Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P04370 (MBP_MOUSE)

Entry version 206 (02 Dec 2020)
Sequence version 2 (18 Oct 2001)
Previous versions | rss
Add a publicationFeedback
Protein

Myelin basic protein

Gene

Mbp

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

The classic group of MBP isoforms (isoform 4-isoform 13) are with PLP the most abundant protein components of the myelin membrane in the CNS. They have a role in both its formation and stabilization. The non-classic group of MBP isoforms (isoform 1-isoform 3/Golli-MBPs) may preferentially have a role in the early developing brain long before myelination, maybe as components of transcriptional complexes, and may also be involved in signaling pathways in T-cells and neural cells. Differential splicing events combined to optional post-translational modifications give a wide spectrum of isomers, with each of them potentially having a specialized function.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Myelin basic protein
Short name:
MBP
Alternative name(s):
Myelin A1 protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Mbp
Synonyms:Shi
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 18

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...MGIi		MGI:96925, Mbp

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Defects in Mbp are a cause of dysmyelinating diseases such as the shiverer (SHI) and myelin deficient (MLD) diseases characterized by decreased myelination in the CNS, tremors, and convulsions of progressively increasing severity leading to early death. The shiverer mice only express isoform 2, the MLD mice have a reduced amount of Mbp.

Keywords - Diseasei

Autoimmune encephalomyelitis

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL1764935

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001589911 – 250Myelin basic proteinAdd BLAST250
Isoform 4 (identifier: P04370-4)
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedBy similarity
Isoform 5 (identifier: P04370-5)
Initiator methionineiRemovedBy similarity
Isoform 6 (identifier: P04370-6)
Initiator methionineiRemovedBy similarity
Isoform 7 (identifier: P04370-7)
Initiator methionineiRemovedCurated
Isoform 8 (identifier: P04370-8)
Initiator methionineiRemovedBy similarity
Isoform 9 (identifier: P04370-9)
Initiator methionineiRemovedCurated

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei31PhosphoserineCombined sources1
Modified residuei40PhosphoserineCombined sources1
Modified residuei141PhosphoserineBy similarity1
Modified residuei144PhosphoserineCombined sources1
Modified residuei146PhosphotyrosineBy similarity1
Modified residuei149PhosphothreonineBy similarity1
Modified residuei151PhosphoserineCombined sources1
Modified residuei152PhosphothreonineBy similarity1
Modified residuei157CitrullineBy similarity1
Modified residuei163CitrullineBy similarity1
Modified residuei167PhosphothreonineCombined sources1
Modified residuei172PhosphoserineCombined sources1
Modified residuei175Omega-N-methylarginineCombined sources1
Modified residuei181Omega-N-methylarginineCombined sources1
Modified residuei188PhosphoserineBy similarity1
Modified residuei197PhosphothreonineCombined sources1
Modified residuei199PhosphotyrosineCombined sources1
Modified residuei206PhosphoserineCombined sources1
Modified residuei211PhosphothreonineCombined sources1
Modified residuei226PhosphothreonineBy similarity1
Modified residuei229PhosphothreonineCombined sources1
Modified residuei234Deamidated glutamineBy similarity1
Modified residuei239CitrullineBy similarity1
Modified residuei241PhosphoserineBy similarity1
Modified residuei245Phosphoserine; by UHMK1By similarity1
Modified residuei250CitrullineBy similarity1
Isoform 4 (identifier: P04370-4)
Modified residuei2N-acetylalanineBy similarity1
Modified residuei122PhosphothreonineCombined sources1
Modified residuei139PhosphoserineCombined sources1
Modified residuei151PhosphotyrosineCombined sources1
Isoform 5 (identifier: P04370-5)
Modified residuei2N-acetylalanineBy similarity1
Modified residuei96PhosphothreonineCombined sources1
Modified residuei113PhosphoserineCombined sources1
Modified residuei125PhosphotyrosineCombined sources1
Isoform 6 (identifier: P04370-6)
Modified residuei2N-acetylalanineBy similarity1
Modified residuei122PhosphothreonineCombined sources1
Isoform 7 (identifier: P04370-7)
Modified residuei2N-acetylalanineCurated1
Isoform 8 (identifier: P04370-8)
Modified residuei2N-acetylalanineBy similarity1
Modified residuei96PhosphothreonineCombined sources1
Isoform 9 (identifier: P04370-9)
Modified residuei2N-acetylalanineCurated1
Isoform 10 (identifier: P04370-10)
Modified residuei135PhosphoserineCombined sources1
Modified residuei147PhosphotyrosineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

As in other animals, several charge isomers may be produced as a result of optional post-translational modifications, such as phosphorylation of serine or threonine residues, deamidation of glutamine or asparagine residues, citrullination and methylation of arginine residues.
Methylated on arginine residues; decreases with the age of the animal, making MBP more cationic.
Phosphorylated by TAOK2, VRK2, MAPK11, MAPK12, MAPK14 and MINK1.By similarity

Keywords - PTMi

Acetylation, Citrullination, Methylation, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P04370

MaxQB - The MaxQuant DataBase

More...MaxQBi		P04370

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P04370

PeptideAtlas

More...PeptideAtlasi		P04370

PRoteomics IDEntifications database

More...PRIDEi		P04370

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P04370

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P04370

SwissPalm database of S-palmitoylation events

More...SwissPalmi		P04370

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

In the embryo, isoform 1-isoform 3 are found in neurons within the central nervous system (primarily in pioneer neurons important in the formation of the cortex) and the peripheral nervous system. They are also expressed in the thymus, gut, lung and kidney. In the adult, isoform 1-isoform 3 are highly expressed in the brain (mainly in brain regions rich in oligodendrocytes) and spleen. Lower levels are seen in the heart, kidney and lung. Isoform 2 is also found in cells of the immune system. The isoforms missing the 134 first amino acids (isoform 4-isoform 13) are almost exclusively produced in the myelin-forming cells, the mature oligodendrocytes.

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

The differential expression of MBP isoforms is developmentally regulated. Isoform 2 and isoform 3 are first expressed during embryonic stages (as early as at embryonic day 11.5), expression of isoform 1 is turned on shortly after birth. Expression of the isoforms missing the 134 first amino acids occurs later, presumably as the oligodendrocytes approach their terminally differentiated state.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSMUSG00000041607, Expressed in sciatic nerve and 316 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P04370, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P04370, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer.

By similarity

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		201336, 53 interactors

Protein interaction database and analysis system

More...IntActi		P04370, 31 interactors

Molecular INTeraction database

More...MINTi		P04370

STRING: functional protein association networks

More...STRINGi		10090.ENSMUSP00000046185

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P04370, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1250
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Biological Magnetic Resonance Data Bank

More...BMRBi		P04370

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P04370

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the myelin basic protein family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502S4SJ, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00390000014772

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_118634_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P04370

Identification of Orthologs from Complete Genome Data

More...OMAi		TKIFKMG

Database of Orthologous Groups

More...OrthoDBi		872191at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P04370

TreeFam database of animal gene trees

More...TreeFami		TF333391

Family and domain databases

Database of protein disorder

More...DisProti		DP01101 [P04370-5]

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR000548, Myelin_BP

The PANTHER Classification System

More...PANTHERi		PTHR11429, PTHR11429, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF01669, Myelin_MBP, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00212, MYELINMBP

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00569, MYELIN_MBP, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (13+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 13 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 13 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P04370-1) [UniParc]FASTAAdd to basket
Also known as: Golli-MBP1, J37

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGNHSGKREL SAEKASKDGE IHRGEAGKKR SVGKLSQTAS EDSDVFGEAD 
        60         70         80         90        100
AIQNNGTSAE DTAVTDSKHT ADPKNNWQGA HPADPGNRPH LIRLFSRDAP 
       110        120        130        140        150
GREDNTFKDR PSESDELQTI QEDPTAASGG LDVMASQKRP SQRSKYLATA 
       160        170        180        190        200
STMDHARHGF LPRHRDTGIL DSIGRFFSGD RGAPKRGSGK DSHTRTTHYG 
       210        220        230        240        250
SLPQKSQHGR TQDENPVVHF FKNIVTPRTP PPSQGKGGRD SRSGSPMARR
Length:250
Mass (Da):27,168
Last modified:October 18, 2001 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB418ED11C27B0C43
GO
Isoform 2 (identifier: P04370-2) [UniParc]FASTAAdd to basket
Also known as: Golli-MBP2, BG21, HMBPR

The sequence of this isoform differs from the canonical sequence as follows:
     191-250: DSHTRTTHYGSLPQKSQHGRTQDENPVVHFFKNIVTPRTPPPSQGKGGRDSRSGSPMARR → VSSEP

Show »
Length:195
Mass (Da):21,004
Checksum:i1C5C6AEFB561D2DA
GO
Isoform 3 (identifier: P04370-3) [UniParc]FASTAAdd to basket
Also known as: Golli-MBP3, TP8

The sequence of this isoform differs from the canonical sequence as follows:
     48-250: EADAIQNNGT...SRSGSPMARR → LTHENYPLWLPAPEVAARPDPR

Show »
Length:69
Mass (Da):7,498
Checksum:i067EABB28D687D99
GO
Isoform 4 (identifier: P04370-4) [UniParc]FASTAAdd to basket
Also known as: 21.5-kDa

The sequence of this isoform differs from the canonical sequence as follows:
     1-133: Missing.
     190-190: K → KVPWLKQSRSPLPSHARSRPGLCHMYK
     236-236: K → KGRGLSLSRFSWGAEGQKPGFGYGGRASDYKSAHKGFKGAYDAQGTLSKIFKL

Show »
Length:195
Mass (Da):21,502
Checksum:i4B57CA6F06C4AC7D
GO
Isoform 5 (identifier: P04370-5) [UniParc]FASTAAdd to basket
Also known as: 18.5-kDa

The sequence of this isoform differs from the canonical sequence as follows:
     1-133: Missing.
     236-236: K → KGRGLSLSRFSWGAEGQKPGFGYGGRASDYKSAHKGFKGAYDAQGTLSKIFKL

Show »
Length:169
Mass (Da):18,488
Checksum:iE609240A863F36CD
GO
Isoform 6 (identifier: P04370-6) [UniParc]FASTAAdd to basket
Also known as: 17-kDa-a

The sequence of this isoform differs from the canonical sequence as follows:
     1-133: Missing.
     190-190: K → KVPWLKQSRSPLPSHARSRPGLCHMYK
     236-236: K → KGRGLSLSRFSW

Show »
Length:154
Mass (Da):17,225
Checksum:i00F1F10ECF90421B
GO
Isoform 7 (identifier: P04370-7) [UniParc]FASTAAdd to basket
Also known as: 17-kDa-b

The sequence of this isoform differs from the canonical sequence as follows:
     1-133: Missing.
     236-236: K → KGAEGQKPGFGYGGRASDYKSAHKGFKGAYDAQGTLSKIFKL

Show »
Length:158
Mass (Da):17,240
Checksum:i7AA39D2A263A2BF3
GO
Isoform 8 (identifier: P04370-8) [UniParc]FASTAAdd to basket
Also known as: 14-kDa

The sequence of this isoform differs from the canonical sequence as follows:
     1-133: Missing.
     236-236: K → KGRGLSLSRFSW

Show »
Length:128
Mass (Da):14,211
Checksum:iE1DB77B2010455FB
GO
Isoform 9 (identifier: P04370-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-133: Missing.
     190-190: K → KVPWLKQSRSPLPSHARSRPGLCHMYK
     236-236: K → KGAEGQKPGFGYGGRASDYKSAHKGFKGAYDAQGTLSKIFKL

Show »
Length:184
Mass (Da):20,255
Checksum:iB7F672275771E3F4
GO
Isoform 10 (identifier: P04370-10) [UniParc]FASTAAdd to basket
Also known as: 21-kDa

The sequence of this isoform differs from the canonical sequence as follows:
     1-133: Missing.
     236-236: K → KDFVPGDHHV...QGTLSKIFKL

Show »
Length:191
Mass (Da):20,814
Checksum:iD986AA8B506E2AE9
GO
Isoform 11 (identifier: P04370-11) [UniParc]FASTAAdd to basket
Also known as: 19.7-kDa

The sequence of this isoform differs from the canonical sequence as follows:
     1-133: Missing.
     190-190: K → KVPWLKQSRSPLPSHARSRPGLCHMYK
     236-236: K → KDFVPGDHHVNVSVVTVSFSSSQGRGLSLSRFSW

Show »
Length:176
Mass (Da):19,552
Checksum:i159154971A58A0CF
GO
Isoform 12 (identifier: P04370-13) [UniParc]FASTAAdd to basket
Also known as: 15.6-kDa

The sequence of this isoform differs from the canonical sequence as follows:
     1-133: Missing.
     190-190: K → KVPWLKQSRSPLPSHARSRPGLCHMYK

Show »
Length:143
Mass (Da):15,978
Checksum:i932F8612537F93E2
GO
Isoform 13 (identifier: P04370-14) [UniParc]FASTAAdd to basket
Also known as: 13-kDa

The sequence of this isoform differs from the canonical sequence as follows:
     1-133: Missing.

Show »
Length:117
Mass (Da):12,963
Checksum:i7FC65A7A1A8C7E53
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A498WGS3A0A498WGS3_MOUSE
Myelin basic protein
Mbp
150Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3Z6U4D3Z6U4_MOUSE
Myelin basic protein
Mbp
55Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti204 – 205QK → HN (PubMed:7681106).Curated2

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0033121 – 133Missing in isoform 4, isoform 5, isoform 6, isoform 7, isoform 8, isoform 9, isoform 10, isoform 11, isoform 12 and isoform 13. 4 PublicationsAdd BLAST133
Alternative sequenceiVSP_00331348 – 250EADAI…PMARR → LTHENYPLWLPAPEVAARPD PR in isoform 3. 1 PublicationAdd BLAST203
Alternative sequenceiVSP_003315190K → KVPWLKQSRSPLPSHARSRP GLCHMYK in isoform 4, isoform 6, isoform 9, isoform 11 and isoform 12. 2 Publications1
Alternative sequenceiVSP_003314191 – 250DSHTR…PMARR → VSSEP in isoform 2. 2 PublicationsAdd BLAST60
Alternative sequenceiVSP_003317236K → KDFVPGDHHVNVSVVTVSFS SSQGRGLSLSRFSWGAEGQK PGFGYGGRASDYKSAHKGFK GAYDAQGTLSKIFKL in isoform 10. Curated1
Alternative sequenceiVSP_003316236K → KDFVPGDHHVNVSVVTVSFS SSQGRGLSLSRFSW in isoform 11. Curated1
Alternative sequenceiVSP_003319236K → KGRGLSLSRFSWGAEGQKPG FGYGGRASDYKSAHKGFKGA YDAQGTLSKIFKL in isoform 4 and isoform 5. Curated1
Alternative sequenceiVSP_003318236K → KGRGLSLSRFSW in isoform 6 and isoform 8. 3 Publications1
Alternative sequenceiVSP_003320236K → KGAEGQKPGFGYGGRASDYK SAHKGFKGAYDAQGTLSKIF KL in isoform 7 and isoform 9. 2 Publications1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
M11533 M11532 Genomic DNA Translation: AAA39496.1
M11533 M11531 Genomic DNA Translation: AAA39497.1
L00404 L00402 Genomic DNA Translation: AAA39499.1
L00404 L00402 Genomic DNA Translation: AAA39500.1
L00404 L00403 Genomic DNA Translation: AAA39501.1
L00404 L00403 Genomic DNA Translation: AAA39502.1
M15060 mRNA Translation: AAB59711.1
M15062 mRNA Translation: AAB59712.1
X67319 mRNA Translation: CAA47733.1
L07507 mRNA Translation: AAA37720.1
L07508 mRNA Translation: AAA37721.1
L07509 mRNA Translation: AAA37722.1
L07505, L07504 Genomic DNA Translation: AAA37719.1
AK005129 mRNA Translation: BAB23830.1
BC004704 mRNA Translation: AAH04704.1
M24410 Genomic DNA Translation: AAA39498.1
M36275 Genomic DNA Translation: AAA39504.1
K00989 mRNA Translation: AAA39495.1
M20010 mRNA Translation: AAA39503.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS29373.1 [P04370-1]
CCDS29374.1 [P04370-2]
CCDS29376.1 [P04370-4]
CCDS29377.1 [P04370-5]
CCDS29378.1 [P04370-6]
CCDS29379.1 [P04370-7]
CCDS37875.1 [P04370-9]
CCDS89290.1 [P04370-8]

Protein sequence database of the Protein Information Resource

More...PIRi		A45421, MBMSB

NCBI Reference Sequences

More...RefSeqi		NP_001020416.1, NM_001025245.1 [P04370-2]
NP_001020422.1, NM_001025251.2 [P04370-4]
NP_001020425.1, NM_001025254.2 [P04370-9]
NP_001020426.1, NM_001025255.2 [P04370-5]
NP_001020427.1, NM_001025256.2 [P04370-6]
NP_001020429.1, NM_001025258.2 [P04370-7]
NP_001020430.1, NM_001025259.2 [P04370-8]
NP_034907.1, NM_010777.3 [P04370-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENSMUST00000047865; ENSMUSP00000046185; ENSMUSG00000041607 [P04370-1]
ENSMUST00000062446; ENSMUSP00000053495; ENSMUSG00000041607 [P04370-11]
ENSMUST00000075372; ENSMUSP00000074836; ENSMUSG00000041607 [P04370-14]
ENSMUST00000091789; ENSMUSP00000089393; ENSMUSG00000041607 [P04370-2]
ENSMUST00000102812; ENSMUSP00000099876; ENSMUSG00000041607 [P04370-10]
ENSMUST00000114674; ENSMUSP00000110322; ENSMUSG00000041607 [P04370-13]
ENSMUST00000123251; ENSMUSP00000121855; ENSMUSG00000041607 [P04370-4]
ENSMUST00000132369; ENSMUSP00000114230; ENSMUSG00000041607 [P04370-7]
ENSMUST00000133193; ENSMUSP00000116019; ENSMUSG00000041607 [P04370-8]
ENSMUST00000142850; ENSMUSP00000115082; ENSMUSG00000041607 [P04370-5]
ENSMUST00000143506; ENSMUSP00000138313; ENSMUSG00000041607 [P04370-3]
ENSMUST00000152071; ENSMUSP00000115409; ENSMUSG00000041607 [P04370-6]
ENSMUST00000153478; ENSMUSP00000114630; ENSMUSG00000041607 [P04370-9]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		17196

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		mmu:17196

UCSC genome browser

More...UCSCi		uc008fts.1, mouse [P04370-1]
uc008ftu.1, mouse [P04370-4]
uc008ftv.1, mouse [P04370-9]
uc008ftw.1, mouse [P04370-5]
uc008fty.1, mouse [P04370-7]
uc029tqh.1, mouse [P04370-14]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M11533 M11532 Genomic DNA Translation: AAA39496.1
M11533 M11531 Genomic DNA Translation: AAA39497.1
L00404 L00402 Genomic DNA Translation: AAA39499.1
L00404 L00402 Genomic DNA Translation: AAA39500.1
L00404 L00403 Genomic DNA Translation: AAA39501.1
L00404 L00403 Genomic DNA Translation: AAA39502.1
M15060 mRNA Translation: AAB59711.1
M15062 mRNA Translation: AAB59712.1
X67319 mRNA Translation: CAA47733.1
L07507 mRNA Translation: AAA37720.1
L07508 mRNA Translation: AAA37721.1
L07509 mRNA Translation: AAA37722.1
L07505, L07504 Genomic DNA Translation: AAA37719.1
AK005129 mRNA Translation: BAB23830.1
BC004704 mRNA Translation: AAH04704.1
M24410 Genomic DNA Translation: AAA39498.1
M36275 Genomic DNA Translation: AAA39504.1
K00989 mRNA Translation: AAA39495.1
M20010 mRNA Translation: AAA39503.1
CCDSiCCDS29373.1 [P04370-1]
CCDS29374.1 [P04370-2]
CCDS29376.1 [P04370-4]
CCDS29377.1 [P04370-5]
CCDS29378.1 [P04370-6]
CCDS29379.1 [P04370-7]
CCDS37875.1 [P04370-9]
CCDS89290.1 [P04370-8]
PIRiA45421, MBMSB
RefSeqiNP_001020416.1, NM_001025245.1 [P04370-2]
NP_001020422.1, NM_001025251.2 [P04370-4]
NP_001020425.1, NM_001025254.2 [P04370-9]
NP_001020426.1, NM_001025255.2 [P04370-5]
NP_001020427.1, NM_001025256.2 [P04370-6]
NP_001020429.1, NM_001025258.2 [P04370-7]
NP_001020430.1, NM_001025259.2 [P04370-8]
NP_034907.1, NM_010777.3 [P04370-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1U3HX-ray2.42I/P135-142[»]
2LUGNMR-A206-237[»]
BMRBiP04370
SMRiP04370
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi201336, 53 interactors
IntActiP04370, 31 interactors
MINTiP04370
STRINGi10090.ENSMUSP00000046185

Chemistry databases

ChEMBLiCHEMBL1764935

PTM databases

iPTMnetiP04370
PhosphoSitePlusiP04370
SwissPalmiP04370

Proteomic databases

jPOSTiP04370
MaxQBiP04370
PaxDbiP04370
PeptideAtlasiP04370
PRIDEiP04370

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		3704, 1274 antibodies

Genome annotation databases

EnsembliENSMUST00000047865; ENSMUSP00000046185; ENSMUSG00000041607 [P04370-1]
ENSMUST00000062446; ENSMUSP00000053495; ENSMUSG00000041607 [P04370-11]
ENSMUST00000075372; ENSMUSP00000074836; ENSMUSG00000041607 [P04370-14]
ENSMUST00000091789; ENSMUSP00000089393; ENSMUSG00000041607 [P04370-2]
ENSMUST00000102812; ENSMUSP00000099876; ENSMUSG00000041607 [P04370-10]
ENSMUST00000114674; ENSMUSP00000110322; ENSMUSG00000041607 [P04370-13]
ENSMUST00000123251; ENSMUSP00000121855; ENSMUSG00000041607 [P04370-4]
ENSMUST00000132369; ENSMUSP00000114230; ENSMUSG00000041607 [P04370-7]
ENSMUST00000133193; ENSMUSP00000116019; ENSMUSG00000041607 [P04370-8]
ENSMUST00000142850; ENSMUSP00000115082; ENSMUSG00000041607 [P04370-5]
ENSMUST00000143506; ENSMUSP00000138313; ENSMUSG00000041607 [P04370-3]
ENSMUST00000152071; ENSMUSP00000115409; ENSMUSG00000041607 [P04370-6]
ENSMUST00000153478; ENSMUSP00000114630; ENSMUSG00000041607 [P04370-9]
GeneIDi17196
KEGGimmu:17196
UCSCiuc008fts.1, mouse [P04370-1]
uc008ftu.1, mouse [P04370-4]
uc008ftv.1, mouse [P04370-9]
uc008ftw.1, mouse [P04370-5]
uc008fty.1, mouse [P04370-7]
uc029tqh.1, mouse [P04370-14]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		4155
MGIiMGI:96925, Mbp

Phylogenomic databases

eggNOGiENOG502S4SJ, Eukaryota
GeneTreeiENSGT00390000014772
HOGENOMiCLU_118634_0_0_1
InParanoidiP04370
OMAiTKIFKMG
OrthoDBi872191at2759
PhylomeDBiP04370
TreeFamiTF333391

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		17196, 2 hits in 16 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		Mbp, mouse

Protein Ontology

More...PROi		PR:P04370
RNActiP04370, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSMUSG00000041607, Expressed in sciatic nerve and 316 other tissues
ExpressionAtlasiP04370, baseline and differential
GenevisibleiP04370, MM

Family and domain databases

DisProtiDP01101 [P04370-5]
InterProiView protein in InterPro
IPR000548, Myelin_BP
PANTHERiPTHR11429, PTHR11429, 1 hit
PfamiView protein in Pfam
PF01669, Myelin_MBP, 1 hit
PRINTSiPR00212, MYELINMBP
PROSITEiView protein in PROSITE
PS00569, MYELIN_MBP, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMBP_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P04370
Secondary accession number(s): Q01585
, Q03139, Q03176, Q61836, Q61837, Q99KE4, Q9QWP1
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 20, 1987
Last sequence update: October 18, 2001
Last modified: December 2, 2020
This is version 206 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again