell-mediated lysis: role of HLA-A11-presented peptides."
Gavioli R., Zhang Q.J., Masucci M.G.
Hum Immunol 49:1-12(1996) [PubMed] [Europe PMC] [Abstract] - Ref.79"Structure of the complex between human T-cell receptor, viral peptide and HLA-A2."
Garboczi D.N., Ghosh P., Utz U., Fan Q.R., Biddison W.E., Wiley D.C.
Nature 384:134-141(1996) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.60 ANGSTROMS) OF 25-299 (ALLELE A*02:01) IN COMPLEX WITH B2M AND PEPTIDE, FUNCTION (ALLELE A*02:01), DOMAIN. - "Assembly, specific binding, and crystallization of a human TCR-alphabeta with an antigenic Tax peptide from human T lymphotropic virus type 1 and the class I MHC molecule HLA-A2."
Garboczi D.N., Utz U., Ghosh P., Seth A., Kim J., VanTienhoven E.A., Biddison W.E., Wiley D.C.
J. Immunol. 157:5403-5410(1996) [PubMed] [Europe PMC] [Abstract] - Ref.80"Crystal structure of the complex between human CD8alpha(alpha) and HLA-A2."
Gao G.F., Tormo J., Gerth U.C., Wyer J.R., McMichael A.J., Stuart D.I., Bell J.I., Jones E.Y., Jakobsen B.K.
Nature 387:630-634(1997) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.65 ANGSTROMS) OF 25-300 (ALLELE A*02:01) IN COMPLEX WITH B2M AND PEPTIDE, INTERACTION WITH CD8A, FUNCTION (ALLELE A*02:01).
- RNA binding Source: UniProtKBInferred from high throughput direct assayi
- "Insights into RNA biology from an atlas of mammalian mRNA-binding proteins."
Castello A., Fischer B., Eichelbaum K., Horos R., Beckmann B.M., Strein C., Davey N.E., Humphreys D.T., Preiss T., Steinmetz L.M., Krijgsveld J., Hentze M.W.
Cell 149:1393-1406(2012) [PubMed] [Europe PMC] [Abstract]
- signaling receptor binding Source: BHF-UCL
<p>Inferred from Physical Interaction</p>
<p>Covers physical interactions between the gene product of interest and another molecule (or ion, or complex).</p>
<p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ipi">GO evidence code guide</a></p>
Inferred from physical interactioni
- "Ig-like transcript 4 inhibits lipid antigen presentation through direct CD1d interaction."
Li D., Wang L., Yu L., Freundt E.C., Jin B., Screaton G.R., Xu X.N.
J Immunol 182:1033-1040(2009) [PubMed] [Europe PMC] [Abstract]
- TAP binding Source: UniProtKBInferred from direct assayi
- "Allele-specific differences in the interaction of MHC class I molecules with transporters associated with antigen processing."
Neisig A., Wubbolts R., Zang X., Melief C., Neefjes J.
J Immunol 156:3196-3206(1996) [PubMed] [Europe PMC] [Abstract] - Ref.43"Point mutations in the alpha 2 domain of HLA-A2.1 define a functionally relevant interaction with TAP."
Lewis J.W., Neisig A., Neefjes J., Elliott T.
Curr. Biol. 6:873-883(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*02:01), MUTAGENESIS OF SER-156 AND THR-158, DOMAIN, INTERACTION WITH B2M, INTERACTION WITH TAP1-TAP2 COMPLEX, SUBCELLULAR LOCATION.
- TAP complex binding Source: UniProtKBInferred from direct assayi
- Ref.44"A point mutation in HLA-A*0201 results in failure to bind the TAP complex and to present virus-derived peptides to CTL."
Peace-Brewer A.L., Tussey L.G., Matsui M., Li G., Quinn D.G., Frelinger J.A.
Immunity 4:505-514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*02:01), INTERACTION WITH TAP1-TAP2 COMPLEX, MUTAGENESIS OF THR-158.
- T cell receptor binding Source: UniProtKBInferred from direct assayi
- "Four A6-TCR/peptide/HLA-A2 structures that generate very different T cell signals are nearly identical."
Ding Y.H., Baker B.M., Garboczi D.N., Biddison W.E., Wiley D.C.
Immunity 11:45-56(1999) [PubMed] [Europe PMC] [Abstract] - Ref.79"Structure of the complex between human T-cell receptor, viral peptide and HLA-A2."
Garboczi D.N., Ghosh P., Utz U., Fan Q.R., Biddison W.E., Wiley D.C.
Nature 384:134-141(1996) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.60 ANGSTROMS) OF 25-299 (ALLELE A*02:01) IN COMPLEX WITH B2M AND PEPTIDE, FUNCTION (ALLELE A*02:01), DOMAIN. - "Assembly, specific binding, and crystallization of a human TCR-alphabeta with an antigenic Tax peptide from human T lymphotropic virus type 1 and the class I MHC molecule HLA-A2."
Garboczi D.N., Utz U., Ghosh P., Seth A., Kim J., VanTienhoven E.A., Biddison W.E., Wiley D.C.
J. Immunol. 157:5403-5410(1996) [PubMed] [Europe PMC] [Abstract]
GO - Biological processi
- antibacterial humoral response Source: UniProtKBInferred from direct assayi
- "Human CD8 T lymphocytes recognize Mycobacterium tuberculosis antigens presented by HLA-E during active tuberculosis and express type 2 cytokines."
Caccamo N., Pietra G., Sullivan L.C., Brooks A.G., Prezzemolo T., La Manna M.P., Di Liberto D., Joosten S.A., van Meijgaarden K.E., Di Carlo P., Titone L., Moretta L., Mingari M.C., Ottenhoff T.H., Dieli F.
Eur J Immunol 45:1069-1081(2015) [PubMed] [Europe PMC] [Abstract]
- antigen processing and presentation of endogenous peptide antigen via MHC class I Source: UniProtKBInferred from direct assayi
- Ref.39"A nonapeptide encoded by human gene MAGE-1 is recognized on HLA-A1 by cytolytic T lymphocytes directed against tumor antigen MZ2-E."
Traversari C., van der Bruggen P., Luescher I.F., Lurquin C., Chomez P., Van Pel A., De Plaen E., Amar-Costesec A., Boon T.
J. Exp. Med. 176:1453-1457(1992) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*01:01). - Ref.61"Production of an antigenic peptide by insulin-degrading enzyme."
Parmentier N., Stroobant V., Colau D., de Diesbach P., Morel S., Chapiro J., van Endert P., Van den Eynde B.J.
Nat. Immunol. 11:449-454(2010) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*01:01).
- antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-dependent Source: UniProtKB
<p>Inferred from Mutant Phenotype</p>
<p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p>
<p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p>
Inferred from mutant phenotypei
- Ref.44"A point mutation in HLA-A*0201 results in failure to bind the TAP complex and to present virus-derived peptides to CTL."
Peace-Brewer A.L., Tussey L.G., Matsui M., Li G., Quinn D.G., Frelinger J.A.
Immunity 4:505-514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*02:01), INTERACTION WITH TAP1-TAP2 COMPLEX, MUTAGENESIS OF THR-158.
- antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-independent Source: UniProtKBInferred from direct assayi
- "Multiple viral ligands naturally presented by different class I molecules in transporter antigen processing-deficient vaccinia virus-infected cells."
Lorente E., Infantes S., Barnea E., Beer I., Garcia R., Lasala F., Jimenez M., Vilches C., Lemonnier F.A., Admon A., Lopez D.
J Virol 86:527-541(2012) [PubMed] [Europe PMC] [Abstract]
- antigen processing and presentation of exogenous peptide antigen via MHC class I Source: UniProtKBInferred from direct assayi
- Ref.51"Differential presentation of a soluble exogenous tumor antigen, NY-ESO-1, by distinct human dendritic cell populations."
Nagata Y., Ono S., Matsuo M., Gnjatic S., Valmori D., Ritter G., Garrett W., Old L.J., Mellman I.
Proc. Natl. Acad. Sci. U.S.A. 99:10629-10634(2002) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*02:01). - Ref.40"HLA-A1 and HLA-A3 T cell epitopes derived from influenza virus proteins predicted from peptide binding motifs."
DiBrino M., Tsuchida T., Turner R.V., Parker K.C., Coligan J.E., Biddison W.E.
J. Immunol. 151:5930-5935(1993) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELES A*01:01 AND A*03:01), INTERACTION WITH B2M AND PEPTIDE.
- CD8-positive, alpha-beta T cell activation Source: UniProtKBInferred from direct assayi
- Ref.51"Differential presentation of a soluble exogenous tumor antigen, NY-ESO-1, by distinct human dendritic cell populations."
Nagata Y., Ono S., Matsuo M., Gnjatic S., Valmori D., Ritter G., Garrett W., Old L.J., Mellman I.
Proc. Natl. Acad. Sci. U.S.A. 99:10629-10634(2002) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*02:01). - Ref.39"A nonapeptide encoded by human gene MAGE-1 is recognized on HLA-A1 by cytolytic T lymphocytes directed against tumor antigen MZ2-E."
Traversari C., van der Bruggen P., Luescher I.F., Lurquin C., Chomez P., Van Pel A., De Plaen E., Amar-Costesec A., Boon T.
J. Exp. Med. 176:1453-1457(1992) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*01:01). - Ref.54"Identification of a highly immunogenic HLA-A*01-binding T cell epitope of WT1."
Asemissen A.M., Keilholz U., Tenzer S., Mueller M., Walter S., Stevanovic S., Schild H., Letsch A., Thiel E., Rammensee H.G., Scheibenbogen C.
Clin. Cancer Res. 12:7476-7482(2006) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*01:01). - Ref.61"Production of an antigenic peptide by insulin-degrading enzyme."
Parmentier N., Stroobant V., Colau D., de Diesbach P., Morel S., Chapiro J., van Endert P., Van den Eynde B.J.
Nat. Immunol. 11:449-454(2010) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*01:01). - Ref.38"Polymorphism in the alpha 3 domain of HLA-A molecules affects binding to CD8."
Salter R.D., Norment A.M., Chen B.P., Clayberger C., Krensky A.M., Littman D.R., Parham P.
Nature 338:345-347(1989) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELES A*02:01 AND A*68:01), INTERACTION WITH CD8A, DOMAIN, CHARACTERIZATION OF VARIANT VAL-269. - Ref.40"HLA-A1 and HLA-A3 T cell epitopes derived from influenza virus proteins predicted from peptide binding motifs."
DiBrino M., Tsuchida T., Turner R.V., Parker K.C., Coligan J.E., Biddison W.E.
J. Immunol. 151:5930-5935(1993) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELES A*01:01 AND A*03:01), INTERACTION WITH B2M AND PEPTIDE. - Ref.44"A point mutation in HLA-A*0201 results in failure to bind the TAP complex and to present virus-derived peptides to CTL."
Peace-Brewer A.L., Tussey L.G., Matsui M., Li G., Quinn D.G., Frelinger J.A.
Immunity 4:505-514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*02:01), INTERACTION WITH TAP1-TAP2 COMPLEX, MUTAGENESIS OF THR-158.
- defense response to Gram-positive bacterium Source: UniProtKBInferred from direct assayi
- "Human CD8 T lymphocytes recognize Mycobacterium tuberculosis antigens presented by HLA-E during active tuberculosis and express type 2 cytokines."
Caccamo N., Pietra G., Sullivan L.C., Brooks A.G., Prezzemolo T., La Manna M.P., Di Liberto D., Joosten S.A., van Meijgaarden K.E., Di Carlo P., Titone L., Moretta L., Mingari M.C., Ottenhoff T.H., Dieli F.
Eur J Immunol 45:1069-1081(2015) [PubMed] [Europe PMC] [Abstract]
- detection of bacterium Source: UniProtKBInferred from mutant phenotypei
- "HLA molecules and nasal carriage of Staphylococcus aureus isolated from dialysis and kidney transplant patients at a hospital in Southern Brazil."
Giarola L.B., Dos Santos R.R., Bedendo J., da Silva Junior W.V., Borelli S.D.
BMC Res Notes 5:90-90(2012) [PubMed] [Europe PMC] [Abstract]
- immune response Source: UniProtKBInferred from mutant phenotypei
- "HLA molecules and nasal carriage of Staphylococcus aureus isolated from dialysis and kidney transplant patients at a hospital in Southern Brazil."
Giarola L.B., Dos Santos R.R., Bedendo J., da Silva Junior W.V., Borelli S.D.
BMC Res Notes 5:90-90(2012) [PubMed] [Europe PMC] [Abstract]
- innate immune response Source: UniProtKB-KW
- positive regulation of CD8-positive, alpha-beta T cell activation Source: BHF-UCLInferred from direct assayi
- "The WT hemochromatosis protein HFE inhibits CD8⁺ T-lymphocyte activation."
Reuben A., Phenix M., Santos M.M., Lapointe R.
Eur J Immunol 44:1604-1614(2014) [PubMed] [Europe PMC] [Abstract]
- positive regulation of CD8-positive, alpha-beta T cell proliferation Source: UniProtKBInferred from direct assayi
- "Human CD8 T lymphocytes recognize Mycobacterium tuberculosis antigens presented by HLA-E during active tuberculosis and express type 2 cytokines."
Caccamo N., Pietra G., Sullivan L.C., Brooks A.G., Prezzemolo T., La Manna M.P., Di Liberto D., Joosten S.A., van Meijgaarden K.E., Di Carlo P., Titone L., Moretta L., Mingari M.C., Ottenhoff T.H., Dieli F.
Eur J Immunol 45:1069-1081(2015) [PubMed] [Europe PMC] [Abstract]
- positive regulation of interferon-gamma production Source: UniProtKBInferred from direct assayi
- "Multiple viral ligands naturally presented by different class I molecules in transporter antigen processing-deficient vaccinia virus-infected cells."
Lorente E., Infantes S., Barnea E., Beer I., Garcia R., Lasala F., Jimenez M., Vilches C., Lemonnier F.A., Admon A., Lopez D.
J Virol 86:527-541(2012) [PubMed] [Europe PMC] [Abstract]
- positive regulation of memory T cell activation Source: UniProtKBInferred from direct assayi
- "Multiple viral ligands naturally presented by different class I molecules in transporter antigen processing-deficient vaccinia virus-infected cells."
Lorente E., Infantes S., Barnea E., Beer I., Garcia R., Lasala F., Jimenez M., Vilches C., Lemonnier F.A., Admon A., Lopez D.
J Virol 86:527-541(2012) [PubMed] [Europe PMC] [Abstract]
- positive regulation of T cell cytokine production Source: BHF-UCLInferred from direct assayi
- "The WT hemochromatosis protein HFE inhibits CD8⁺ T-lymphocyte activation."
Reuben A., Phenix M., Santos M.M., Lapointe R.
Eur J Immunol 44:1604-1614(2014) [PubMed] [Europe PMC] [Abstract]
- positive regulation of T cell mediated cytotoxicity Source: UniProtKBInferred from direct assayi
- "Multiple viral ligands naturally presented by different class I molecules in transporter antigen processing-deficient vaccinia virus-infected cells."
Lorente E., Infantes S., Barnea E., Beer I., Garcia R., Lasala F., Jimenez M., Vilches C., Lemonnier F.A., Admon A., Lopez D.
J Virol 86:527-541(2012) [PubMed] [Europe PMC] [Abstract] - "The epitopes of influenza nucleoprotein recognized by cytotoxic T lymphocytes can be defined with short synthetic peptides."
Townsend A.R., Rothbard J., Gotch F.M., Bahadur G., Wraith D., McMichael A.J.
Cell 44:959-968(1986) [PubMed] [Europe PMC] [Abstract] - "Human CD8 T lymphocytes recognize Mycobacterium tuberculosis antigens presented by HLA-E during active tuberculosis and express type 2 cytokines."
Caccamo N., Pietra G., Sullivan L.C., Brooks A.G., Prezzemolo T., La Manna M.P., Di Liberto D., Joosten S.A., van Meijgaarden K.E., Di Carlo P., Titone L., Moretta L., Mingari M.C., Ottenhoff T.H., Dieli F.
Eur J Immunol 45:1069-1081(2015) [PubMed] [Europe PMC] [Abstract] - Ref.43"Point mutations in the alpha 2 domain of HLA-A2.1 define a functionally relevant interaction with TAP."
Lewis J.W., Neisig A., Neefjes J., Elliott T.
Curr. Biol. 6:873-883(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*02:01), MUTAGENESIS OF SER-156 AND THR-158, DOMAIN, INTERACTION WITH B2M, INTERACTION WITH TAP1-TAP2 COMPLEX, SUBCELLULAR LOCATION.
- protection from natural killer cell mediated cytotoxicity Source: UniProtKBInferred from direct assayi
- Ref.57"Human leukocyte antigens A23, A24, and A32 but not A25 are ligands for KIR3DL1."
Stern M., Ruggeri L., Capanni M., Mancusi A., Velardi A.
Blood 112:708-710(2008) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*24:02), INTERACTION WITH KIR3DL1. - "HLA-A11-mediated protection from NK cell-mediated lysis: role of HLA-A11-presented peptides."
Gavioli R., Zhang Q.J., Masucci M.G.
Hum Immunol 49:1-12(1996) [PubMed] [Europe PMC] [Abstract]
- T cell mediated cytotoxicity Source: UniProtKBInferred from direct assayi
- Ref.40"HLA-A1 and HLA-A3 T cell epitopes derived from influenza virus proteins predicted from peptide binding motifs."
DiBrino M., Tsuchida T., Turner R.V., Parker K.C., Coligan J.E., Biddison W.E.
J. Immunol. 151:5930-5935(1993) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELES A*01:01 AND A*03:01), INTERACTION WITH B2M AND PEPTIDE.
- T cell mediated cytotoxicity directed against tumor cell target Source: UniProtKBInferred from direct assayi
- Ref.39"A nonapeptide encoded by human gene MAGE-1 is recognized on HLA-A1 by cytolytic T lymphocytes directed against tumor antigen MZ2-E."
Traversari C., van der Bruggen P., Luescher I.F., Lurquin C., Chomez P., Van Pel A., De Plaen E., Amar-Costesec A., Boon T.
J. Exp. Med. 176:1453-1457(1992) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*01:01). - Ref.54"Identification of a highly immunogenic HLA-A*01-binding T cell epitope of WT1."
Asemissen A.M., Keilholz U., Tenzer S., Mueller M., Walter S., Stevanovic S., Schild H., Letsch A., Thiel E., Rammensee H.G., Scheibenbogen C.
Clin. Cancer Res. 12:7476-7482(2006) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*01:01). - Ref.61"Production of an antigenic peptide by insulin-degrading enzyme."
Parmentier N., Stroobant V., Colau D., de Diesbach P., Morel S., Chapiro J., van Endert P., Van den Eynde B.J.
Nat. Immunol. 11:449-454(2010) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*01:01).
- T cell receptor signaling pathway Source: UniProtKBInferred from direct assayi
- "Four A6-TCR/peptide/HLA-A2 structures that generate very different T cell signals are nearly identical."
Ding Y.H., Baker B.M., Garboczi D.N., Biddison W.E., Wiley D.C.
Immunity 11:45-56(1999) [PubMed] [Europe PMC] [Abstract]
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi
| Biological process | Adaptive immunity, Host-virus interaction, Immunity, Innate immunity |
Enzyme and pathway databases
Pathway Commons web resource for biological pathway data More...PathwayCommonsi | P04439 |
Reactome - a knowledgebase of biological pathways and processes More...Reactomei | R-HSA-1236974, ER-Phagosome pathway R-HSA-1236977, Endosomal/Vacuolar pathway R-HSA-164940, Nef mediated downregulation of MHC class I complex cell surface expression R-HSA-198933, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell R-HSA-6798695, Neutrophil degranulation R-HSA-877300, Interferon gamma signaling R-HSA-8866654, E3 ubiquitin ligases ubiquitinate target proteins R-HSA-909733, Interferon alpha/beta signaling R-HSA-983170, Antigen Presentation: Folding, assembly and peptide loading of class I MHC |
Protein family/group databases
Transport Classification Database More...TCDBi | 9.A.75.1.2, the mhc ii receptor (mhc2r) family |
<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi | Recommended name: HLA class I histocompatibility antigen, A alpha chainAlternative name(s): Human leukocyte antigen A Short name: HLA-A |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi | |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>Organismi | Homo sapiens (Human) |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri | 9606 [NCBI] |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineagei | cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi |
|
Organism-specific databases
Human Gene Nomenclature Database More...HGNCi | HGNC:4931, HLA-A |
Online Mendelian Inheritance in Man (OMIM) More...MIMi | 142800, gene |
neXtProt; the human protein knowledge platform More...neXtProti | NX_P04439 |
Eukaryotic Pathogen, Vector and Host Database Resources More...VEuPathDBi | HostDB:ENSG00000206503 |
<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi
Endoplasmic reticulum
- Endoplasmic reticulum membrane 1 Publication
<p>Manually curated information which has been inferred by a curator based on his/her scientific knowledge or on the scientific content of an article.</p> <p><a href="/manual/evidences#ECO:0000305">More...</a></p> Manual assertion inferred by curator fromi
- Ref.43"Point mutations in the alpha 2 domain of HLA-A2.1 define a functionally relevant interaction with TAP."
Lewis J.W., Neisig A., Neefjes J., Elliott T.
Curr. Biol. 6:873-883(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*02:01), MUTAGENESIS OF SER-156 AND THR-158, DOMAIN, INTERACTION WITH B2M, INTERACTION WITH TAP1-TAP2 COMPLEX, SUBCELLULAR LOCATION.
- Endoplasmic reticulum membrane 1 Publication
Plasma membrane
- Cell membrane 3 Publications
Manual assertion based on experiment ini
- Ref.43"Point mutations in the alpha 2 domain of HLA-A2.1 define a functionally relevant interaction with TAP."
Lewis J.W., Neisig A., Neefjes J., Elliott T.
Curr. Biol. 6:873-883(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*02:01), MUTAGENESIS OF SER-156 AND THR-158, DOMAIN, INTERACTION WITH B2M, INTERACTION WITH TAP1-TAP2 COMPLEX, SUBCELLULAR LOCATION. - Ref.63"Distinct functions for the glycans of tapasin and heavy chains in the assembly of MHC class I molecules."
Rizvi S.M., Del Cid N., Lybarger L., Raghavan M.
J. Immunol. 186:2309-2320(2011) [PubMed] [Europe PMC] [Abstract]Cited for: INDUCTION BY IFNG, GLYCOSYLATION AT ASN-110, MUTAGENESIS OF ASN-110, SUBCELLULAR LOCATION, INTERACTION WITH TAPBP. - Ref.69"A comprehensive analysis of peptides presented by HLA-A1."
Giam K., Ayala-Perez R., Illing P.T., Schittenhelm R.B., Croft N.P., Purcell A.W., Dudek N.L.
Tissue Antigens 85:492-496(2015) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*01:01), SUBCELLULAR LOCATION.
- Cell membrane 3 Publications
Endoplasmic reticulum
- endoplasmic reticulum Source: UniProtKBInferred from direct assayi
- "Receptor-mediated ER export of human MHC class I molecules is regulated by the C-terminal single amino acid."
Cho S., Ryoo J., Jun Y., Ahn K.
Traffic 12:42-55(2011) [PubMed] [Europe PMC] [Abstract] - Ref.43"Point mutations in the alpha 2 domain of HLA-A2.1 define a functionally relevant interaction with TAP."
Lewis J.W., Neisig A., Neefjes J., Elliott T.
Curr. Biol. 6:873-883(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*02:01), MUTAGENESIS OF SER-156 AND THR-158, DOMAIN, INTERACTION WITH B2M, INTERACTION WITH TAP1-TAP2 COMPLEX, SUBCELLULAR LOCATION.
- endoplasmic reticulum exit site Source: UniProtKBInferred from direct assayi
- "Receptor-mediated ER export of human MHC class I molecules is regulated by the C-terminal single amino acid."
Cho S., Ryoo J., Jun Y., Ahn K.
Traffic 12:42-55(2011) [PubMed] [Europe PMC] [Abstract]
- endoplasmic reticulum membrane Source: Reactome
- integral component of lumenal side of endoplasmic reticulum membrane Source: Reactome
- MHC class I peptide loading complex Source: UniProtKBInferred from direct assayi
- Ref.63"Distinct functions for the glycans of tapasin and heavy chains in the assembly of MHC class I molecules."
Rizvi S.M., Del Cid N., Lybarger L., Raghavan M.
J. Immunol. 186:2309-2320(2011) [PubMed] [Europe PMC] [Abstract]Cited for: INDUCTION BY IFNG, GLYCOSYLATION AT ASN-110, MUTAGENESIS OF ASN-110, SUBCELLULAR LOCATION, INTERACTION WITH TAPBP.
- endoplasmic reticulum Source: UniProtKBInferred from direct assayi
Endosome
- early endosome membrane Source: Reactome
- recycling endosome membrane Source: Reactome
Extracellular region or secreted
- extracellular exosome Source: UniProtKBInferred from high throughput direct assayi
- "Intestinal epithelial cells secrete exosome-like vesicles."
van Niel G., Raposo G., Candalh C., Boussac M., Hershberg R., Cerf-Bensussan N., Heyman M.
Gastroenterology 121:337-349(2001) [PubMed] [Europe PMC] [Abstract] - "Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT)."
Gonzalez-Begne M., Lu B., Han X., Hagen F.K., Hand A.R., Melvin J.E., Yates J.R.
J Proteome Res 8:1304-1314(2009) [PubMed] [Europe PMC] [Abstract] - "MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis."
Buschow S.I., van Balkom B.W., Aalberts M., Heck A.J., Wauben M., Stoorvogel W.
Immunol Cell Biol 88:851-856(2010) [PubMed] [Europe PMC] [Abstract]
- extracellular exosome Source: UniProtKBInferred from high throughput direct assayi
Golgi apparatus
- Golgi apparatus Source: UniProtKBInferred from direct assayi
- "Receptor-mediated ER export of human MHC class I molecules is regulated by the C-terminal single amino acid."
Cho S., Ryoo J., Jun Y., Ahn K.
Traffic 12:42-55(2011) [PubMed] [Europe PMC] [Abstract]
- Golgi medial cisterna Source: UniProtKBInferred from direct assayi
- Ref.43"Point mutations in the alpha 2 domain of HLA-A2.1 define a functionally relevant interaction with TAP."
Lewis J.W., Neisig A., Neefjes J., Elliott T.
Curr. Biol. 6:873-883(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*02:01), MUTAGENESIS OF SER-156 AND THR-158, DOMAIN, INTERACTION WITH B2M, INTERACTION WITH TAP1-TAP2 COMPLEX, SUBCELLULAR LOCATION.
- Golgi membrane Source: Reactome
- Golgi apparatus Source: UniProtKBInferred from direct assayi
Plasma Membrane
- integral component of plasma membrane Source: UniProtKB
<p>Non-traceable Author Statement</p>
<p>Used for statements in the abstract, introduction or discussion of a paper that cannot be traced back to another publication.</p>
<p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#nas">GO evidence code guide</a></p>
Non-traceable author statementi
- Ref.10"Distinctive HLA-A,B antigens of black populations formed by interallelic conversion."
Madrigal J.A., Belich M.P., Hildebrand W.H., Benjamin R.J., Little A.-M., Zemmour J., Ennis P.D., Ward F.E., Petzl-Erler M.L., Martell R.W., du Toit E.D., Parham P.
J. Immunol. 149:3411-3415(1992) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ALLELES A*34:01; A*36:01; A*43:01; A*66:01 AND A*74:01). - Ref.22"DNA sequence of HLA-A11: remarkable homology with HLA-A3 allows identification of residues involved in epitopes recognized by antibodies and T cells."
Cowan E.P., Jelachich M.L., Biddison W.E., Coligan J.E.
Immunogenetics 25:241-250(1987) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 26-365 (ALLELE A*11:01). - Ref.5"Molecular analysis of the serologically defined HLA-Aw19 antigens. A genetically distinct family of HLA-A antigens comprising A29, A31, A32, and Aw33, but probably not A30."
Kato K., Trapani J.A., Allopenna J., Dupont B., Yang S.Y.
J. Immunol. 143:3371-3378(1989) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ALLELES A*30:01; A*31:01 AND A*33:01). - Ref.6"Diversity and diversification of HLA-A,B,C alleles."
Parham P., Lawlor D.A., Lomen C.E., Ennis P.D.
J. Immunol. 142:3937-3950(1989) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ALLELE A*01:01). - Ref.19"Complete nucleotide sequence of a functional class I HLA gene, HLA-A3: implications for the evolution of HLA genes."
Strachan T., Sodoyer R., Damotte M., Jordan B.R.
EMBO J. 3:887-894(1984) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ALLELE A*03:01). - Ref.15"Characterization of a new and highly distinguishable HLA-A allele in a Spanish family."
Balas A., Garcia-Sanchez F., Gomez-Reino F., Vicario J.L.
Immunogenetics 39:452-452(1994) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ALLELE A*80:01).
- MHC class I protein complex Source: UniProtKBInferred from direct assayi
- "Multiple viral ligands naturally presented by different class I molecules in transporter antigen processing-deficient vaccinia virus-infected cells."
Lorente E., Infantes S., Barnea E., Beer I., Garcia R., Lasala F., Jimenez M., Vilches C., Lemonnier F.A., Admon A., Lopez D.
J Virol 86:527-541(2012) [PubMed] [Europe PMC] [Abstract] - "Human CD8 T lymphocytes recognize Mycobacterium tuberculosis antigens presented by HLA-E during active tuberculosis and express type 2 cytokines."
Caccamo N., Pietra G., Sullivan L.C., Brooks A.G., Prezzemolo T., La Manna M.P., Di Liberto D., Joosten S.A., van Meijgaarden K.E., Di Carlo P., Titone L., Moretta L., Mingari M.C., Ottenhoff T.H., Dieli F.
Eur J Immunol 45:1069-1081(2015) [PubMed] [Europe PMC] [Abstract] - Ref.77"The antigenic identity of peptide-MHC complexes: a comparison of the conformations of five viral peptides presented by HLA-A2."
Madden D.R., Garboczi D.N., Wiley D.C.
Cell 75:693-708(1993) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.50 ANGSTROMS) OF 25-299 (ALLELE A*02:01) IN COMPLEX WITH B2M AND PEPTIDE, FUNCTION (ALLELE A*02:01), DISULFIDE BOND, DOMAIN. - Ref.43"Point mutations in the alpha 2 domain of HLA-A2.1 define a functionally relevant interaction with TAP."
Lewis J.W., Neisig A., Neefjes J., Elliott T.
Curr. Biol. 6:873-883(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*02:01), MUTAGENESIS OF SER-156 AND THR-158, DOMAIN, INTERACTION WITH B2M, INTERACTION WITH TAP1-TAP2 COMPLEX, SUBCELLULAR LOCATION. - Ref.79"Structure of the complex between human T-cell receptor, viral peptide and HLA-A2."
Garboczi D.N., Ghosh P., Utz U., Fan Q.R., Biddison W.E., Wiley D.C.
Nature 384:134-141(1996) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.60 ANGSTROMS) OF 25-299 (ALLELE A*02:01) IN COMPLEX WITH B2M AND PEPTIDE, FUNCTION (ALLELE A*02:01), DOMAIN.
- plasma membrane Source: UniProtKBInferred from direct assayi
- Ref.38"Polymorphism in the alpha 3 domain of HLA-A molecules affects binding to CD8."
Salter R.D., Norment A.M., Chen B.P., Clayberger C., Krensky A.M., Littman D.R., Parham P.
Nature 338:345-347(1989) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELES A*02:01 AND A*68:01), INTERACTION WITH CD8A, DOMAIN, CHARACTERIZATION OF VARIANT VAL-269. - Ref.44"A point mutation in HLA-A*0201 results in failure to bind the TAP complex and to present virus-derived peptides to CTL."
Peace-Brewer A.L., Tussey L.G., Matsui M., Li G., Quinn D.G., Frelinger J.A.
Immunity 4:505-514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*02:01), INTERACTION WITH TAP1-TAP2 COMPLEX, MUTAGENESIS OF THR-158.
- integral component of plasma membrane Source: UniProtKB
<p>Non-traceable Author Statement</p>
<p>Used for statements in the abstract, introduction or discussion of a paper that cannot be traced back to another publication.</p>
<p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#nas">GO evidence code guide</a></p>
Non-traceable author statementi
Other locations
- cell surface Source: UniProtKBInferred from direct assayi
- "Multiple viral ligands naturally presented by different class I molecules in transporter antigen processing-deficient vaccinia virus-infected cells."
Lorente E., Infantes S., Barnea E., Beer I., Garcia R., Lasala F., Jimenez M., Vilches C., Lemonnier F.A., Admon A., Lopez D.
J Virol 86:527-541(2012) [PubMed] [Europe PMC] [Abstract] - Ref.43"Point mutations in the alpha 2 domain of HLA-A2.1 define a functionally relevant interaction with TAP."
Lewis J.W., Neisig A., Neefjes J., Elliott T.
Curr. Biol. 6:873-883(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*02:01), MUTAGENESIS OF SER-156 AND THR-158, DOMAIN, INTERACTION WITH B2M, INTERACTION WITH TAP1-TAP2 COMPLEX, SUBCELLULAR LOCATION. - "HLA-A11-mediated protection from NK cell-mediated lysis: role of HLA-A11-presented peptides."
Gavioli R., Zhang Q.J., Masucci M.G.
Hum Immunol 49:1-12(1996) [PubMed] [Europe PMC] [Abstract]
- ER to Golgi transport vesicle membrane Source: Reactome
- membrane Source: UniProtKBInferred from high throughput direct assayi
- "Defining the membrane proteome of NK cells."
Ghosh D., Lippert D., Krokhin O., Cortens J.P., Wilkins J.A.
J Mass Spectrom 45:1-25(2010) [PubMed] [Europe PMC] [Abstract]
- phagocytic vesicle membrane Source: Reactome
- cell surface Source: UniProtKBInferred from direct assayi
Topology
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini | 25 – 308 | ExtracellularSequence analysisAdd BLAST | 284 | |
| <p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei | 309 – 332 | HelicalSequence analysisAdd BLAST | 24 | |
| Topological domaini | 333 – 365 | CytoplasmicSequence analysisAdd BLAST | 33 |
Keywords - Cellular componenti
Cell membrane, Endoplasmic reticulum, Membrane, MHC I<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi
<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei
Alleles A*02:01 and A*24:02 are associated with increased susceptibility to diabetes mellitus, insulin-dependent (IDDM) (PubMed:22245737, PubMed:18802479, PubMed:16731854, PubMed:22522618). In a glucose-dependent way, allele A*02:01 may aberrantly present the signal peptide of preproinsulin (ALWGPDPAAA) on the surface of pancreatic beta cells to autoreactive CD8-positive T cells, potentially driving T-cell mediated cytotoxicity in pancreatic islets (PubMed:22245737, PubMed:18802479). Allele A*24:02 may present the signal peptide of preproinsulin (LWMRLLPLL) and contribute to acute pancreatic beta-cell destruction and early onset of IDDM (PubMed:16731854, PubMed:22522618).4 Publications
Manual assertion based on experiment ini
- Ref.91"Structural basis for the killing of human beta cells by CD8(+) T cells in type 1 diabetes."
Bulek A.M., Cole D.K., Skowera A., Dolton G., Gras S., Madura F., Fuller A., Miles J.J., Gostick E., Price D.A., Drijfhout J.W., Knight R.R., Huang G.C., Lissin N., Molloy P.E., Wooldridge L., Jakobsen B.K., Rossjohn J. , Peakman M., Rizkallah P.J., Sewell A.K.
Nat. Immunol. 13:283-289(2012) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (1.67 ANGSTROMS) OF 25-300 (ALLELE A*02:01) IN COMPLEX WITH B2M AND PEPTIDE, INTERACTION WITH TCR, FUNCTION (ALLELE A*02:01), DOMAIN, INDUCTION BY CYTOKINES, INVOLVEMENT IN IDDM (ALLELE A*02:01). - Ref.97"Combination of HLA-A24, -DQA1*03, and -DR9 contributes to acute-onset and early complete beta-cell destruction in type 1 diabetes: longitudinal study of residual beta-cell function."
Nakanishi K., Inoko H.
Diabetes 55:1862-1868(2006) [PubMed] [Europe PMC] [Abstract]Cited for: ASSOCIATION OF ALLELE A*24:02 WITH IDDM. - Ref.98"CTLs are targeted to kill beta cells in patients with type 1 diabetes through recognition of a glucose-regulated preproinsulin epitope."
Skowera A., Ellis R.J., Varela-Calvino R., Arif S., Huang G.C., Van-Krinks C., Zaremba A., Rackham C., Allen J.S., Tree T.I., Zhao M., Dayan C.M., Sewell A.K., Unger W.W., Unger W., Drijfhout J.W., Ossendorp F., Roep B.O., Peakman M.
J. Clin. Invest. 118:3390-3402(2008) [PubMed] [Europe PMC] [Abstract]Cited for: ASSOCIATION OF ALLELE A*02:01 WITH IDDM. - Ref.100"Circulating preproinsulin signal peptide-specific CD8 T cells restricted by the susceptibility molecule HLA-A24 are expanded at onset of type 1 diabetes and kill beta-cells."
Kronenberg D., Knight R.R., Estorninho M., Ellis R.J., Kester M.G., de Ru A., Eichmann M., Huang G.C., Powrie J., Dayan C.M., Skowera A., van Veelen P.A., Peakman M.
Diabetes 61:1752-1759(2012) [PubMed] [Europe PMC] [Abstract]Cited for: ASSOCIATION OF ALLELE A*24:02 WITH IDDM.
Allele A*03:01 is associated with increased susceptibility to multiple sclerosis (MS), an autoimmune disease of the central nervous system (PubMed:10746785). May contribute to the initiation phase of the disease by presenting myelin PLP1 self-peptide (KLIETYFSK) to autoreactive CD8-positive T cells capable of initiating the first autoimmune attacks (PubMed:18953350).2 Publications
Manual assertion based on experiment ini
- Ref.96"Multiple sclerosis: a modifying influence of HLA class I genes in an HLA class II associated autoimmune disease."
Fogdell-Hahn A., Ligers A., Groenning M., Hillert J., Olerup O.
Tissue Antigens 55:140-148(2000) [PubMed] [Europe PMC] [Abstract]Cited for: ASSOCIATION OF ALLELE A*03:01 WITH MULTIPLE SCLEROSIS. - Ref.99"Opposing effects of HLA class I molecules in tuning autoreactive CD8+ T cells in multiple sclerosis."
Friese M.A., Jakobsen K.B., Friis L., Etzensperger R., Craner M.J., McMahon R.M., Jensen L.T., Huygelen V., Jones E.Y., Bell J.I., Fugger L.
Nat. Med. 14:1227-1235(2008) [PubMed] [Europe PMC] [Abstract]Cited for: ASSOCIATION OF ALLELE A*03:01 WITH MULTIPLE SCLEROSIS.
Allele A*26:01 is associated with increased susceptibility to Behcet disease (BD) in the Northeast Asian population. Especially in the HLA-B*51-negative BD populations, HLA-A*26 is significantly associated with the onset of BD.1 Publication
Manual assertion based on experiment ini
- Ref.102"The association analysis between HLA-A*26 and Behcet's disease."
Nakamura J., Meguro A., Ishii G., Mihara T., Takeuchi M., Mizuki Y., Yuda K., Yamane T., Kawagoe T., Ota M., Mizuki N.
Sci. Rep. 9:4426-4426(2019) [PubMed] [Europe PMC] [Abstract]Cited for: ASSOCIATION OF ALLELE A*26:01 WITH BEHCET DISEASE.
Allele A*29:02 is associated with increased susceptibility to birdshot chorioretinopathy (BSCR). May aberrantly present retinal autoantigens and induce autoimmune uveitis.1 Publication
Manual assertion based on experiment ini
- Ref.95"HLA-A29.2 subtype associated with birdshot retinochoroidopathy."
LeHoang P., Ozdemir N., Benhamou A., Tabary T., Edelson C., Betuel H., Semiglia R., Cohen J.H.
Am. J. Ophthalmol. 113:33-35(1992) [PubMed] [Europe PMC] [Abstract]Cited for: ASSOCIATION OF ALLELE A*29:02 WITH BIRDSHOT CHORIORETINOPATHY.
Mutagenesis
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi | 110 | N → Q: Impairs the recruitment of HLA-A*02 in the peptide-loading complex. 1 Publication Manual assertion based on experiment ini
| 1 | |
| Mutagenesisi | 156 | S → C: Impairs the maturation of a peptide-receptive HLA-A*02-B2M complex. 1 Publication Manual assertion based on experiment ini
| 1 | |
| Mutagenesisi | 158 | T → K: Impairs binding to TAP1-TAP2 transporter, resulting in impaired presentation of intracellular peptides. 2 Publications Manual assertion based on experiment ini
| 1 |
Organism-specific databases
DisGeNET More...DisGeNETi | 3105 |
MalaCards human disease database More...MalaCardsi | HLA-A |
| MIMi | 126200, phenotype 222100, phenotype |
Open Targets More...OpenTargetsi | ENSG00000206503 |
Orphanet; a database dedicated to information on rare diseases and orphan drugs More...Orphaneti | 179, Birdshot chorioretinopathy 414750, Phenytoin or carbamazepine toxicity |
The Pharmacogenetics and Pharmacogenomics Knowledge Base More...PharmGKBi | PA35055 |
Miscellaneous databases
Pharos NIH Druggable Genome Knowledgebase More...Pharosi | P04439, Tbio |
Chemistry databases
ChEMBL database of bioactive drug-like small molecules More...ChEMBLi | CHEMBL2632 |
Drug and drug target database More...DrugBanki | DB02740, 3-Indolebutyric Acid DB11294, Coccidioides immitis spherule DB06226, Nelipepimut-S |
<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi
Molecule processing
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei | 1 – 24 | 1 Publication Manual assertion based on experiment ini
| 24 | |
| <p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_0000018815 | 25 – 365 | HLA class I histocompatibility antigen, A alpha chainAdd BLAST | 341 |
Amino acid modifications
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei | 83 | SulfotyrosineSequence analysis | 1 | |
| <p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi | 110 | N-linked (GlcNAc...) asparagine1 Publication Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi | 125 ↔ 188 | PROSITE-ProRule annotation <p>Manual validated information which has been generated by the UniProtKB automatic annotation system.</p> <p><a href="/manual/evidences#ECO:0000255">More...</a></p> Manual assertion according to rulesi 8 PublicationsManual assertion based on experiment ini
| ||
| Disulfide bondi | 227 ↔ 283 | PROSITE-ProRule annotation Manual assertion according to rulesi 8 PublicationsManual assertion based on experiment ini
| ||
| Modified residuei | 343 | PhosphoserineCombined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0007744">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei
| 1 | |
| Modified residuei | 344 | PhosphotyrosineCombined sources Manual assertion inferred from combination of experimental and computational evidencei
| 1 | |
| Modified residuei | 349 | PhosphoserineCombined sources Manual assertion inferred from combination of experimental and computational evidencei
| 1 | |
| Modified residuei | 350 | PhosphoserineCombined sources Manual assertion inferred from combination of experimental and computational evidencei
| 1 | |
| Modified residuei | 352 | PhosphoserineCombined sources Manual assertion inferred from combination of experimental and computational evidencei
| 1 | |
| Modified residuei | 356 | PhosphoserineCombined sources Manual assertion inferred from combination of experimental and computational evidencei
| 1 | |
| Modified residuei | 359 | PhosphoserineCombined sources Manual assertion inferred from combination of experimental and computational evidencei
| 1 |
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi
(Microbial infection) Polyubiquitinated in a post ER compartment by interaction with human herpesvirus 8 MIR1 protein. This targets the protein for rapid degradation via the ubiquitin system.1 Publication
Manual assertion based on experiment ini
- Ref.50"Ubiquitylation of MHC class I by the K3 viral protein signals internalization and TSG101-dependent degradation."
Hewitt E.W., Duncan L., Mufti D., Baker J., Stevenson P.G., Lehner P.J.
EMBO J. 21:2418-2429(2002) [PubMed] [Europe PMC] [Abstract]Cited for: INTERACTION WITH HUMAN HERPESVIRUS 8 MIR1 PROTEIN (MICROBIAL INFECTION), UBIQUITINATION (MICROBIAL INFECTION).
N-linked glycosylation at Asn-110.2 Publications
Manual assertion based on experiment ini
- Ref.59"Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry."
Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.
J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract]Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-110. - Ref.63"Distinct functions for the glycans of tapasin and heavy chains in the assembly of MHC class I molecules."
Rizvi S.M., Del Cid N., Lybarger L., Raghavan M.
J. Immunol. 186:2309-2320(2011) [PubMed] [Europe PMC] [Abstract]Cited for: INDUCTION BY IFNG, GLYCOSYLATION AT ASN-110, MUTAGENESIS OF ASN-110, SUBCELLULAR LOCATION, INTERACTION WITH TAPBP.
Keywords - PTMi
Disulfide bond, Glycoprotein, Phosphoprotein, Sulfation, Ubl conjugationProteomic databases
Encyclopedia of Proteome Dynamics More...EPDi | P04439 |
jPOST - Japan Proteome Standard Repository/Database More...jPOSTi | P04439 |
MassIVE - Mass Spectrometry Interactive Virtual Environment More...MassIVEi | P04439 |
MaxQB - The MaxQuant DataBase More...MaxQBi | P04439 |
PaxDb, a database of protein abundance averages across all three domains of life More...PaxDbi | P04439 |
PeptideAtlas More...PeptideAtlasi | P04439 |
PRoteomics IDEntifications database More...PRIDEi | P04439 |
ProteomicsDB: a multi-organism proteome resource More...ProteomicsDBi | 51505 51506 51714 51843 52596 52597 52979 52980 53320 53321 53322 53564 54669 54670 54671 54672 54673 54674 54675 54676 54707 58716 |
PTM databases
GlyConnect protein glycosylation platform More...GlyConnecti | 1315, 3 N-Linked glycans (1 site) 1316, 3 N-Linked glycans (1 site) 1317, 4 N-Linked glycans (1 site) 1318, 1 N-Linked glycan (1 site) 1319, 3 N-Linked glycans (1 site) 1320, 3 N-Linked glycans (1 site) 1321, 1 N-Linked glycan (1 site) 1322, 1 N-Linked glycan (1 site) 1323, 4 N-Linked glycans (1 site) 1324, 3 N-Linked glycans (1 site) 1325, 4 N-Linked glycans (1 site) 1326, 4 N-Linked glycans (1 site) 1327, 1 N-Linked glycan (1 site) 1328, 3 N-Linked glycans (1 site) 1329, 1 N-Linked glycan (1 site) |
GlyGen: Computational and Informatics Resources for Glycoscience More...GlyGeni | P04439, 2 sites, 2 N-linked glycans (1 site), 1 O-linked glycan (1 site) |
iPTMnet integrated resource for PTMs in systems biology context More...iPTMneti | P04439 |
Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat. More...PhosphoSitePlusi | P04439 |
SwissPalm database of S-palmitoylation events More...SwissPalmi | P04439 |
<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni
<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi
Ubiquitous.Curated
<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni
Up-regulated by IFNG, and proinflammatory cytokines IL1B and TNF.2 Publications
Manual assertion based on experiment ini
- Ref.63"Distinct functions for the glycans of tapasin and heavy chains in the assembly of MHC class I molecules."
Rizvi S.M., Del Cid N., Lybarger L., Raghavan M.
J. Immunol. 186:2309-2320(2011) [PubMed] [Europe PMC] [Abstract]Cited for: INDUCTION BY IFNG, GLYCOSYLATION AT ASN-110, MUTAGENESIS OF ASN-110, SUBCELLULAR LOCATION, INTERACTION WITH TAPBP. - Ref.91"Structural basis for the killing of human beta cells by CD8(+) T cells in type 1 diabetes."
Bulek A.M., Cole D.K., Skowera A., Dolton G., Gras S., Madura F., Fuller A., Miles J.J., Gostick E., Price D.A., Drijfhout J.W., Knight R.R., Huang G.C., Lissin N., Molloy P.E., Wooldridge L., Jakobsen B.K., Rossjohn J. , Peakman M., Rizkallah P.J., Sewell A.K.
Nat. Immunol. 13:283-289(2012) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (1.67 ANGSTROMS) OF 25-300 (ALLELE A*02:01) IN COMPLEX WITH B2M AND PEPTIDE, INTERACTION WITH TCR, FUNCTION (ALLELE A*02:01), DOMAIN, INDUCTION BY CYTOKINES, INVOLVEMENT IN IDDM (ALLELE A*02:01).
Gene expression databases
Bgee dataBase for Gene Expression Evolution More...Bgeei | ENSG00000206503, Expressed in mononuclear cell and 252 other tissues |
ExpressionAtlas, Differential and Baseline Expression More...ExpressionAtlasi | P04439, baseline and differential |
Organism-specific databases
Human Protein Atlas More...HPAi | ENSG00000206503, Low tissue specificity |
<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni
<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei
Heterotrimer that consists of an alpha chain HLA-A, a beta chain B2M and a peptide (peptide-HLA-A-B2M) (PubMed:7504010, PubMed:7679507, PubMed:21943705, PubMed:19177349, PubMed:24395804, PubMed:26758806, PubMed:7504010, PubMed:7506728, PubMed:8805302, PubMed:7694806, PubMed:7935798, PubMed:9177355, PubMed:18275829, PubMed:22245737, PubMed:28250417, PubMed:11502003, PubMed:8906788, PubMed:19542454). Early in biogenesis, HLA-A-B2M dimer interacts with the components of the peptide-loading complex composed of TAPBP, TAP1-TAP2, TAPBPL, PDIA3/ERP57 and CALR (PubMed:21263072).
Interacts with TAP1-TAP2 transporter via TAPBP; this interaction is obligatory for the loading of peptide epitopes delivered to the ER by TAP1-TAP2 transporter (PubMed:8805302, PubMed:8630735, PubMed:21263072).
Interacts with TAPBPL; TAPBPL binds peptide-free HLA-A-B2M complexes or those loaded with low affinity peptides, likely facilitating peptide exchange for higher affinity peptides (PubMed:26869717). Only optimally assembled peptide-HLA-B2M trimer translocates to the surface of antigen-presenting cells, where it interacts with TCR and CD8 coreceptor on the surface of T cells. HLA-A (via polymorphic alpha-1 and alpha-2 domains) interacts with antigen-specific TCR (via CDR3 domains) (PubMed:22245737, PubMed:12796775, PubMed:18275829). One HLA-A molecule (mainly via nonpolymorphic alpha-3 domain) interacts with one CD8A homodimer (via CDR-like loop); this interaction insures peptide-HLA-A-B2M recognition by CD8-positive T cells only (PubMed:9177355, PubMed:2784196). Alleles A*23:01; A*24:02 and A*32:01 interact (via Bw4 motif) with KIR3DL1 on NK cells; this interaction is direct.
22 PublicationsManual assertion based on experiment ini
- Ref.38"Polymorphism in the alpha 3 domain of HLA-A molecules affects binding to CD8."
Salter R.D., Norment A.M., Chen B.P., Clayberger C., Krensky A.M., Littman D.R., Parham P.
Nature 338:345-347(1989) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELES A*02:01 AND A*68:01), INTERACTION WITH CD8A, DOMAIN, CHARACTERIZATION OF VARIANT VAL-269. - Ref.40"HLA-A1 and HLA-A3 T cell epitopes derived from influenza virus proteins predicted from peptide binding motifs."
DiBrino M., Tsuchida T., Turner R.V., Parker K.C., Coligan J.E., Biddison W.E.
J. Immunol. 151:5930-5935(1993) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELES A*01:01 AND A*03:01), INTERACTION WITH B2M AND PEPTIDE. - Ref.41"Endogenous peptides bound to HLA-A3 possess a specific combination of anchor residues that permit identification of potential antigenic peptides."
DiBrino M., Parker K.C., Shiloach J., Knierman M., Lukszo J., Turner R.V., Biddison W.E., Coligan J.E.
Proc. Natl. Acad. Sci. U.S.A. 90:1508-1512(1993) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*03:01), INTERACTION WITH B2M AND PEPTIDE. - Ref.42"Endogenous peptides with distinct amino acid anchor residue motifs bind to HLA-A1 and HLA-B8."
DiBrino M., Parker K.C., Shiloach J., Turner R.V., Tsuchida T., Garfield M., Biddison W.E., Coligan J.E.
J. Immunol. 152:620-631(1994) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*01:01), INTERACTION WITH B2M AND PEPTIDE. - Ref.43"Point mutations in the alpha 2 domain of HLA-A2.1 define a functionally relevant interaction with TAP."
Lewis J.W., Neisig A., Neefjes J., Elliott T.
Curr. Biol. 6:873-883(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*02:01), MUTAGENESIS OF SER-156 AND THR-158, DOMAIN, INTERACTION WITH B2M, INTERACTION WITH TAP1-TAP2 COMPLEX, SUBCELLULAR LOCATION. - Ref.44"A point mutation in HLA-A*0201 results in failure to bind the TAP complex and to present virus-derived peptides to CTL."
Peace-Brewer A.L., Tussey L.G., Matsui M., Li G., Quinn D.G., Frelinger J.A.
Immunity 4:505-514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*02:01), INTERACTION WITH TAP1-TAP2 COMPLEX, MUTAGENESIS OF THR-158. - Ref.55"Cutting Edge: Allele-specific and peptide-dependent interactions between KIR3DL1 and HLA-A and HLA-B."
Thananchai H., Gillespie G., Martin M.P., Bashirova A., Yawata N., Yawata M., Easterbrook P., McVicar D.W., Maenaka K., Parham P., Carrington M., Dong T., Rowland-Jones S.
J. Immunol. 178:33-37(2007) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELES A*23:01; A*24:02 AND A*32:01), INTERACTION WITH KIR3DL1. - Ref.57"Human leukocyte antigens A23, A24, and A32 but not A25 are ligands for KIR3DL1."
Stern M., Ruggeri L., Capanni M., Mancusi A., Velardi A.
Blood 112:708-710(2008) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*24:02), INTERACTION WITH KIR3DL1. - Ref.63"Distinct functions for the glycans of tapasin and heavy chains in the assembly of MHC class I molecules."
Rizvi S.M., Del Cid N., Lybarger L., Raghavan M.
J. Immunol. 186:2309-2320(2011) [PubMed] [Europe PMC] [Abstract]Cited for: INDUCTION BY IFNG, GLYCOSYLATION AT ASN-110, MUTAGENESIS OF ASN-110, SUBCELLULAR LOCATION, INTERACTION WITH TAPBP. - Ref.70"Interaction of TAPBPR, a tapasin homolog, with MHC-I molecules promotes peptide editing."
Morozov G.I., Zhao H., Mage M.G., Boyd L.F., Jiang J., Dolan M.A., Venna R., Norcross M.A., McMurtrey C.P., Hildebrand W., Schuck P., Natarajan K., Margulies D.H.
Proc. Natl. Acad. Sci. U.S.A. 113:E1006-E1015(2016) [PubMed] [Europe PMC] [Abstract]Cited for: INTERACTION WITH TAPBPL. - Ref.77"The antigenic identity of peptide-MHC complexes: a comparison of the conformations of five viral peptides presented by HLA-A2."
Madden D.R., Garboczi D.N., Wiley D.C.
Cell 75:693-708(1993) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.50 ANGSTROMS) OF 25-299 (ALLELE A*02:01) IN COMPLEX WITH B2M AND PEPTIDE, FUNCTION (ALLELE A*02:01), DISULFIDE BOND, DOMAIN. - Ref.78"Three-dimensional structure of a peptide extending from one end of a class I MHC binding site."
Collins E.J., Garboczi D.N., Wiley D.C.
Nature 371:626-629(1994) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.00 ANGSTROMS) OF 25-299 (ALLELE A*02:01) IN COMPLEX WITH B2M AND PEPTIDE, FUNCTION (ALLELE A*02:01). - Ref.80"Crystal structure of the complex between human CD8alpha(alpha) and HLA-A2."
Gao G.F., Tormo J., Gerth U.C., Wyer J.R., McMichael A.J., Stuart D.I., Bell J.I., Jones E.Y., Jakobsen B.K.
Nature 387:630-634(1997) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.65 ANGSTROMS) OF 25-300 (ALLELE A*02:01) IN COMPLEX WITH B2M AND PEPTIDE, INTERACTION WITH CD8A, FUNCTION (ALLELE A*02:01). - Ref.81"High-resolution structure of HLA-A*0201 in complex with a tumour-specific antigenic peptide encoded by the MAGE-A4 gene."
Hillig R.C., Coulie P.G., Stroobant V., Saenger W., Ziegler A., Hulsmeyer M.
J. Mol. Biol. 310:1167-1176(2001) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (1.40 ANGSTROMS) OF 25-299 (ALLELE A*02:01) IN COMPLEX WITH B2M AND PEPTIDE, FUNCTION (ALLELE A*02:01). - Ref.82"A structural basis for immunodominant human T cell receptor recognition."
Stewart-Jones G.B.E., McMichael A.J., Bell J.I., Stuart D.I., Jones E.Y.
Nat. Immunol. 4:657-663(2003) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (1.40 ANGSTROMS) OF 25-300 (ALLELE A*02:01) IN COMPLEX WITH B2M AND PEPTIDE, INTERACTION WITH TCR, FUNCTION (ALLELE A*02:01). - Ref.84"The structural dynamics and energetics of an immunodominant T cell receptor are programmed by its Vbeta domain."
Ishizuka J., Stewart-Jones G.B., van der Merwe A., Bell J.I., McMichael A.J., Jones E.Y.
Immunity 28:171-182(2008) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (1.60 ANGSTROMS) OF 25-300 (ALLELE A*02:01) IN COMPLEX WITH B2M AND PEPTIDE, INTERACTION WITH TCR, FUNCTION (ALLELE A*02:01). - Ref.86"Conformational changes within the HLA-A1:MAGE-A1 complex induced by binding of a recombinant antibody fragment with TCR-like specificity."
Kumar P., Vahedi-Faridi A., Saenger W., Ziegler A., Uchanska-Ziegler B.
Protein Sci. 18:37-49(2009) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (1.80 ANGSTROMS) OF 25-298 (ALLELE A*01:01) IN COMPLEX WITH B2M AND PEPTIDE, FUNCTION (ALLELE A*01:01), DOMAIN, DISULFIDE BOND. - Ref.90"Structural basis of cross-allele presentation by HLA-A*0301 and HLA-A*1101 revealed by two HIV-derived peptide complexes."
Zhang S., Liu J., Cheng H., Tan S., Qi J., Yan J., Gao G.F.
Mol. Immunol. 49:395-401(2011) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.00 ANGSTROMS) OF 25-298 (ALLELE A*03:01) IN COMPLEX WITH B2M AND PEPTIDE, DISULFIDE BOND, DOMAIN, FUNCTION (ALLELE A*03:01). - Ref.91"Structural basis for the killing of human beta cells by CD8(+) T cells in type 1 diabetes."
Bulek A.M., Cole D.K., Skowera A., Dolton G., Gras S., Madura F., Fuller A., Miles J.J., Gostick E., Price D.A., Drijfhout J.W., Knight R.R., Huang G.C., Lissin N., Molloy P.E., Wooldridge L., Jakobsen B.K., Rossjohn J. , Peakman M., Rizkallah P.J., Sewell A.K.
Nat. Immunol. 13:283-289(2012) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (1.67 ANGSTROMS) OF 25-300 (ALLELE A*02:01) IN COMPLEX WITH B2M AND PEPTIDE, INTERACTION WITH TCR, FUNCTION (ALLELE A*02:01), DOMAIN, INDUCTION BY CYTOKINES, INVOLVEMENT IN IDDM (ALLELE A*02:01). - Ref.92"Preexisting CD8+ T-cell immunity to the H7N9 influenza A virus varies across ethnicities."
Quinones-Parra S., Grant E., Loh L., Nguyen T.H., Campbell K.A., Tong S.Y., Miller A., Doherty P.C., Vijaykrishna D., Rossjohn J., Gras S., Kedzierska K.
Proc. Natl. Acad. Sci. U.S.A. 111:1049-1054(2014) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.00 ANGSTROMS) OF 25-308 (ALLELE A*01:01) IN COMPLEX WITH B2M AND PEPTIDE, FUNCTION (ALLELE A*01:01), DOMAIN. - Ref.93"Direct molecular mimicry enables off-target cardiovascular toxicity by an enhanced affinity TCR designed for cancer immunotherapy."
Raman M.C., Rizkallah P.J., Simmons R., Donnellan Z., Dukes J., Bossi G., Le Provost G.S., Todorov P., Baston E., Hickman E., Mahon T., Hassan N., Vuidepot A., Sami M., Cole D.K., Jakobsen B.K.
Sci. Rep. 6:18851-18851(2016) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.40 ANGSTROMS) OF 25-298 (ALLELE A*01:01) IN COMPLEX WITH B2M AND PEPTIDE, FUNCTION (ALLELE A*01:01), DOMAIN, DISULFIDE BOND. - Ref.94"Broad TCR repertoire and diverse structural solutions for recognition of an immunodominant CD8+ T cell epitope."
Song I., Gil A., Mishra R., Ghersi D., Selin L.K., Stern L.J.
Nat. Struct. Mol. Biol. 24:395-406(2017) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.06 ANGSTROMS) OF 25-299 (ALLELE A*02:01) IN COMPLEX WITH B2M AND PEPTIDE, FUNCTION (ALLELE A*02:01), DOMAIN, DISULFIDE BOND.
(Microbial infection) Interacts with HHV-8 MIR1 protein.
1 PublicationManual assertion based on experiment ini
- Ref.50"Ubiquitylation of MHC class I by the K3 viral protein signals internalization and TSG101-dependent degradation."
Hewitt E.W., Duncan L., Mufti D., Baker J., Stevenson P.G., Lehner P.J.
EMBO J. 21:2418-2429(2002) [PubMed] [Europe PMC] [Abstract]Cited for: INTERACTION WITH HUMAN HERPESVIRUS 8 MIR1 PROTEIN (MICROBIAL INFECTION), UBIQUITINATION (MICROBIAL INFECTION).
(Microbial infection) Interacts with HTLV-1 accessory protein p12I.
1 PublicationManual assertion based on experiment ini
- Ref.49"Free major histocompatibility complex class I heavy chain is preferentially targeted for degradation by human T-cell leukemia/lymphotropic virus type 1 p12(I) protein."
Johnson J.M., Nicot C., Fullen J., Ciminale V., Casareto L., Mulloy J.C., Jacobson S., Franchini G.
J. Virol. 75:6086-6094(2001) [PubMed] [Europe PMC] [Abstract]Cited for: INTERACTION WITH HTLV-1 ACCESSORY PROTEIN P12I (MICROBIAL INFECTION).
<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi
P04439
| With | #Exp. | IntAct |
|---|---|---|
| 8 [P0DTC8] from Severe acute respiratory syndrome coronavirus 2. | 3 | EBI-1042870,EBI-25475900 |
GO - Molecular functioni
- beta-2-microglobulin binding Source: UniProtKBInferred from direct assayi
- "Structure of the human class I histocompatibility antigen, HLA-A2."
Bjorkman P.J., Saper M.A., Samraoui B., Bennett W.S., Strominger J.L., Wiley D.C.
Nature 329:506-512(1987) [PubMed] [Europe PMC] [Abstract] - Ref.77"The antigenic identity of peptide-MHC complexes: a comparison of the conformations of five viral peptides presented by HLA-A2."
Madden D.R., Garboczi D.N., Wiley D.C.
Cell 75:693-708(1993) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.50 ANGSTROMS) OF 25-299 (ALLELE A*02:01) IN COMPLEX WITH B2M AND PEPTIDE, FUNCTION (ALLELE A*02:01), DISULFIDE BOND, DOMAIN. - Ref.43"Point mutations in the alpha 2 domain of HLA-A2.1 define a functionally relevant interaction with TAP."
Lewis J.W., Neisig A., Neefjes J., Elliott T.
Curr. Biol. 6:873-883(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*02:01), MUTAGENESIS OF SER-156 AND THR-158, DOMAIN, INTERACTION WITH B2M, INTERACTION WITH TAP1-TAP2 COMPLEX, SUBCELLULAR LOCATION. - Ref.79"Structure of the complex between human T-cell receptor, viral peptide and HLA-A2."
Garboczi D.N., Ghosh P., Utz U., Fan Q.R., Biddison W.E., Wiley D.C.
Nature 384:134-141(1996) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.60 ANGSTROMS) OF 25-299 (ALLELE A*02:01) IN COMPLEX WITH B2M AND PEPTIDE, FUNCTION (ALLELE A*02:01), DOMAIN.
- CD8 receptor binding Source: UniProtKBInferred from direct assayi
- Ref.38"Polymorphism in the alpha 3 domain of HLA-A molecules affects binding to CD8."
Salter R.D., Norment A.M., Chen B.P., Clayberger C., Krensky A.M., Littman D.R., Parham P.
Nature 338:345-347(1989) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELES A*02:01 AND A*68:01), INTERACTION WITH CD8A, DOMAIN, CHARACTERIZATION OF VARIANT VAL-269.
- signaling receptor binding Source: BHF-UCLInferred from physical interactioni
- "Ig-like transcript 4 inhibits lipid antigen presentation through direct CD1d interaction."
Li D., Wang L., Yu L., Freundt E.C., Jin B., Screaton G.R., Xu X.N.
J Immunol 182:1033-1040(2009) [PubMed] [Europe PMC] [Abstract]
- TAP binding Source: UniProtKBInferred from direct assayi
- "Allele-specific differences in the interaction of MHC class I molecules with transporters associated with antigen processing."
Neisig A., Wubbolts R., Zang X., Melief C., Neefjes J.
J Immunol 156:3196-3206(1996) [PubMed] [Europe PMC] [Abstract] - Ref.43"Point mutations in the alpha 2 domain of HLA-A2.1 define a functionally relevant interaction with TAP."
Lewis J.W., Neisig A., Neefjes J., Elliott T.
Curr. Biol. 6:873-883(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*02:01), MUTAGENESIS OF SER-156 AND THR-158, DOMAIN, INTERACTION WITH B2M, INTERACTION WITH TAP1-TAP2 COMPLEX, SUBCELLULAR LOCATION.
- T cell receptor binding Source: UniProtKBInferred from direct assayi
- "Four A6-TCR/peptide/HLA-A2 structures that generate very different T cell signals are nearly identical."
Ding Y.H., Baker B.M., Garboczi D.N., Biddison W.E., Wiley D.C.
Immunity 11:45-56(1999) [PubMed] [Europe PMC] [Abstract] - Ref.79"Structure of the complex between human T-cell receptor, viral peptide and HLA-A2."
Garboczi D.N., Ghosh P., Utz U., Fan Q.R., Biddison W.E., Wiley D.C.
Nature 384:134-141(1996) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.60 ANGSTROMS) OF 25-299 (ALLELE A*02:01) IN COMPLEX WITH B2M AND PEPTIDE, FUNCTION (ALLELE A*02:01), DOMAIN. - "Assembly, specific binding, and crystallization of a human TCR-alphabeta with an antigenic Tax peptide from human T lymphotropic virus type 1 and the class I MHC molecule HLA-A2."
Garboczi D.N., Utz U., Ghosh P., Seth A., Kim J., VanTienhoven E.A., Biddison W.E., Wiley D.C.
J. Immunol. 157:5403-5410(1996) [PubMed] [Europe PMC] [Abstract]
Protein-protein interaction databases
The Biological General Repository for Interaction Datasets (BioGRID) More...BioGRIDi | 109350, 151 interactors |
Protein interaction database and analysis system More...IntActi | P04439, 83 interactors |
Molecular INTeraction database More...MINTi | P04439 |
Chemistry databases
BindingDB database of measured binding affinities More...BindingDBi | P04439 |
<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei
Secondary structure
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more detailsHide details| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the <a href="http://www.uniprot.org/help/structure_section">'Structure'</a> section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 27 – 36 | Combined sources <p>Information inferred from a combination of experimental and computational evidence, without manual validation.</p> <p><a href="/manual/evidences#ECO:0000213">More...</a></p> Automatic assertion inferred from combination of experimental and computational evidencei | 10 | |
| Beta strandi | 41 – 43 | Combined sources Automatic assertion inferred from combination of experimental and computational evidencei | 3 | |
| Beta strandi | 45 – 52 | Combined sources Automatic assertion inferred from combination of experimental and computational evidencei | 8 | |
| Beta strandi | 55 – 61 | Combined sources Automatic assertion inferred from combination of experimental and computational evidencei | 7 | |
| Beta strandi | 64 – 66 | Combined sources Automatic assertion inferred from combination of experimental and computational evidencei | 3 | |
| Beta strandi | 70 – 73 | Combined sources Automatic assertion inferred from combination of experimental and computational evidencei | 4 | |
| <p>This subsection of the <a href="http://www.uniprot.org/help/structure_section">'Structure'</a> section is used to indicate the positions of experimentally determined helical regions within the protein sequence.<p><a href='/help/helix' target='_top'>More...</a></p>Helixi | 74 – 78 | Combined sources Automatic assertion inferred from combination of experimental and computational evidencei | 5 | |
| Helixi | 81 – 108 | Combined sources Automatic assertion inferred from combination of experimental and computational evidencei | 28 | |
| Beta strandi | 113 – 115 | Combined sources Automatic assertion inferred from combination of experimental and computational evidencei | 3 | |
| Beta strandi | 118 – 127 | Combined sources Automatic assertion inferred from combination of experimental and computational evidencei | 10 | |
| Beta strandi | 129 – 131 | Combined sources Automatic assertion inferred from combination of experimental and computational evidencei | 3 | |
| Beta strandi | 133 – 142 | Combined sources Automatic assertion inferred from combination of experimental and computational evidencei | 10 | |
| Beta strandi | 145 – 150 | Combined sources Automatic assertion inferred from combination of experimental and computational evidencei | 6 | |
| Beta strandi | 152 – 155 | Combined sources Automatic assertion inferred from combination of experimental and computational evidencei | 4 | |
| Beta strandi | 157 – 159 | Combined sources Automatic assertion inferred from combination of experimental and computational evidencei | 3 | |
| Helixi | 162 – 173 | Combined sources Automatic assertion inferred from combination of experimental and computational evidencei | 12 | |
| Helixi | 176 – 185 | Combined sources Automatic assertion inferred from combination of experimental and computational evidencei | 10 | |
| Helixi | 187 – 198 | Combined sources Automatic assertion inferred from combination of experimental and computational evidencei | 12 | |
| Helixi | 200 – 203 | Combined sources Automatic assertion inferred from combination of experimental and computational evidencei | 4 | |
| Beta strandi | 210 – 235 | Combined sources Automatic assertion inferred from combination of experimental and computational evidencei | 26 | |
| Beta strandi | 238 – 243 | Combined sources Automatic assertion inferred from combination of experimental and computational evidencei | 6 | |
| Beta strandi | 246 – 248 | Combined sources Automatic assertion inferred from combination of experimental and computational evidencei | 3 | |
| Helixi | 249 – 251 | Combined sources Automatic assertion inferred from combination of experimental and computational evidencei | 3 | |
| Beta strandi | 252 – 254 | Combined sources Automatic assertion inferred from combination of experimental and computational evidencei | 3 | |
| Beta strandi | 261 – 263 | Combined sources Automatic assertion inferred from combination of experimental and computational evidencei | 3 | |
| Beta strandi | 265 – 274 | Combined sources Automatic assertion inferred from combination of experimental and computational evidencei | 10 | |
| Beta strandi | 275 – 277 | Combined sources Automatic assertion inferred from combination of experimental and computational evidencei | 3 | |
| Helixi | 278 – 280 | Combined sources Automatic assertion inferred from combination of experimental and computational evidencei | 3 | |
| Beta strandi | 281 – 286 | Combined sources Automatic assertion inferred from combination of experimental and computational evidencei | 6 | |
| Beta strandi | 290 – 292 | Combined sources Automatic assertion inferred from combination of experimental and computational evidencei | 3 | |
| Beta strandi | 294 – 296 | Combined sources Automatic assertion inferred from combination of experimental and computational evidencei | 3 | |
| Beta strandi | 348 – 350 | Combined sources Automatic assertion inferred from combination of experimental and computational evidencei | 3 |
3D structure databases
SWISS-MODEL Repository - a database of annotated 3D protein structure models More...SMRi | P04439 |
Database of comparative protein structure models More...ModBasei | Search... |
Protein Data Bank in Europe - Knowledge Base More...PDBe-KBi | Search... |
<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi
Domains and Repeats
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini | 209 – 295 | Ig-like C1-typeSequence analysisAdd BLAST | 87 |
Region
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni | 25 – 114 | Alpha-1Sequence analysisAdd BLAST | 90 | |
| Regioni | 115 – 206 | Alpha-2Sequence analysisAdd BLAST | 92 | |
| Regioni | 207 – 298 | Alpha-3Sequence analysisAdd BLAST | 92 | |
| Regioni | 299 – 308 | Connecting peptideSequence analysis | 10 | |
| Regioni | 339 – 365 | DisorderedSequence analysis <p>Information which has been generated by the UniProtKB automatic annotation system, without manual validation.</p> <p><a href="/manual/evidences#ECO:0000256">More...</a></p> Automatic assertion according to sequence analysisi Add BLAST | 27 |
Compositional bias
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi | 341 – 359 | Polar residuesSequence analysis Automatic assertion according to sequence analysisi Add BLAST | 19 |
<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini
The alpha-1 domain is a structural part of the peptide-binding cleft.11 Publications
Manual assertion based on experiment ini
- Ref.38"Polymorphism in the alpha 3 domain of HLA-A molecules affects binding to CD8."
Salter R.D., Norment A.M., Chen B.P., Clayberger C., Krensky A.M., Littman D.R., Parham P.
Nature 338:345-347(1989) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELES A*02:01 AND A*68:01), INTERACTION WITH CD8A, DOMAIN, CHARACTERIZATION OF VARIANT VAL-269. - Ref.77"The antigenic identity of peptide-MHC complexes: a comparison of the conformations of five viral peptides presented by HLA-A2."
Madden D.R., Garboczi D.N., Wiley D.C.
Cell 75:693-708(1993) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.50 ANGSTROMS) OF 25-299 (ALLELE A*02:01) IN COMPLEX WITH B2M AND PEPTIDE, FUNCTION (ALLELE A*02:01), DISULFIDE BOND, DOMAIN. - Ref.79"Structure of the complex between human T-cell receptor, viral peptide and HLA-A2."
Garboczi D.N., Ghosh P., Utz U., Fan Q.R., Biddison W.E., Wiley D.C.
Nature 384:134-141(1996) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.60 ANGSTROMS) OF 25-299 (ALLELE A*02:01) IN COMPLEX WITH B2M AND PEPTIDE, FUNCTION (ALLELE A*02:01), DOMAIN. - Ref.85"Structural bases for the affinity-driven selection of a public TCR against a dominant human cytomegalovirus epitope."
Gras S., Saulquin X., Reiser J.B., Debeaupuis E., Echasserieau K., Kissenpfennig A., Legoux F., Chouquet A., Le Gorrec M., Machillot P., Neveu B., Thielens N., Malissen B., Bonneville M., Housset D.
J. Immunol. 183:430-437(2009) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (1.60 ANGSTROMS) OF 25-298 (ALLELE A*02:01) IN COMPLEX WITH B2M AND PEPTIDE, FUNCTION (ALLELE A*02:01), DOMAIN. - Ref.86"Conformational changes within the HLA-A1:MAGE-A1 complex induced by binding of a recombinant antibody fragment with TCR-like specificity."
Kumar P., Vahedi-Faridi A., Saenger W., Ziegler A., Uchanska-Ziegler B.
Protein Sci. 18:37-49(2009) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (1.80 ANGSTROMS) OF 25-298 (ALLELE A*01:01) IN COMPLEX WITH B2M AND PEPTIDE, FUNCTION (ALLELE A*01:01), DOMAIN, DISULFIDE BOND. - Ref.87"Novel immunodominant peptide presentation strategy: a featured HLA-A*2402-restricted cytotoxic T-lymphocyte epitope stabilized by intrachain hydrogen bonds from severe acute respiratory syndrome coronavirus nucleocapsid protein."
Liu J., Wu P., Gao F., Qi J., Kawana-Tachikawa A., Xie J., Vavricka C.J., Iwamoto A., Li T., Gao G.F.
J. Virol. 84:11849-11857(2010) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.4 ANGSTROMS) OF 25-298 (ALLELE A*24:02) IN COMPLEX WITH B2M AND WITH SARS NUCLEOCAPSID PEPTIDE, DISULFIDE BONDS, FUNCTION (ALLELE A*24:02), DOMAIN. - Ref.88"Structures of native and affinity-enhanced WT1 epitopes bound to HLA-A*0201: implications for WT1-based cancer therapeutics."
Borbulevych O.Y., Do P., Baker B.M.
Mol. Immunol. 47:2519-2524(2010) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (1.89 ANGSTROMS) OF 25-299 (ALLELE A*02:01) IN COMPLEX WITH B2M AND PEPTIDE, FUNCTION (ALLELE A*02:01), DOMAIN. - Ref.90"Structural basis of cross-allele presentation by HLA-A*0301 and HLA-A*1101 revealed by two HIV-derived peptide complexes."
Zhang S., Liu J., Cheng H., Tan S., Qi J., Yan J., Gao G.F.
Mol. Immunol. 49:395-401(2011) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.00 ANGSTROMS) OF 25-298 (ALLELE A*03:01) IN COMPLEX WITH B2M AND PEPTIDE, DISULFIDE BOND, DOMAIN, FUNCTION (ALLELE A*03:01). - Ref.91"Structural basis for the killing of human beta cells by CD8(+) T cells in type 1 diabetes."
Bulek A.M., Cole D.K., Skowera A., Dolton G., Gras S., Madura F., Fuller A., Miles J.J., Gostick E., Price D.A., Drijfhout J.W., Knight R.R., Huang G.C., Lissin N., Molloy P.E., Wooldridge L., Jakobsen B.K., Rossjohn J. , Peakman M., Rizkallah P.J., Sewell A.K.
Nat. Immunol. 13:283-289(2012) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (1.67 ANGSTROMS) OF 25-300 (ALLELE A*02:01) IN COMPLEX WITH B2M AND PEPTIDE, INTERACTION WITH TCR, FUNCTION (ALLELE A*02:01), DOMAIN, INDUCTION BY CYTOKINES, INVOLVEMENT IN IDDM (ALLELE A*02:01). - Ref.92"Preexisting CD8+ T-cell immunity to the H7N9 influenza A virus varies across ethnicities."
Quinones-Parra S., Grant E., Loh L., Nguyen T.H., Campbell K.A., Tong S.Y., Miller A., Doherty P.C., Vijaykrishna D., Rossjohn J., Gras S., Kedzierska K.
Proc. Natl. Acad. Sci. U.S.A. 111:1049-1054(2014) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.00 ANGSTROMS) OF 25-308 (ALLELE A*01:01) IN COMPLEX WITH B2M AND PEPTIDE, FUNCTION (ALLELE A*01:01), DOMAIN. - Ref.93"Direct molecular mimicry enables off-target cardiovascular toxicity by an enhanced affinity TCR designed for cancer immunotherapy."
Raman M.C., Rizkallah P.J., Simmons R., Donnellan Z., Dukes J., Bossi G., Le Provost G.S., Todorov P., Baston E., Hickman E., Mahon T., Hassan N., Vuidepot A., Sami M., Cole D.K., Jakobsen B.K.
Sci. Rep. 6:18851-18851(2016) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.40 ANGSTROMS) OF 25-298 (ALLELE A*01:01) IN COMPLEX WITH B2M AND PEPTIDE, FUNCTION (ALLELE A*01:01), DOMAIN, DISULFIDE BOND.
The alpha-2 domain is a structural part of the peptide-binding cleft (PubMed:21543847, PubMed:21943705, PubMed:19177349, PubMed:26758806, PubMed:24395804, PubMed:7694806, PubMed:8906788, PubMed:2784196, PubMed:28250417, PubMed:22245737, PubMed:19542454, PubMed:20619457, PubMed:20844028). Mediates the interaction with TAP1-TAP2 complex (PubMed:8805302).14 Publications
Manual assertion based on experiment ini
- Ref.38"Polymorphism in the alpha 3 domain of HLA-A molecules affects binding to CD8."
Salter R.D., Norment A.M., Chen B.P., Clayberger C., Krensky A.M., Littman D.R., Parham P.
Nature 338:345-347(1989) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELES A*02:01 AND A*68:01), INTERACTION WITH CD8A, DOMAIN, CHARACTERIZATION OF VARIANT VAL-269. - Ref.43"Point mutations in the alpha 2 domain of HLA-A2.1 define a functionally relevant interaction with TAP."
Lewis J.W., Neisig A., Neefjes J., Elliott T.
Curr. Biol. 6:873-883(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELE A*02:01), MUTAGENESIS OF SER-156 AND THR-158, DOMAIN, INTERACTION WITH B2M, INTERACTION WITH TAP1-TAP2 COMPLEX, SUBCELLULAR LOCATION. - Ref.77"The antigenic identity of peptide-MHC complexes: a comparison of the conformations of five viral peptides presented by HLA-A2."
Madden D.R., Garboczi D.N., Wiley D.C.
Cell 75:693-708(1993) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.50 ANGSTROMS) OF 25-299 (ALLELE A*02:01) IN COMPLEX WITH B2M AND PEPTIDE, FUNCTION (ALLELE A*02:01), DISULFIDE BOND, DOMAIN. - Ref.79"Structure of the complex between human T-cell receptor, viral peptide and HLA-A2."
Garboczi D.N., Ghosh P., Utz U., Fan Q.R., Biddison W.E., Wiley D.C.
Nature 384:134-141(1996) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.60 ANGSTROMS) OF 25-299 (ALLELE A*02:01) IN COMPLEX WITH B2M AND PEPTIDE, FUNCTION (ALLELE A*02:01), DOMAIN. - Ref.85"Structural bases for the affinity-driven selection of a public TCR against a dominant human cytomegalovirus epitope."
Gras S., Saulquin X., Reiser J.B., Debeaupuis E., Echasserieau K., Kissenpfennig A., Legoux F., Chouquet A., Le Gorrec M., Machillot P., Neveu B., Thielens N., Malissen B., Bonneville M., Housset D.
J. Immunol. 183:430-437(2009) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (1.60 ANGSTROMS) OF 25-298 (ALLELE A*02:01) IN COMPLEX WITH B2M AND PEPTIDE, FUNCTION (ALLELE A*02:01), DOMAIN. - Ref.86"Conformational changes within the HLA-A1:MAGE-A1 complex induced by binding of a recombinant antibody fragment with TCR-like specificity."
Kumar P., Vahedi-Faridi A., Saenger W., Ziegler A., Uchanska-Ziegler B.
Protein Sci. 18:37-49(2009) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (1.80 ANGSTROMS) OF 25-298 (ALLELE A*01:01) IN COMPLEX WITH B2M AND PEPTIDE, FUNCTION (ALLELE A*01:01), DOMAIN, DISULFIDE BOND. - Ref.87"Novel immunodominant peptide presentation strategy: a featured HLA-A*2402-restricted cytotoxic T-lymphocyte epitope stabilized by intrachain hydrogen bonds from severe acute respiratory syndrome coronavirus nucleocapsid protein."
Liu J., Wu P., Gao F., Qi J., Kawana-Tachikawa A., Xie J., Vavricka C.J., Iwamoto A., Li T., Gao G.F.
J. Virol. 84:11849-11857(2010) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.4 ANGSTROMS) OF 25-298 (ALLELE A*24:02) IN COMPLEX WITH B2M AND WITH SARS NUCLEOCAPSID PEPTIDE, DISULFIDE BONDS, FUNCTION (ALLELE A*24:02), DOMAIN. - Ref.88"Structures of native and affinity-enhanced WT1 epitopes bound to HLA-A*0201: implications for WT1-based cancer therapeutics."
Borbulevych O.Y., Do P., Baker B.M.
Mol. Immunol. 47:2519-2524(2010) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (1.89 ANGSTROMS) OF 25-299 (ALLELE A*02:01) IN COMPLEX WITH B2M AND PEPTIDE, FUNCTION (ALLELE A*02:01), DOMAIN. - Ref.89"Structure of HLA-A*0301 in complex with a peptide of proteolipid protein: insights into the role of HLA-A alleles in susceptibility to multiple sclerosis."
McMahon R.M., Friis L., Siebold C., Friese M.A., Fugger L., Jones E.Y.
Acta Crystallogr. D 67:447-454(2011) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.6 ANGSTROMS) OF 25-298 (ALLELE A*03:01) IN COMPLEX WITH B2M AND PLP1 ANTIGENIC PEPTIDE, DISULFIDE BONDS, DOMAIN. - Ref.90"Structural basis of cross-allele presentation by HLA-A*0301 and HLA-A*1101 revealed by two HIV-derived peptide complexes."
Zhang S., Liu J., Cheng H., Tan S., Qi J., Yan J., Gao G.F.
Mol. Immunol. 49:395-401(2011) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.00 ANGSTROMS) OF 25-298 (ALLELE A*03:01) IN COMPLEX WITH B2M AND PEPTIDE, DISULFIDE BOND, DOMAIN, FUNCTION (ALLELE A*03:01). - Ref.91"Structural basis for the killing of human beta cells by CD8(+) T cells in type 1 diabetes."
Bulek A.M., Cole D.K., Skowera A., Dolton G., Gras S., Madura F., Fuller A., Miles J.J., Gostick E., Price D.A., Drijfhout J.W., Knight R.R., Huang G.C., Lissin N., Molloy P.E., Wooldridge L., Jakobsen B.K., Rossjohn J. , Peakman M., Rizkallah P.J., Sewell A.K.
Nat. Immunol. 13:283-289(2012) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (1.67 ANGSTROMS) OF 25-300 (ALLELE A*02:01) IN COMPLEX WITH B2M AND PEPTIDE, INTERACTION WITH TCR, FUNCTION (ALLELE A*02:01), DOMAIN, INDUCTION BY CYTOKINES, INVOLVEMENT IN IDDM (ALLELE A*02:01). - Ref.92"Preexisting CD8+ T-cell immunity to the H7N9 influenza A virus varies across ethnicities."
Quinones-Parra S., Grant E., Loh L., Nguyen T.H., Campbell K.A., Tong S.Y., Miller A., Doherty P.C., Vijaykrishna D., Rossjohn J., Gras S., Kedzierska K.
Proc. Natl. Acad. Sci. U.S.A. 111:1049-1054(2014) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.00 ANGSTROMS) OF 25-308 (ALLELE A*01:01) IN COMPLEX WITH B2M AND PEPTIDE, FUNCTION (ALLELE A*01:01), DOMAIN. - Ref.93"Direct molecular mimicry enables off-target cardiovascular toxicity by an enhanced affinity TCR designed for cancer immunotherapy."
Raman M.C., Rizkallah P.J., Simmons R., Donnellan Z., Dukes J., Bossi G., Le Provost G.S., Todorov P., Baston E., Hickman E., Mahon T., Hassan N., Vuidepot A., Sami M., Cole D.K., Jakobsen B.K.
Sci. Rep. 6:18851-18851(2016) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.40 ANGSTROMS) OF 25-298 (ALLELE A*01:01) IN COMPLEX WITH B2M AND PEPTIDE, FUNCTION (ALLELE A*01:01), DOMAIN, DISULFIDE BOND. - Ref.94"Broad TCR repertoire and diverse structural solutions for recognition of an immunodominant CD8+ T cell epitope."
Song I., Gil A., Mishra R., Ghersi D., Selin L.K., Stern L.J.
Nat. Struct. Mol. Biol. 24:395-406(2017) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.06 ANGSTROMS) OF 25-299 (ALLELE A*02:01) IN COMPLEX WITH B2M AND PEPTIDE, FUNCTION (ALLELE A*02:01), DOMAIN, DISULFIDE BOND.
The alpha-3 Ig-like domain mediates the interaction with CD8 coreceptor.1 Publication
Manual assertion based on experiment ini
- Ref.38"Polymorphism in the alpha 3 domain of HLA-A molecules affects binding to CD8."
Salter R.D., Norment A.M., Chen B.P., Clayberger C., Krensky A.M., Littman D.R., Parham P.
Nature 338:345-347(1989) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION (ALLELES A*02:01 AND A*68:01), INTERACTION WITH CD8A, DOMAIN, CHARACTERIZATION OF VARIANT VAL-269.
<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi
Belongs to the MHC class I family.Curated
Keywords - Domaini
Immunoglobulin domain, Signal, Transmembrane, Transmembrane helixPhylogenomic databases
evolutionary genealogy of genes: Non-supervised Orthologous Groups More...eggNOGi | ENOG502RQEK, Eukaryota |
Ensembl GeneTree More...GeneTreei | ENSGT00980000198488 |
Identification of Orthologs from Complete Genome Data More...OMAi | WERERVC |
Database of Orthologous Groups More...OrthoDBi | 1390181at2759 |
Database for complete collections of gene phylogenies More...PhylomeDBi | P04439 |
TreeFam database of animal gene trees More...TreeFami | TF336617 |
Family and domain databases
Gene3D Structural and Functional Annotation of Protein Families More...Gene3Di | 2.60.40.10, 1 hit 3.30.500.10, 1 hit |
Integrated resource of protein families, domains and functional sites More...InterProi | View protein in InterPro IPR007110, Ig-like_dom IPR036179, Ig-like_dom_sf IPR013783, Ig-like_fold IPR003006, Ig/MHC_CS IPR003597, Ig_C1-set IPR011161, MHC_I-like_Ag-recog IPR037055, MHC_I-like_Ag-recog_sf IPR011162, MHC_I/II-like_Ag-recog IPR001039, MHC_I_a_a1/a2 IPR010579, MHC_I_a_C |
Pfam protein domain database More...Pfami | View protein in Pfam PF07654, C1-set, 1 hit PF00129, MHC_I, 1 hit PF06623, MHC_I_C, 1 hit |
Protein Motif fingerprint database; a protein domain database More...PRINTSi | PR01638, MHCCLASSI |
Simple Modular Architecture Research Tool; a protein domain database More...SMARTi | View protein in SMART SM00407, IGc1, 1 hit |
Superfamily database of structural and functional annotation More...SUPFAMi | SSF48726, SSF48726, 1 hit SSF54452, SSF54452, 1 hit |
<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i
<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.
<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.
This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basketAdded to basketThis entry has 2 described isoforms and 31 potential isoforms that are computationally mapped.Show allAlign All
Isoform 1 (identifier: P04439-1) [UniParc]FASTAAdd to basketAdded to basket
This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
« Hide
Show »10 20 30 40 50
MAVMAPRTLL LLLSGALALT QTWAGSHSMR YFFTSVSRPG RGEPRFIAVG
60 70 80 90 100
YVDDTQFVRF DSDAASQRME PRAPWIEQEG PEYWDQETRN VKAQSQTDRV
110 120 130 140 150
DLGTLRGYYN QSEAGSHTIQ IMYGCDVGSD GRFLRGYRQD AYDGKDYIAL
160 170 180 190 200
NEDLRSWTAA DMAAQITKRK WEAAHEAEQL RAYLDGTCVE WLRRYLENGK
210 220 230 240 250
ETLQRTDPPK THMTHHPISD HEATLRCWAL GFYPAEITLT WQRDGEDQTQ
260 270 280 290 300
DTELVETRPA GDGTFQKWAA VVVPSGEEQR YTCHVQHEGL PKPLTLRWEL
310 320 330 340 350
SSQPTIPIVG IIAGLVLLGA VITGAVVAAV MWRRKSSDRK GGSYTQAASS
360
DSAQGSDVSL TACKV
Length:365
Mass (Da):40,841
Last modified:August 22, 2003 - v2
<p>The checksum is a form of redundancy check that is calculated
from the sequence. It is useful for tracking sequence updates.</p>
<p>It should be noted that while, in theory, two different sequences could
have the same checksum value, the likelihood that this would happen
is extremely low.</p>
<p>However UniProtKB may contain entries with identical sequences in case
of multiple genes (paralogs).</p>
<p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64)
using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1.
The algorithm is described in the ISO 3309 standard.
</p>
<p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br />
<strong>Cyclic redundancy and other checksums</strong><br />
<a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p>
Checksum:iDEDFCEC4450E0580
Isoform 2 (identifier: P04439-2) [UniParc]FASTAAdd to basketAdded to basket
The sequence of this isoform differs from the canonical sequence as follows:
176-187: EAEQLRAYLDGT → AAEQQRAYLEGR
337-337: S → SGGEGVK
« Hide
Show »10 20 30 40 50
MAVMAPRTLL LLLSGALALT QTWAGSHSMR YFFTSVSRPG RGEPRFIAVG
60 70 80 90 100
YVDDTQFVRF DSDAASQRME PRAPWIEQEG PEYWDQETRN VKAQSQTDRV
110 120 130 140 150
DLGTLRGYYN QSEAGSHTIQ IMYGCDVGSD GRFLRGYRQD AYDGKDYIAL
160 170 180 190 200
NEDLRSWTAA DMAAQITKRK WEAAHAAEQQ RAYLEGRCVE WLRRYLENGK
210 220 230 240 250
ETLQRTDPPK THMTHHPISD HEATLRCWAL GFYPAEITLT WQRDGEDQTQ
260 270 280 290 300
DTELVETRPA GDGTFQKWAA VVVPSGEEQR YTCHVQHEGL PKPLTLRWEL
310 320 330 340 350
SSQPTIPIVG IIAGLVLLGA VITGAVVAAV MWRRKSSGGE GVKDRKGGSY
360 370
TQAASSDSAQ GSDVSLTACK V
<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi
There are 31 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket| Entry | Entry name | Protein names | Gene names | Length | Annotation | ||
|---|---|---|---|---|---|---|---|
| Q5SUL5 | Q5SUL5_HUMAN | HLA class I histocompatibility anti... HLA class I histocompatibility antigen (HLA class I histocompatibility antigen A alpha chain) (HLA class I histocompatibility antigen, A alpha chain) (MHC class I antigen) (MHC class I protein) | HLA-A HLA, HLA-A*0101 | 365 | Annotation score: Annotation score:5 out of 5 <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p> | ||
| Q53Z42 | Q53Z42_HUMAN | HLA class I antigen HLA class I antigen (HLA class I histocompatibility antigen) (HLA class I histocompatibility antigen A alpha chain) (HLA class I histocompatibility antigen, A alpha chain) (MHC class I antigen) (MHC class I protein) (MHC class I protein (HLA-A)) | HLA-A HLA | 365 | Annotation score: Annotation score:2 out of 5 <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p> | ||
| A0A140T913 | A0A140T913_HUMAN | HLA class I histocompatibility anti... HLA class I histocompatibility antigen, A alpha chain | HLA-A | 371 | Annotation score: Annotation score:2 out of 5 <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p> | ||
| Q5SPM2 | Q5SPM2_HUMAN | HLA class I heavy chain HLA class I heavy chain (HLA class I histocompatibility antigen) (HLA class I histocompatibility antigen A alpha chain) (HLA class I histocompatibility antigen, A alpha chain) (HLA-A26.3 antigen) (MHC class I antigen) (MHC class I protein) | HLA-A HLA, HLA-A26 | 365 | Annotation score: Annotation score:2 out of 5 <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p> | ||
| B0UXQ0 | B0UXQ0_HUMAN | HLA class I histocompatibility anti... HLA class I histocompatibility antigen, A alpha chain (MHC class I antigen) (MHC class I protein) | HLA-A HLA | 365 | Annotation score: Annotation score:2 out of 5 <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p> | ||
| Q5RJ27 | Q5RJ27_HUMAN | HLA class I histocompatibility anti... HLA class I histocompatibility antigen, A alpha chain (MHC class I antigen) (MHC class I protein) (MHC class I protein (HLA-A)) | HLA-A HLA | 365 | Annotation score: Annotation score:2 out of 5 <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p> | ||
| Q5SRN5 | Q5SRN5_HUMAN | HLA class I histocompatibility anti... HLA class I histocompatibility antigen, A alpha chain | HLA-A | 371 | Annotation score: Annotation score:2 out of 5 <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p> | ||
| A0A0G2JIF2 | A0A0G2JIF2_HUMAN | HLA class I histocompatibility anti... HLA class I histocompatibility antigen, A alpha chain | HLA-A | 371 | Annotation score: Annotation score:2 out of 5 <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p> | ||
| A0A140T8Y4 | A0A140T8Y4_HUMAN | HLA class I histocompatibility anti... HLA class I histocompatibility antigen, A alpha chain | HLA-A | 371 | Annotation score: Annotation score:2 out of 5 <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p> | ||
| A0A140T9X5 | A0A140T9X5_HUMAN | HLA class I histocompatibility anti... HLA class I histocompatibility antigen, A alpha chain | HLA-A | 371 | Annotation score: Annotation score:2 out of 5 <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p> | ||
| There are more potential isoformsShow all | |||||||
<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni
The sequence CAA25162 differs from that shown. Reason: Erroneous gene model prediction.1 Publication
Manual assertion inferred by curator fromi
- Ref.19"Complete nucleotide sequence of a functional class I HLA gene, HLA-A3: implications for the evolution of HLA genes."
Strachan T., Sodoyer R., Damotte M., Jordan B.R.
EMBO J. 3:887-894(1984) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ALLELE A*03:01).
<p>This subsection of the 'Sequence' section provides information on polymorphic variants. If the variant is associated with a disease state, the description of the latter can be found in the <a href="http://www.uniprot.org/manual/involvement_in_disease">'Involvement in disease'</a> subsection.<p><a href='/help/polymorphism' target='_top'>More...</a></p>Polymorphismi
Highly polymorphic. Polymorphic residues encode for alpha-1 and alpha-2 domains of the peptide-binding cleft, where they contribute to variations in peptide binding and TCR recognition among different alleles. The human population is estimated to have millions of HLA-A alleles. But only 11 common HLA-A alleles are considered core alleles, representing all functionally significant variation (polymorphism) in alpha-1 and alpha-2 domains. These are: A*01:01; A*02:01; A*02:05; A*03:01; A*11:01; A*24:02; A*26:01; A*29:02; A*30:01; A*74:01 and A*80:01. Among these, A*02:01; A*11:01; A*24:02 and A*26:01, were likely passed by introgression from archaic to modern humans. Functional alleles of more recent origin (non-core) were derived by recombination (PubMed:28650991). The sequence shown is that of A*03:01. The sequences of core alleles and common representative alleles of serologically distinct allele groups are described as variants of A*03:01 (PubMed:28650991). Allele A*31:01 is associated with carbamazepine-induced hypersensitivity reactions among subjects of Northern European ancestry [MIMi:608579] (PubMed:21428769).2 Publications
Manual assertion based on experiment ini
- Ref.101"HLA-A*3101 and carbamazepine-induced hypersensitivity reactions in Europeans."
McCormack M., Alfirevic A., Bourgeois S., Farrell J.J., Kasperaviciute D., Carrington M., Sills G.J., Marson T., Jia X., de Bakker P.I., Chinthapalli K., Molokhia M., Johnson M.R., O'Connor G.D., Chaila E., Alhusaini S., Shianna K.V., Radtke R.A. , Heinzen E.L., Walley N., Pandolfo M., Pichler W., Park B.K., Depondt C., Sisodiya S.M., Goldstein D.B., Deloukas P., Delanty N., Cavalleri G.L., Pirmohamed M.
N. Engl. J. Med. 364:1134-1143(2011) [PubMed] [Europe PMC] [Abstract]Cited for: ASSOCIATION OF ALLELE A*31:01 WITH CARBAMAZEPINE-INDUCED HYPERSENSITIVITY REACTIONS. - Ref.103"Distinguishing functional polymorphism from random variation in the sequences of >10,000 HLA-A, -B and -C alleles."
Robinson J., Guethlein L.A., Cereb N., Yang S.Y., Norman P.J., Marsh S.G.E., Parham P.
PLoS Genet. 13:E1006862-E1006862(2017) [PubMed] [Europe PMC] [Abstract]Cited for: POLYMORPHISM.
Natural variant
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_082315 | 3 | V → I in allele A*34:01. 1 Publication Manual assertion based on experiment ini
| 1 | |
| Natural variantiVAR_082316 | 5 | A → P in allele A*80:01. 2 Publications Manual assertion based on experiment ini
| 1 | |
| Natural variantiVAR_082317 | 10 | L → V in allele A*02:01, allele A*02:05, allele A*23:01, allele A*24:02, allele A*25:01, allele A*26:01, allele A*34:01, allele A*43:01, allele A*66:01, allele A*68:01 and allele A*69:01. 10 Publications Manual assertion based on experiment ini
| 1 | |
| Natural variantiVAR_082318 | 14 | S → L in allele A*29:02, allele A*31:01, allele A*32:01, allele A*33:01 and allele A*74:01. 7 Publications Manual assertion based on experiment ini
| 1 | |
| Natural variantiVAR_082319 | 23 | W → R in allele A*74:01. 1 Publication Manual assertion based on experiment ini
| 1 | |
| Natural variantiVAR_082320 | 33 | F → S in allele A*23:01, allele A*24:02 and allele A*30:01. 4 Publications Manual assertion based on experiment ini
| 1 | |
| Natural variantiVAR_082321 | 33 | F → T in allele A*29:02, allele A*31:01 and allele A*33:01; requires 2 nucleotide substitutions. 4 Publications Manual assertion based on experiment ini
| 1 | |
| Natural variantiVAR_082322 | 33 | F → Y in allele A*02:05, allele A*11:01, allele A*25:01, allele A*26:01, allele A*34:01, allele A*43:01, allele A*66:01, allele A*68:01 and allele A*69:01. 9 Publications Manual assertion based on experiment ini
| 1 | |
| Natural variantiVAR_082323 | 41 | R → S in allele A*30:01. 2 Publications Manual assertion based on experiment ini
| 1 | |
| Natural variantiVAR_082324 | 55 | T → S in allele A*80:01. 2 Publications Manual assertion based on experiment ini
| 1 | |
| Natural variantiVAR_082325 | 59 | R → Q in allele A*80:01. 2 Publications Manual assertion based on experiment ini
| 1 | |
| Natural variantiVAR_082326 | 67 | Q → R in allele A*02:05. 1 Publication Manual assertion based on experiment ini
| 1 | |
| Natural variantiVAR_082327 | 68 | R → K in alleles A*01:01 and allele A*36:01. 4 Publications Manual assertion based on experiment ini
| 1 | |
| Natural variantiVAR_082328 | 80 | G → E in allele A*80:01. 2 Publications Manual assertion based on experiment ini
| 1 | |
| Natural variantiVAR_082329 | 80 | G → R in allele A*30:01 and allele A*31:01. 4 Publications Manual assertion based on experiment ini
| 1 | |
| Natural variantiVAR_082330 | 86 | Q → E in allele A*23:01, allele 24:02 and allele A*80:01. 4 Publications Manual assertion based on experiment ini
| 1 | |
| Natural variantiVAR_082331 | 86 | Q → G in allele A*02:01 and allele A*02:05; requires 2 nucleotide substitutions. 4 Publications Manual assertion based on experiment ini
| 1 | |
| Natural variantiVAR_082332 | 86 | Q → L in alleles A*29:02 and allele A*43:01. 2 Publications Manual assertion based on experiment ini
| 1 | |
| Natural variantiVAR_082333 | 86 | Q → R in allele A*25:01, allele A*26:01, allele A*33:01, allele A*34:01, allele A*66:01, allele A*68:01 and allele A*69:01. 6 Publications Manual assertion based on experiment ini
| 1 | |
| Natural variantiVAR_082334 | 87 | E → N in alleles A*25:01, allele A*26:01, allele A*33:01, allele A*34:01, allele A*66:01, allele A*68:01 and allele A*69:01; requires 2 nucleotide substitutions. 6 Publications Manual assertion based on experiment ini
| 1 | |
| Natural variantiVAR_082335 | 87 | E → Q in allele A*29:02 and allele A*43:01. 2 Publications Manual assertion based on experiment ini
| 1 | |
| Natural variantiVAR_082336 | 89 | R → G in allele A*23:01 and allele 24:02. 2 Publications Manual assertion based on experiment ini
| 1 | |
| Natural variantiVAR_082337 | 90 | N → K in allele A*02:01, allele A*02:05, allele A*23:01, allele 24:02 and allele A*34:01. 7 Publications Manual assertion based on experiment ini
| 1 | |
| Natural variantiVAR_082338 | 91 | V → M in allele A*01:01 and allele A*36:01. 4 Publications Manual assertion based on experiment ini
| 1 | |
| Natural variantiVAR_082339 | 94 | Q → H in allele A*01:01, allele A*02:01, allele A*02:05, allele A*23:01, allele 24:02, allele A*25:01, allele A*26:01, allele A*31:01, allele A*32:01, allele A*33:01, allele A*36:01, allele A*43:01, allele A*74:01 and allele A*80:01. 19 Publications Manual assertion based on experiment ini
| 1 | |
| Natural variantiVAR_082340 | 97 | T → I in allele A*31:01 and allele A*33:01. 3 Publications Manual assertion based on experiment ini
| 1 | |
| Natural variantiVAR_082341 | 98 | D → H in allele A*02:01 and allele A*02:05. 4 Publications Manual assertion based on experiment ini
| 1 | |
| Natural variantiVAR_082342 | 98 | D → N in allele A*80:01. 2 Publications Manual assertion based on experiment ini
| 1 | |
| Natural variantiVAR_082343 | 100 | V → A in allele A*01:01, allele A*26:01, allele A*29:02, allele A*36:01, allele A*43:01 and allele A*80:01. 9 Publications Manual assertion based on experiment ini
| 1 | |
| Natural variantiVAR_082344 | 100 | V → E in allele A*23:01, allele A*24:02, allele A*25:01 and allele A*32:01. 5 Publications Manual assertion based on experiment ini
| 1 | |
| Natural variantiVAR_082345 | 101 | D → N Allele A*01:01, allele A*23:01, allele A*24:02, allele A*26:01, allele A*29:02, allele A*36:01, allele A*43:01 and allele A*80:01. 11 Publications Manual assertion based on experiment ini
| 1 | |
| Natural variantiVAR_082346 | 101 | D → S in allele A*25:01 and allele A*32:01; requires 2 nucleotide substitutions. 3 Publications Manual assertion based on experiment ini
| 1 | |
| Natural variantiVAR_082347 | 103 – 107 | GTLRG → RIALR in allele A*23:01, allele A*24:02, allele A*25:01 and allele A*32:01; Bw4 motif RIALR is involved in the recognition of NK cell inhibitory receptor KIR3DL1. 7 Publications Manual assertion based on experiment ini
| 5 | |
| Natural variantiVAR_082348 | 114 | A → D in allele A*01:01, allele A*11:01, allele A*25:01, allele A*26:01, allele A*34:01, allele A*36:01, allele A*43:01, allele A*66:01 and allele A*80:01. 12 Publications Manual assertion based on experiment in |