Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
We will be switching to the new UniProt website soon. Please explore and share your feedback. Take me to the new website.

UniProtKB - P04278 (SHBG_HUMAN)

Entry version 205 (23 Feb 2022)
Sequence version 2 (01 Apr 1990)
Previous versions | rss
Add a publicationFeedback
Protein

Sex hormone-binding globulin

Gene

SHBG

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Functions as an androgen transport protein, but may also be involved in receptor mediated processes. Each dimer binds one molecule of steroid. Specific for 5-alpha-dihydrotestosterone, testosterone, and 17-beta-estradiol. Regulates the plasma metabolic clearance rate of steroid hormones by controlling their plasma concentration.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • androgen binding Source: ProtInc
  • steroid binding Source: GO_Central
Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

LigandLipid-binding, Steroid-binding

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		P04278

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		P04278

Protein family/group databases

MoonDB Database of extreme multifunctional and moonlighting proteins

More...MoonDBi		P04278, Predicted

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Sex hormone-binding globulin
Short name:
SHBG
Alternative name(s):
Sex steroid-binding protein
Short name:
SBP
Testis-specific androgen-binding protein
Short name:
ABP
Testosterone-estradiol-binding globulin
Short name:
TeBG
Testosterone-estrogen-binding globulin
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SHBG
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:10839, SHBG

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		182205, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P04278

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000129214

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		6462

Open Targets

More...OpenTargetsi		ENSG00000129214

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA35745

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P04278, Tchem

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL3305

Drug and drug target database

More...DrugBanki		DB02342, 2-Methoxyestradiol
DB04429, 4'-Hydroxyflavanone
DB03882, 5-Alpha-Androstane-3-Beta,17beta-Diol
DB03926, 5alpha-androstane-3beta,17alpha-diol
DB04468, Afimoxifene
DB00882, Clomifene
DB00286, Conjugated estrogens
DB01406, Danazol
DB00304, Desogestrel
DB00890, Dienestrol
DB00255, Diethylstilbestrol
DB11221, Dioxybenzone
DB00858, Drostanolone
DB11674, Equol
DB00783, Estradiol
DB13952, Estradiol acetate
DB13953, Estradiol benzoate
DB13954, Estradiol cypionate
DB13955, Estradiol dienanthate
DB13956, Estradiol valerate
DB04573, Estriol
DB14641, Estriol tripropionate
DB00655, Estrone
DB04574, Estrone sulfate
DB00977, Ethinylestradiol
DB00294, Etonogestrel
DB15690, Fluoroestradiol F-18
DB01185, Fluoxymesterone
DB01645, Genistein
DB11619, Gestrinone
DB01094, Hesperetin
DB00741, Hydrocortisone
DB14538, Hydrocortisone aceponate
DB14539, Hydrocortisone acetate
DB14540, Hydrocortisone butyrate
DB14541, Hydrocortisone cypionate
DB14542, Hydrocortisone phosphate
DB14543, Hydrocortisone probutate
DB14544, Hydrocortisone valerate
DB01026, Ketoconazole
DB00367, Levonorgestrel
DB00179, Masoprocol
DB09124, Medrogestone
DB06710, Methyltestosterone
DB00648, Mitotane
DB03467, Naringenin
DB00717, Norethisterone
DB09371, Norethynodrel
DB00957, Norgestimate
DB06412, Oxymetholone
DB04824, Phenolphthalein
DB00396, Progesterone
DB04216, Quercetin
DB00421, Spironolactone
DB02901, Stanolone
DB13951, Stanolone acetate
DB00675, Tamoxifen
DB00624, Testosterone
DB13943, Testosterone cypionate
DB13944, Testosterone enanthate
DB01420, Testosterone propionate
DB13946, Testosterone undecanoate
DB00539, Toremifene
DB11478, Zeranol
DB01593, Zinc
DB14487, Zinc acetate
DB14533, Zinc chloride
DB14548, Zinc sulfate, unspecified form

DrugCentral

More...DrugCentrali		P04278

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		SHBG

Domain mapping of disease mutations (DMDM)

More...DMDMi		134907

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 292 PublicationsAdd BLAST29
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000003255730 – 402Sex hormone-binding globulin1 PublicationAdd BLAST373

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>GlycosylationiCAR_00017436O-linked (GalNAc...) threonine1 Publication1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi193 ↔ 217PROSITE-ProRule annotation1 Publication
Disulfide bondi362 ↔ 390PROSITE-ProRule annotation1 Publication
Glycosylationi380N-linked (GlcNAc...) asparagine3 Publications1
Glycosylationi396N-linked (GlcNAc...) asparagine2 Publications1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Variant Asn-356 contains one N-linked (GlcNAc...) at position 356.3 Publications

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P04278

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P04278

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P04278

PeptideAtlas

More...PeptideAtlasi		P04278

PRoteomics IDEntifications database

More...PRIDEi		P04278

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		20405
2543
27033
46697
51697 [P04278-1]
51698 [P04278-2]

PTM databases

GlyConnect protein glycosylation platform

More...GlyConnecti		562, 5 N-Linked glycans (2 sites), 3 O-Linked glycans (1 site)

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		P04278, 4 sites, 12 N-linked glycans (3 sites), 6 O-linked glycans (1 site)

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P04278

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P04278

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 1 and isoform 2 are present in liver and testis.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000129214, Expressed in right lobe of liver and 115 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P04278, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P04278, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000129214, Tissue enriched (liver)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer.

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		112359, 58 interactors

Protein interaction database and analysis system

More...IntActi		P04278, 5 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000369816

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		P04278

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P04278, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1402
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P04278

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		P04278

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini45 – 217Laminin G-like 1PROSITE-ProRule annotationAdd BLAST173
Domaini224 – 390Laminin G-like 2PROSITE-ProRule annotationAdd BLAST167

Keywords - Domaini

Repeat, Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3927, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000154035

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P04278

Identification of Orthologs from Complete Genome Data

More...OMAi		WRPLIHT

Database for complete collections of gene phylogenies

More...PhylomeDBi		P04278

TreeFam database of animal gene trees

More...TreeFami		TF334367

Family and domain databases

Conserved Domains Database

More...CDDi		cd00110, LamG, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR013320, ConA-like_dom_sf
IPR001791, Laminin_G

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00054, Laminin_G_1, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00282, LamG, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF49899, SSF49899, 2 hits

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50025, LAM_G_DOMAIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 5 described isoforms and 14 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P04278-1) [UniParc]FASTAAdd to basket
Also known as: SHBG, SHBGr-1

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MESRGPLATS RLLLLLLLLL LRHTRQGWAL RPVLPTQSAH DPPAVHLSNG 
        60         70         80         90        100
PGQEPIAVMT FDLTKITKTS SSFEVRTWDP EGVIFYGDTN PKDDWFMLGL 
       110        120        130        140        150
RDGRPEIQLH NHWAQLTVGA GPRLDDGRWH QVEVKMEGDS VLLEVDGEEV 
       160        170        180        190        200
LRLRQVSGPL TSKRHPIMRI ALGGLLFPAS NLRLPLVPAL DGCLRRDSWL 
       210        220        230        240        250
DKQAEISASA PTSLRSCDVE SNPGIFLPPG TQAEFNLRDI PQPHAEPWAF 
       260        270        280        290        300
SLDLGLKQAA GSGHLLALGT PENPSWLSLH LQDQKVVLSS GSGPGLDLPL 
       310        320        330        340        350
VLGLPLQLKL SMSRVVLSQG SKMKALALPP LGLAPLLNLW AKPQGRLFLG 
       360        370        380        390        400
ALPGEDSSTS FCLNGLWAQG QRLDVDQALN RSHEIWTHSC PQSPGNGTDA 

SH
Length:402
Mass (Da):43,779
Last modified:April 1, 1990 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i5A3B1885E4E7A460
GO
Isoform 2 (identifier: P04278-2) [UniParc]FASTAAdd to basket
Also known as: Sex hormone binding globulin-gene-related protein (SHBGgrp), SHBGr-2

The sequence of this isoform differs from the canonical sequence as follows:
     1-37: MESRGPLATSRLLLLLLLLLLRHTRQGWALRPVLPTQ → PRFKGSPAVLFKLTYAVITCFSLRLTHPPRPW
     285-293: KVVLSSGSG → EKTLPPLFA
     294-402: Missing.

Note: Incomplete sequence.Curated
Show »
Length:288
Mass (Da):31,829
Checksum:iF5BCCF800F560461
GO
Isoform 3 (identifier: P04278-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     285-293: KVVLSSGSG → EKTLPPLFA
     294-402: Missing.

Show »
Length:293
Mass (Da):32,363
Checksum:iB88FA1CEE7F97A7E
GO
Isoform 4 (identifier: P04278-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     239-353: Missing.

Show »
Length:287
Mass (Da):31,720
Checksum:i04D30318BC6B1191
GO
Isoform 5 (identifier: P04278-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     186-203: Missing.

Show »
Length:384
Mass (Da):41,712
Checksum:iACAF2C28914C13D1
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 14 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0C4DGN2A0A0C4DGN2_HUMAN
Sex hormone-binding globulin
SHBG
260Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B0FWH6B0FWH6_HUMAN
Sex hormone-binding globulin
SHBG
206Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B0FWH7B0FWH7_HUMAN
Sex hormone-binding globulin
SHBG
113Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L0M1I3L0M1_HUMAN
Sex hormone-binding globulin
SHBG
181Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B4DYU0B4DYU0_HUMAN
Sex hormone-binding globulin
SHBG
235Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L145I3L145_HUMAN
Sex hormone-binding globulin
SHBG hCG_42018
344Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L4D0I3L4D0_HUMAN
Sex hormone-binding globulin
SHBG
57Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L1C1I3L1C1_HUMAN
Sex hormone-binding globulin
SHBG
93Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L2X4I3L2X4_HUMAN
Sex hormone-binding globulin
SHBG
290Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L1J1I3L1J1_HUMAN
Sex hormone-binding globulin
SHBG
229Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence CAA29309 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti22R → Q in CAA28987 (PubMed:15489334).Curated1
Sequence conflicti334A → L in AAC18778 (PubMed:2608061).Curated1
Sequence conflicti336L → S in AAC18778 (PubMed:2608061).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_02200222R → H. Corresponds to variant dbSNP:rs9282845EnsemblClinVar.1
Natural variantiVAR_01394625R → H1 PublicationCorresponds to variant dbSNP:rs6260EnsemblClinVar.1
Natural variantiVAR_016182185P → L. Corresponds to variant dbSNP:rs6258Ensembl.1
Natural variantiVAR_013129356D → N Generates a N-glycosylation site. 3 PublicationsCorresponds to variant dbSNP:rs6259Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0060901 – 37MESRG…VLPTQ → PRFKGSPAVLFKLTYAVITC FSLRLTHPPRPW in isoform 2. CuratedAdd BLAST37
Alternative sequenceiVSP_045376186 – 203Missing in isoform 5. CuratedAdd BLAST18
Alternative sequenceiVSP_045358239 – 353Missing in isoform 4. 1 PublicationAdd BLAST115
Alternative sequenceiVSP_006091285 – 293KVVLSSGSG → EKTLPPLFA in isoform 2 and isoform 3. 1 Publication9
Alternative sequenceiVSP_006092294 – 402Missing in isoform 2 and isoform 3. 1 PublicationAdd BLAST109

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
X16349 Genomic DNA Translation: CAA34398.1
X16350 Genomic DNA Translation: CAA34399.1
X16351 mRNA Translation: CAA34400.1
M31651 Genomic DNA Translation: AAC18778.1
CD013955 mRNA No translation available.
BC069597 mRNA Translation: AAH69597.1
BC101785 mRNA Translation: AAI01786.1
BC112186 mRNA Translation: AAI12187.1
AC007421 Genomic DNA No translation available.
X05403 mRNA Translation: CAA28987.1
EU352661 mRNA Translation: ABY67999.1
X05885 mRNA Translation: CAA29309.1 Frameshift.
X05792 mRNA Translation: CAA29234.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS11117.1 [P04278-1]
CCDS54082.1 [P04278-3]
CCDS54083.1 [P04278-4]
CCDS58513.1 [P04278-5]

Protein sequence database of the Protein Information Resource

More...PIRi		S09606, BOHUS

NCBI Reference Sequences

More...RefSeqi		NP_001031.2, NM_001040.4 [P04278-1]
NP_001139751.1, NM_001146279.2 [P04278-5]
NP_001139752.1, NM_001146280.2 [P04278-3]
NP_001139753.1, NM_001146281.2 [P04278-4]
NP_001276042.1, NM_001289113.1
NP_001276043.1, NM_001289114.1
NP_001276044.1, NM_001289115.1
NP_001276045.1, NM_001289116.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000380450; ENSP00000369816; ENSG00000129214
ENST00000416273; ENSP00000388867; ENSG00000129214 [P04278-3]
ENST00000441599; ENSP00000393426; ENSG00000129214 [P04278-4]
ENST00000575903; ENSP00000458973; ENSG00000129214 [P04278-5]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		6462

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:6462

Matched Annotation from NCBI and EMBL-EBI (MANE) - Phase one

More...MANE-Selecti		ENST00000380450.9; ENSP00000369816.4; NM_001040.5; NP_001031.2

UCSC genome browser

More...UCSCi		uc002gie.4, human [P04278-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Wikipedia

Androgen-binding protein entry

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X16349 Genomic DNA Translation: CAA34398.1
X16350 Genomic DNA Translation: CAA34399.1
X16351 mRNA Translation: CAA34400.1
M31651 Genomic DNA Translation: AAC18778.1
CD013955 mRNA No translation available.
BC069597 mRNA Translation: AAH69597.1
BC101785 mRNA Translation: AAI01786.1
BC112186 mRNA Translation: AAI12187.1
AC007421 Genomic DNA No translation available.
X05403 mRNA Translation: CAA28987.1
EU352661 mRNA Translation: ABY67999.1
X05885 mRNA Translation: CAA29309.1 Frameshift.
X05792 mRNA Translation: CAA29234.1
CCDSiCCDS11117.1 [P04278-1]
CCDS54082.1 [P04278-3]
CCDS54083.1 [P04278-4]
CCDS58513.1 [P04278-5]
PIRiS09606, BOHUS
RefSeqiNP_001031.2, NM_001040.4 [P04278-1]
NP_001139751.1, NM_001146279.2 [P04278-5]
NP_001139752.1, NM_001146280.2 [P04278-3]
NP_001139753.1, NM_001146281.2 [P04278-4]
NP_001276042.1, NM_001289113.1
NP_001276043.1, NM_001289114.1
NP_001276044.1, NM_001289115.1
NP_001276045.1, NM_001289116.1

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1D2SX-ray1.55A42-217[»]
1F5FX-ray1.70A30-234[»]
1KDKX-ray1.70A41-217[»]
1KDMX-ray2.35A41-217[»]
1LHNX-ray2.00A30-218[»]
1LHOX-ray2.00A30-218[»]
1LHUX-ray1.80A30-218[»]
1LHVX-ray2.00A30-218[»]
1LHWX-ray1.75A30-218[»]
6PYAX-ray1.71A30-234[»]
6PYBX-ray1.80A30-234[»]
6PYFX-ray1.73A30-234[»]
6ULBX-ray1.75A30-234[»]
SMRiP04278
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi112359, 58 interactors
IntActiP04278, 5 interactors
STRINGi9606.ENSP00000369816

Chemistry databases

BindingDBiP04278
ChEMBLiCHEMBL3305
DrugBankiDB02342, 2-Methoxyestradiol
DB04429, 4'-Hydroxyflavanone
DB03882, 5-Alpha-Androstane-3-Beta,17beta-Diol
DB03926, 5alpha-androstane-3beta,17alpha-diol
DB04468, Afimoxifene
DB00882, Clomifene
DB00286, Conjugated estrogens
DB01406, Danazol
DB00304, Desogestrel
DB00890, Dienestrol
DB00255, Diethylstilbestrol
DB11221, Dioxybenzone
DB00858, Drostanolone
DB11674, Equol
DB00783, Estradiol
DB13952, Estradiol acetate
DB13953, Estradiol benzoate
DB13954, Estradiol cypionate
DB13955, Estradiol dienanthate
DB13956, Estradiol valerate
DB04573, Estriol
DB14641, Estriol tripropionate
DB00655, Estrone
DB04574, Estrone sulfate
DB00977, Ethinylestradiol
DB00294, Etonogestrel
DB15690, Fluoroestradiol F-18
DB01185, Fluoxymesterone
DB01645, Genistein
DB11619, Gestrinone
DB01094, Hesperetin
DB00741, Hydrocortisone
DB14538, Hydrocortisone aceponate
DB14539, Hydrocortisone acetate
DB14540, Hydrocortisone butyrate
DB14541, Hydrocortisone cypionate
DB14542, Hydrocortisone phosphate
DB14543, Hydrocortisone probutate
DB14544, Hydrocortisone valerate
DB01026, Ketoconazole
DB00367, Levonorgestrel
DB00179, Masoprocol
DB09124, Medrogestone
DB06710, Methyltestosterone
DB00648, Mitotane
DB03467, Naringenin
DB00717, Norethisterone
DB09371, Norethynodrel
DB00957, Norgestimate
DB06412, Oxymetholone
DB04824, Phenolphthalein
DB00396, Progesterone
DB04216, Quercetin
DB00421, Spironolactone
DB02901, Stanolone
DB13951, Stanolone acetate
DB00675, Tamoxifen
DB00624, Testosterone
DB13943, Testosterone cypionate
DB13944, Testosterone enanthate
DB01420, Testosterone propionate
DB13946, Testosterone undecanoate
DB00539, Toremifene
DB11478, Zeranol
DB01593, Zinc
DB14487, Zinc acetate
DB14533, Zinc chloride
DB14548, Zinc sulfate, unspecified form
DrugCentraliP04278

Protein family/group databases

MoonDBiP04278, Predicted

PTM databases

GlyConnecti562, 5 N-Linked glycans (2 sites), 3 O-Linked glycans (1 site)
GlyGeniP04278, 4 sites, 12 N-linked glycans (3 sites), 6 O-linked glycans (1 site)
iPTMnetiP04278
PhosphoSitePlusiP04278

Genetic variation databases

BioMutaiSHBG
DMDMi134907

Proteomic databases

jPOSTiP04278
MassIVEiP04278
PaxDbiP04278
PeptideAtlasiP04278
PRIDEiP04278
ProteomicsDBi20405
2543
27033
46697
51697 [P04278-1]
51698 [P04278-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		24226, 724 antibodies from 36 providers

The DNASU plasmid repository

More...DNASUi		6462

Genome annotation databases

EnsembliENST00000380450; ENSP00000369816; ENSG00000129214
ENST00000416273; ENSP00000388867; ENSG00000129214 [P04278-3]
ENST00000441599; ENSP00000393426; ENSG00000129214 [P04278-4]
ENST00000575903; ENSP00000458973; ENSG00000129214 [P04278-5]
GeneIDi6462
KEGGihsa:6462
MANE-SelectiENST00000380450.9; ENSP00000369816.4; NM_001040.5; NP_001031.2
UCSCiuc002gie.4, human [P04278-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		6462
DisGeNETi6462

GeneCards: human genes, protein and diseases

More...GeneCardsi		SHBG
HGNCiHGNC:10839, SHBG
HPAiENSG00000129214, Tissue enriched (liver)
MIMi182205, gene
neXtProtiNX_P04278
OpenTargetsiENSG00000129214
PharmGKBiPA35745
VEuPathDBiHostDB:ENSG00000129214

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3927, Eukaryota
GeneTreeiENSGT00940000154035
InParanoidiP04278
OMAiWRPLIHT
PhylomeDBiP04278
TreeFamiTF334367

Enzyme and pathway databases

PathwayCommonsiP04278
SignaLinkiP04278

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		6462, 9 hits in 1036 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		SHBG, human
EvolutionaryTraceiP04278

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		Sex_hormone-binding_globulin

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		6462
PharosiP04278, Tchem

Protein Ontology

More...PROi		PR:P04278
RNActiP04278, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000129214, Expressed in right lobe of liver and 115 other tissues
ExpressionAtlasiP04278, baseline and differential
GenevisibleiP04278, HS

Family and domain databases

CDDicd00110, LamG, 1 hit
InterProiView protein in InterPro
IPR013320, ConA-like_dom_sf
IPR001791, Laminin_G
PfamiView protein in Pfam
PF00054, Laminin_G_1, 1 hit
SMARTiView protein in SMART
SM00282, LamG, 1 hit
SUPFAMiSSF49899, SSF49899, 2 hits
PROSITEiView protein in PROSITE
PS50025, LAM_G_DOMAIN, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSHBG_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P04278
Secondary accession number(s): B0FWH4
, E9PGW1, F5H5Z8, I3L1N7, P14689, Q16616, Q3MIL0, Q6ISD2
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 20, 1987
Last sequence update: April 1, 1990
Last modified: February 23, 2022
This is version 205 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again