Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sex hormone-binding globulin

Gene

SHBG

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Functions as an androgen transport protein, but may also be involved in receptor mediated processes. Each dimer binds one molecule of steroid. Specific for 5-alpha-dihydrotestosterone, testosterone, and 17-beta-estradiol. Regulates the plasma metabolic clearance rate of steroid hormones by controlling their plasma concentration.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • androgen binding Source: ProtInc
  • steroid binding Source: UniProtKB-KW

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

LigandLipid-binding, Steroid-binding

Protein family/group databases

MoonDB Database of extreme multifunctional and moonlighting proteins

More...
MoonDBi
P04278 Predicted

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Sex hormone-binding globulin
Short name:
SHBG
Alternative name(s):
Sex steroid-binding protein
Short name:
SBP
Testis-specific androgen-binding protein
Short name:
ABP
Testosterone-estradiol-binding globulin
Short name:
TeBG
Testosterone-estrogen-binding globulin
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SHBG
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000129214.14

Human Gene Nomenclature Database

More...
HGNCi
HGNC:10839 SHBG

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
182205 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P04278

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
6462

Open Targets

More...
OpenTargetsi
ENSG00000129214

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA35745

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL3305

Drug and drug target database

More...
DrugBanki
DB02342 2-Methoxyestradiol
DB01406 Danazol
DB02901 Dihydrotestosterone
DB00858 Drostanolone
DB00783 Estradiol
DB04574 Estrone sulfate
DB01185 Fluoxymesterone
DB00741 Hydrocortisone
DB06710 Methyltestosterone
DB00648 Mitotane
DB00717 Norethisterone
DB06412 Oxymetholone
DB00421 Spironolactone
DB00624 Testosterone

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SHBG

Domain mapping of disease mutations (DMDM)

More...
DMDMi
134907

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 292 PublicationsAdd BLAST29
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000003255730 – 402Sex hormone-binding globulin1 PublicationAdd BLAST373

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>GlycosylationiCAR_00017436O-linked (GalNAc...) threonine1 Publication1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi193 ↔ 217PROSITE-ProRule annotation1 Publication
Disulfide bondi362 ↔ 390PROSITE-ProRule annotation1 Publication
Glycosylationi380N-linked (GlcNAc...) asparagine3 Publications1
Glycosylationi396N-linked (GlcNAc...) asparagine2 Publications1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Variant Asn-356 contains one N-linked (GlcNAc...) at position 356.3 Publications

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P04278

PeptideAtlas

More...
PeptideAtlasi
P04278

PRoteomics IDEntifications database

More...
PRIDEi
P04278

ProteomicsDB human proteome resource

More...
ProteomicsDBi
51697
51698 [P04278-2]

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
562

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P04278

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P04278

UniCarbKB; an annotated and curated database of glycan structures

More...
UniCarbKBi
P04278

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 1 and isoform 2 are present in liver and testis.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000129214 Expressed in 92 organ(s), highest expression level in right lobe of liver

CleanEx database of gene expression profiles

More...
CleanExi
HS_SHBG

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P04278 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P04278 HS

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer.

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
112359, 58 interactors

Protein interaction database and analysis system

More...
IntActi
P04278, 2 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000369816

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
P04278

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1402
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P04278

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P04278

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P04278

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini45 – 217Laminin G-like 1PROSITE-ProRule annotationAdd BLAST173
Domaini224 – 390Laminin G-like 2PROSITE-ProRule annotationAdd BLAST167

Keywords - Domaini

Repeat, Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IKW6 Eukaryota
ENOG410YKMT LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154035

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000285982

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG017800

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P04278

Identification of Orthologs from Complete Genome Data

More...
OMAi
THAEFSL

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0D6A

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P04278

TreeFam database of animal gene trees

More...
TreeFami
TF334367

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR013320 ConA-like_dom_sf
IPR001791 Laminin_G

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00054 Laminin_G_1, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00282 LamG, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49899 SSF49899, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50025 LAM_G_DOMAIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 5 described isoforms and 14 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P04278-1) [UniParc]FASTAAdd to basket
Also known as: SHBG, SHBGr-1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MESRGPLATS RLLLLLLLLL LRHTRQGWAL RPVLPTQSAH DPPAVHLSNG
60 70 80 90 100
PGQEPIAVMT FDLTKITKTS SSFEVRTWDP EGVIFYGDTN PKDDWFMLGL
110 120 130 140 150
RDGRPEIQLH NHWAQLTVGA GPRLDDGRWH QVEVKMEGDS VLLEVDGEEV
160 170 180 190 200
LRLRQVSGPL TSKRHPIMRI ALGGLLFPAS NLRLPLVPAL DGCLRRDSWL
210 220 230 240 250
DKQAEISASA PTSLRSCDVE SNPGIFLPPG TQAEFNLRDI PQPHAEPWAF
260 270 280 290 300
SLDLGLKQAA GSGHLLALGT PENPSWLSLH LQDQKVVLSS GSGPGLDLPL
310 320 330 340 350
VLGLPLQLKL SMSRVVLSQG SKMKALALPP LGLAPLLNLW AKPQGRLFLG
360 370 380 390 400
ALPGEDSSTS FCLNGLWAQG QRLDVDQALN RSHEIWTHSC PQSPGNGTDA

SH
Length:402
Mass (Da):43,779
Last modified:April 1, 1990 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i5A3B1885E4E7A460
GO
Isoform 2 (identifier: P04278-2) [UniParc]FASTAAdd to basket
Also known as: Sex hormone binding globulin-gene-related protein (SHBGgrp), SHBGr-2

The sequence of this isoform differs from the canonical sequence as follows:
     1-37: MESRGPLATSRLLLLLLLLLLRHTRQGWALRPVLPTQ → PRFKGSPAVLFKLTYAVITCFSLRLTHPPRPW
     285-293: KVVLSSGSG → EKTLPPLFA
     294-402: Missing.

Note: Incomplete sequence.
Show »
Length:288
Mass (Da):31,829
Checksum:iF5BCCF800F560461
GO
Isoform 3 (identifier: P04278-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     285-293: KVVLSSGSG → EKTLPPLFA
     294-402: Missing.

Note: No experimental confirmation available.
Show »
Length:293
Mass (Da):32,363
Checksum:iB88FA1CEE7F97A7E
GO
Isoform 4 (identifier: P04278-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     239-353: Missing.

Show »
Length:287
Mass (Da):31,720
Checksum:i04D30318BC6B1191
GO
Isoform 5 (identifier: P04278-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     186-203: Missing.

Show »
Length:384
Mass (Da):41,712
Checksum:iACAF2C28914C13D1
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 14 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B4DYU0B4DYU0_HUMAN
cDNA FLJ51403, highly similar to Se...
SHBG
235Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L0M1I3L0M1_HUMAN
Sex hormone-binding globulin
SHBG
181Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L145I3L145_HUMAN
Sex hormone-binding globulin, isofo...
SHBG hCG_42018
344Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L4D0I3L4D0_HUMAN
Sex hormone-binding globulin
SHBG
57Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B0FWH6B0FWH6_HUMAN
Sex hormone-binding globulin
SHBG
206Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L1J1I3L1J1_HUMAN
Sex hormone-binding globulin
SHBG
229Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B0FWH7B0FWH7_HUMAN
Sex hormone-binding globulin
SHBG
113Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L4B9I3L4B9_HUMAN
Sex hormone-binding globulin
SHBG
175Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L1G4I3L1G4_HUMAN
Sex hormone-binding globulin
SHBG
82Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L2X4I3L2X4_HUMAN
Sex hormone-binding globulin
SHBG
290Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence CAA29309 differs from that shown. Reason: Frameshift at positions 47, 52 and 54.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti22R → Q in CAA28987 (PubMed:15489334).Curated1
Sequence conflicti334A → L in AAC18778 (PubMed:2608061).Curated1
Sequence conflicti336L → S in AAC18778 (PubMed:2608061).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_02200222R → H. Corresponds to variant dbSNP:rs9282845Ensembl.1
Natural variantiVAR_01394625R → H1 PublicationCorresponds to variant dbSNP:rs6260Ensembl.1
Natural variantiVAR_016182185P → L. Corresponds to variant dbSNP:rs6258Ensembl.1
Natural variantiVAR_013129356D → N Polymorphism; generates a N-glycosylation site. 3 PublicationsCorresponds to variant dbSNP:rs6259Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0060901 – 37MESRG…VLPTQ → PRFKGSPAVLFKLTYAVITC FSLRLTHPPRPW in isoform 2. CuratedAdd BLAST37
Alternative sequenceiVSP_045376186 – 203Missing in isoform 5. CuratedAdd BLAST18
Alternative sequenceiVSP_045358239 – 353Missing in isoform 4. 1 PublicationAdd BLAST115
Alternative sequenceiVSP_006091285 – 293KVVLSSGSG → EKTLPPLFA in isoform 2 and isoform 3. 1 Publication9
Alternative sequenceiVSP_006092294 – 402Missing in isoform 2 and isoform 3. 1 PublicationAdd BLAST109

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X16349 Genomic DNA Translation: CAA34398.1
X16350 Genomic DNA Translation: CAA34399.1
X16351 mRNA Translation: CAA34400.1
M31651 Genomic DNA Translation: AAC18778.1
CD013955 mRNA No translation available.
BC069597 mRNA Translation: AAH69597.1
BC101785 mRNA Translation: AAI01786.1
BC112186 mRNA Translation: AAI12187.1
AC007421 Genomic DNA No translation available.
X05403 mRNA Translation: CAA28987.1
EU352661 mRNA Translation: ABY67999.1
X05885 mRNA Translation: CAA29309.1 Frameshift.
X05792 mRNA Translation: CAA29234.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS11117.1 [P04278-1]
CCDS54082.1 [P04278-3]
CCDS54083.1 [P04278-4]
CCDS58513.1 [P04278-5]

Protein sequence database of the Protein Information Resource

More...
PIRi
S09606 BOHUS

NCBI Reference Sequences

More...
RefSeqi
NP_001031.2, NM_001040.4 [P04278-1]
NP_001139751.1, NM_001146279.2 [P04278-5]
NP_001139752.1, NM_001146280.2 [P04278-3]
NP_001139753.1, NM_001146281.2 [P04278-4]
NP_001276042.1, NM_001289113.1
NP_001276043.1, NM_001289114.1
NP_001276044.1, NM_001289115.1
NP_001276045.1, NM_001289116.1

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.632235

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000380450; ENSP00000369816; ENSG00000129214 [P04278-1]
ENST00000416273; ENSP00000388867; ENSG00000129214 [P04278-3]
ENST00000441599; ENSP00000393426; ENSG00000129214 [P04278-4]
ENST00000575903; ENSP00000458973; ENSG00000129214 [P04278-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
6462

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:6462

UCSC genome browser

More...
UCSCi
uc002gie.4 human [P04278-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Wikipedia

Androgen-binding protein entry

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X16349 Genomic DNA Translation: CAA34398.1
X16350 Genomic DNA Translation: CAA34399.1
X16351 mRNA Translation: CAA34400.1
M31651 Genomic DNA Translation: AAC18778.1
CD013955 mRNA No translation available.
BC069597 mRNA Translation: AAH69597.1
BC101785 mRNA Translation: AAI01786.1
BC112186 mRNA Translation: AAI12187.1
AC007421 Genomic DNA No translation available.
X05403 mRNA Translation: CAA28987.1
EU352661 mRNA Translation: ABY67999.1
X05885 mRNA Translation: CAA29309.1 Frameshift.
X05792 mRNA Translation: CAA29234.1
CCDSiCCDS11117.1 [P04278-1]
CCDS54082.1 [P04278-3]
CCDS54083.1 [P04278-4]
CCDS58513.1 [P04278-5]
PIRiS09606 BOHUS
RefSeqiNP_001031.2, NM_001040.4 [P04278-1]
NP_001139751.1, NM_001146279.2 [P04278-5]
NP_001139752.1, NM_001146280.2 [P04278-3]
NP_001139753.1, NM_001146281.2 [P04278-4]
NP_001276042.1, NM_001289113.1
NP_001276043.1, NM_001289114.1
NP_001276044.1, NM_001289115.1
NP_001276045.1, NM_001289116.1
UniGeneiHs.632235

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1D2SX-ray1.55A42-217[»]
1F5FX-ray1.70A30-234[»]
1KDKX-ray1.70A41-217[»]
1KDMX-ray2.35A41-217[»]
1LHNX-ray2.00A30-218[»]
1LHOX-ray2.00A30-218[»]
1LHUX-ray1.80A30-218[»]
1LHVX-ray2.00A30-218[»]
1LHWX-ray1.75A30-218[»]
ProteinModelPortaliP04278
SMRiP04278
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112359, 58 interactors
IntActiP04278, 2 interactors
STRINGi9606.ENSP00000369816

Chemistry databases

BindingDBiP04278
ChEMBLiCHEMBL3305
DrugBankiDB02342 2-Methoxyestradiol
DB01406 Danazol
DB02901 Dihydrotestosterone
DB00858 Drostanolone
DB00783 Estradiol
DB04574 Estrone sulfate
DB01185 Fluoxymesterone
DB00741 Hydrocortisone
DB06710 Methyltestosterone
DB00648 Mitotane
DB00717 Norethisterone
DB06412 Oxymetholone
DB00421 Spironolactone
DB00624 Testosterone

Protein family/group databases

MoonDBiP04278 Predicted

PTM databases

GlyConnecti562
iPTMnetiP04278
PhosphoSitePlusiP04278
UniCarbKBiP04278

Polymorphism and mutation databases

BioMutaiSHBG
DMDMi134907

Proteomic databases

PaxDbiP04278
PeptideAtlasiP04278
PRIDEiP04278
ProteomicsDBi51697
51698 [P04278-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
6462
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000380450; ENSP00000369816; ENSG00000129214 [P04278-1]
ENST00000416273; ENSP00000388867; ENSG00000129214 [P04278-3]
ENST00000441599; ENSP00000393426; ENSG00000129214 [P04278-4]
ENST00000575903; ENSP00000458973; ENSG00000129214 [P04278-5]
GeneIDi6462
KEGGihsa:6462
UCSCiuc002gie.4 human [P04278-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
6462
DisGeNETi6462
EuPathDBiHostDB:ENSG00000129214.14

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SHBG
HGNCiHGNC:10839 SHBG
MIMi182205 gene
neXtProtiNX_P04278
OpenTargetsiENSG00000129214
PharmGKBiPA35745

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IKW6 Eukaryota
ENOG410YKMT LUCA
GeneTreeiENSGT00940000154035
HOGENOMiHOG000285982
HOVERGENiHBG017800
InParanoidiP04278
OMAiTHAEFSL
OrthoDBiEOG091G0D6A
PhylomeDBiP04278
TreeFamiTF334367

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SHBG human
EvolutionaryTraceiP04278

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
Sex_hormone-binding_globulin

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
6462

Protein Ontology

More...
PROi
PR:P04278

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000129214 Expressed in 92 organ(s), highest expression level in right lobe of liver
CleanExiHS_SHBG
ExpressionAtlasiP04278 baseline and differential
GenevisibleiP04278 HS

Family and domain databases

InterProiView protein in InterPro
IPR013320 ConA-like_dom_sf
IPR001791 Laminin_G
PfamiView protein in Pfam
PF00054 Laminin_G_1, 1 hit
SMARTiView protein in SMART
SM00282 LamG, 1 hit
SUPFAMiSSF49899 SSF49899, 2 hits
PROSITEiView protein in PROSITE
PS50025 LAM_G_DOMAIN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSHBG_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P04278
Secondary accession number(s): B0FWH4
, E9PGW1, F5H5Z8, I3L1N7, P14689, Q16616, Q3MIL0, Q6ISD2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 20, 1987
Last sequence update: April 1, 1990
Last modified: December 5, 2018
This is version 185 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again