UniProtKB - P04278 (SHBG_HUMAN)
Sex hormone-binding globulin
SHBG
Functioni
GO - Molecular functioni
- androgen binding Source: ProtInc
- steroid binding Source: GO_Central
Keywordsi
Ligand | Lipid-binding, Steroid-binding |
Enzyme and pathway databases
PathwayCommonsi | P04278 |
Protein family/group databases
MoonDBi | P04278, Predicted |
Names & Taxonomyi
Protein namesi | Recommended name: Sex hormone-binding globulinShort name: SHBG Alternative name(s): Sex steroid-binding protein Short name: SBP Testis-specific androgen-binding protein Short name: ABP Testosterone-estradiol-binding globulin Short name: TeBG Testosterone-estrogen-binding globulin |
Gene namesi | Name:SHBG |
Organismi | Homo sapiens (Human) |
Taxonomic identifieri | 9606 [NCBI] |
Taxonomic lineagei | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Proteomesi |
|
Organism-specific databases
EuPathDBi | HostDB:ENSG00000129214.14 |
HGNCi | HGNC:10839, SHBG |
MIMi | 182205, gene |
neXtProti | NX_P04278 |
Subcellular locationi
Extracellular region or secreted
- Secreted By similarity
Note: In testis, it is synthesized by the Sertoli cells, secreted into the lumen of the seminiferous tubule and transported to the epididymis.By similarity
Extracellular region or secreted
- extracellular exosome Source: UniProtKB
- extracellular region Source: UniProtKB
Keywords - Cellular componenti
SecretedPathology & Biotechi
Organism-specific databases
DisGeNETi | 6462 |
OpenTargetsi | ENSG00000129214 |
PharmGKBi | PA35745 |
Miscellaneous databases
Pharosi | P04278, Tchem |
Chemistry databases
ChEMBLi | CHEMBL3305 |
DrugBanki | DB02342, 2-Methoxyestradiol DB04429, 4'-Hydroxyflavanone DB03882, 5-Alpha-Androstane-3-Beta,17beta-Diol DB03926, 5alpha-androstane-3beta,17alpha-diol DB04468, Afimoxifene DB00882, Clomifene DB00286, Conjugated estrogens DB01406, Danazol DB00304, Desogestrel DB00890, Dienestrol DB00255, Diethylstilbestrol DB11221, Dioxybenzone DB00858, Drostanolone DB11674, Equol DB00783, Estradiol DB13952, Estradiol acetate DB13953, Estradiol benzoate DB13954, Estradiol cypionate DB13955, Estradiol dienanthate DB13956, Estradiol valerate DB04573, Estriol DB14641, Estriol tripropionate DB00655, Estrone DB04574, Estrone sulfate DB00977, Ethinylestradiol DB00294, Etonogestrel DB15690, Fluoroestradiol F-18 DB01185, Fluoxymesterone DB01645, Genistein DB11619, Gestrinone DB01094, Hesperetin DB00741, Hydrocortisone DB14538, Hydrocortisone aceponate DB14539, Hydrocortisone acetate DB14540, Hydrocortisone butyrate DB14541, Hydrocortisone cypionate DB14542, Hydrocortisone phosphate DB14543, Hydrocortisone probutate DB14544, Hydrocortisone valerate DB01026, Ketoconazole DB00367, Levonorgestrel DB00179, Masoprocol DB09124, Medrogestone DB06710, Methyltestosterone DB00648, Mitotane DB03467, Naringenin DB00717, Norethisterone DB09371, Norethynodrel DB00957, Norgestimate DB06412, Oxymetholone DB04824, Phenolphthalein DB00396, Progesterone DB04216, Quercetin DB00421, Spironolactone DB02901, Stanolone DB13951, Stanolone acetate DB00675, Tamoxifen DB00624, Testosterone DB13943, Testosterone cypionate DB13944, Testosterone enanthate DB01420, Testosterone propionate DB13946, Testosterone undecanoate DB00539, Toremifene DB11478, Zeranol DB01593, Zinc DB14487, Zinc acetate DB14533, Zinc chloride DB14548, Zinc sulfate, unspecified form |
DrugCentrali | P04278 |
Polymorphism and mutation databases
BioMutai | SHBG |
DMDMi | 134907 |
PTM / Processingi
Molecule processing
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
Signal peptidei | 1 – 29 | 2 PublicationsAdd BLAST | 29 | |
ChainiPRO_0000032557 | 30 – 402 | Sex hormone-binding globulin1 PublicationAdd BLAST | 373 |
Amino acid modifications
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
GlycosylationiCAR_000174 | 36 | O-linked (GalNAc...) threonine1 Publication | 1 | |
Disulfide bondi | 193 ↔ 217 | PROSITE-ProRule annotation1 Publication | ||
Disulfide bondi | 362 ↔ 390 | PROSITE-ProRule annotation1 Publication | ||
Glycosylationi | 380 | N-linked (GlcNAc...) asparagine3 Publications | 1 | |
Glycosylationi | 396 | N-linked (GlcNAc...) asparagine2 Publications | 1 |
Post-translational modificationi
Keywords - PTMi
Disulfide bond, GlycoproteinProteomic databases
jPOSTi | P04278 |
MassIVEi | P04278 |
PaxDbi | P04278 |
PeptideAtlasi | P04278 |
PRIDEi | P04278 |
ProteomicsDBi | 20405 2543 27033 46697 51697 [P04278-1] 51698 [P04278-2] |
PTM databases
GlyConnecti | 562, 5 N-Linked glycans (2 sites), 3 O-Linked glycans (1 site) |
GlyGeni | P04278, 3 sites, 8 N-linked glycans (2 sites), 4 O-linked glycans (1 site) |
iPTMneti | P04278 |
PhosphoSitePlusi | P04278 |
UniCarbKBi | P04278 |
Expressioni
Tissue specificityi
Gene expression databases
Bgeei | ENSG00000129214, Expressed in right lobe of liver and 114 other tissues |
ExpressionAtlasi | P04278, baseline and differential |
Genevisiblei | P04278, HS |
Organism-specific databases
HPAi | ENSG00000129214, Group enriched (intestine, liver) |
Interactioni
Subunit structurei
Homodimer.
Protein-protein interaction databases
BioGRIDi | 112359, 58 interactors |
IntActi | P04278, 5 interactors |
STRINGi | 9606.ENSP00000369816 |
Chemistry databases
BindingDBi | P04278 |
Miscellaneous databases
RNActi | P04278, protein |
Structurei
Secondary structure
3D structure databases
SMRi | P04278 |
ModBasei | Search... |
PDBe-KBi | Search... |
Miscellaneous databases
EvolutionaryTracei | P04278 |
Family & Domainsi
Domains and Repeats
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
Domaini | 45 – 217 | Laminin G-like 1PROSITE-ProRule annotationAdd BLAST | 173 | |
Domaini | 224 – 390 | Laminin G-like 2PROSITE-ProRule annotationAdd BLAST | 167 |
Keywords - Domaini
Repeat, SignalPhylogenomic databases
eggNOGi | KOG3927, Eukaryota |
GeneTreei | ENSGT00940000154035 |
InParanoidi | P04278 |
OMAi | WRPLIHT |
PhylomeDBi | P04278 |
TreeFami | TF334367 |
Family and domain databases
InterProi | View protein in InterPro IPR013320, ConA-like_dom_sf IPR001791, Laminin_G |
Pfami | View protein in Pfam PF00054, Laminin_G_1, 1 hit |
SMARTi | View protein in SMART SM00282, LamG, 1 hit |
SUPFAMi | SSF49899, SSF49899, 2 hits |
PROSITEi | View protein in PROSITE PS50025, LAM_G_DOMAIN, 1 hit |
s (5+)i Sequence
Sequence statusi: Complete.
: The displayed sequence is further processed into a mature form. Sequence processingi
This entry describes 5 produced by isoformsialternative splicing. AlignAdd to basketThis entry has 5 described isoforms and 14 potential isoforms that are computationally mapped.Show allAlign All
This isoform has been chosen as the sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. canonicali
10 20 30 40 50
MESRGPLATS RLLLLLLLLL LRHTRQGWAL RPVLPTQSAH DPPAVHLSNG
60 70 80 90 100
PGQEPIAVMT FDLTKITKTS SSFEVRTWDP EGVIFYGDTN PKDDWFMLGL
110 120 130 140 150
RDGRPEIQLH NHWAQLTVGA GPRLDDGRWH QVEVKMEGDS VLLEVDGEEV
160 170 180 190 200
LRLRQVSGPL TSKRHPIMRI ALGGLLFPAS NLRLPLVPAL DGCLRRDSWL
210 220 230 240 250
DKQAEISASA PTSLRSCDVE SNPGIFLPPG TQAEFNLRDI PQPHAEPWAF
260 270 280 290 300
SLDLGLKQAA GSGHLLALGT PENPSWLSLH LQDQKVVLSS GSGPGLDLPL
310 320 330 340 350
VLGLPLQLKL SMSRVVLSQG SKMKALALPP LGLAPLLNLW AKPQGRLFLG
360 370 380 390 400
ALPGEDSSTS FCLNGLWAQG QRLDVDQALN RSHEIWTHSC PQSPGNGTDA
SH
The sequence of this isoform differs from the canonical sequence as follows:
1-37: MESRGPLATSRLLLLLLLLLLRHTRQGWALRPVLPTQ → PRFKGSPAVLFKLTYAVITCFSLRLTHPPRPW
285-293: KVVLSSGSG → EKTLPPLFA
294-402: Missing.
Computationally mapped potential isoform sequencesi
There are 14 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basketB0FWH6 | B0FWH6_HUMAN | Sex hormone-binding globulin | SHBG | 206 | Annotation score: | ||
B0FWH7 | B0FWH7_HUMAN | Sex hormone-binding globulin | SHBG | 113 | Annotation score: | ||
A0A0C4DGN2 | A0A0C4DGN2_HUMAN | Sex hormone-binding globulin | SHBG | 260 | Annotation score: | ||
I3L0M1 | I3L0M1_HUMAN | Sex hormone-binding globulin | SHBG | 181 | Annotation score: | ||
B4DYU0 | B4DYU0_HUMAN | Sex hormone-binding globulin | SHBG | 235 | Annotation score: | ||
I3L145 | I3L145_HUMAN | Sex hormone-binding globulin | SHBG hCG_42018 | 344 | Annotation score: | ||
I3L4D0 | I3L4D0_HUMAN | Sex hormone-binding globulin | SHBG | 57 | Annotation score: | ||
I3L1J1 | I3L1J1_HUMAN | Sex hormone-binding globulin | SHBG | 229 | Annotation score: | ||
I3L2X4 | I3L2X4_HUMAN | Sex hormone-binding globulin | SHBG | 290 | Annotation score: | ||
I3L1C1 | I3L1C1_HUMAN | Sex hormone-binding globulin | SHBG | 93 | Annotation score: | ||
There are more potential isoformsShow all |
Sequence cautioni
Experimental Info
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
Sequence conflicti | 22 | R → Q in CAA28987 (PubMed:15489334).Curated | 1 | |
Sequence conflicti | 334 | A → L in AAC18778 (PubMed:2608061).Curated | 1 | |
Sequence conflicti | 336 | L → S in AAC18778 (PubMed:2608061).Curated | 1 |
Natural variant
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
Natural variantiVAR_022002 | 22 | R → H. Corresponds to variant dbSNP:rs9282845EnsemblClinVar. | 1 | |
Natural variantiVAR_013946 | 25 | R → H1 PublicationCorresponds to variant dbSNP:rs6260EnsemblClinVar. | 1 | |
Natural variantiVAR_016182 | 185 | P → L. Corresponds to variant dbSNP:rs6258Ensembl. | 1 | |
Natural variantiVAR_013129 | 356 | D → N Polymorphism; generates a N-glycosylation site. 3 PublicationsCorresponds to variant dbSNP:rs6259Ensembl. | 1 |
Alternative sequence
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
Alternative sequenceiVSP_006090 | 1 – 37 | MESRG…VLPTQ → PRFKGSPAVLFKLTYAVITC FSLRLTHPPRPW in isoform 2. CuratedAdd BLAST | 37 | |
Alternative sequenceiVSP_045376 | 186 – 203 | Missing in isoform 5. CuratedAdd BLAST | 18 | |
Alternative sequenceiVSP_045358 | 239 – 353 | Missing in isoform 4. 1 PublicationAdd BLAST | 115 | |
Alternative sequenceiVSP_006091 | 285 – 293 | KVVLSSGSG → EKTLPPLFA in isoform 2 and isoform 3. 1 Publication | 9 | |
Alternative sequenceiVSP_006092 | 294 – 402 | Missing in isoform 2 and isoform 3. 1 PublicationAdd BLAST | 109 |
Sequence databases
Select the link destinations: EMBLi GenBanki DDBJi Links Updated | X16349 Genomic DNA Translation: CAA34398.1 X16350 Genomic DNA Translation: CAA34399.1 X16351 mRNA Translation: CAA34400.1 M31651 Genomic DNA Translation: AAC18778.1 CD013955 mRNA No translation available. BC069597 mRNA Translation: AAH69597.1 BC101785 mRNA Translation: AAI01786.1 BC112186 mRNA Translation: AAI12187.1 AC007421 Genomic DNA No translation available. X05403 mRNA Translation: CAA28987.1 EU352661 mRNA Translation: ABY67999.1 X05885 mRNA Translation: CAA29309.1 Frameshift. X05792 mRNA Translation: CAA29234.1 |
CCDSi | CCDS11117.1 [P04278-1] CCDS54082.1 [P04278-3] CCDS54083.1 [P04278-4] CCDS58513.1 [P04278-5] |
PIRi | S09606, BOHUS |
RefSeqi | NP_001031.2, NM_001040.4 [P04278-1] NP_001139751.1, NM_001146279.2 [P04278-5] NP_001139752.1, NM_001146280.2 [P04278-3] NP_001139753.1, NM_001146281.2 [P04278-4] NP_001276042.1, NM_001289113.1 NP_001276043.1, NM_001289114.1 NP_001276044.1, NM_001289115.1 NP_001276045.1, NM_001289116.1 |
Genome annotation databases
Ensembli | ENST00000380450; ENSP00000369816; ENSG00000129214 [P04278-1] ENST00000416273; ENSP00000388867; ENSG00000129214 [P04278-3] ENST00000441599; ENSP00000393426; ENSG00000129214 [P04278-4] ENST00000575903; ENSP00000458973; ENSG00000129214 [P04278-5] |
GeneIDi | 6462 |
KEGGi | hsa:6462 |
UCSCi | uc002gie.4, human [P04278-1] |
Keywords - Coding sequence diversityi
Alternative splicing, PolymorphismSimilar proteinsi
Cross-referencesi
Web resourcesi
Wikipedia Androgen-binding protein entry |
Atlas of Genetics and Cytogenetics in Oncology and Haematology |
Sequence databases
Select the link destinations: EMBLi GenBanki DDBJi Links Updated | X16349 Genomic DNA Translation: CAA34398.1 X16350 Genomic DNA Translation: CAA34399.1 X16351 mRNA Translation: CAA34400.1 M31651 Genomic DNA Translation: AAC18778.1 CD013955 mRNA No translation available. BC069597 mRNA Translation: AAH69597.1 BC101785 mRNA Translation: AAI01786.1 BC112186 mRNA Translation: AAI12187.1 AC007421 Genomic DNA No translation available. X05403 mRNA Translation: CAA28987.1 EU352661 mRNA Translation: ABY67999.1 X05885 mRNA Translation: CAA29309.1 Frameshift. X05792 mRNA Translation: CAA29234.1 |
CCDSi | CCDS11117.1 [P04278-1] CCDS54082.1 [P04278-3] CCDS54083.1 [P04278-4] CCDS58513.1 [P04278-5] |
PIRi | S09606, BOHUS |
RefSeqi | NP_001031.2, NM_001040.4 [P04278-1] NP_001139751.1, NM_001146279.2 [P04278-5] NP_001139752.1, NM_001146280.2 [P04278-3] NP_001139753.1, NM_001146281.2 [P04278-4] NP_001276042.1, NM_001289113.1 NP_001276043.1, NM_001289114.1 NP_001276044.1, NM_001289115.1 NP_001276045.1, NM_001289116.1 |
3D structure databases
Select the link destinations: PDBei RCSB PDBi PDBji Links Updated | PDB entry | Method | Resolution (Å) | Chain | Positions | PDBsum |
1D2S | X-ray | 1.55 | A | 42-217 | [»] | |
1F5F | X-ray | 1.70 | A | 30-234 | [»] | |
1KDK | X-ray | 1.70 | A | 41-217 | [»] | |
1KDM | X-ray | 2.35 | A | 41-217 | [»] | |
1LHN | X-ray | 2.00 | A | 30-218 | [»] | |
1LHO | X-ray | 2.00 | A | 30-218 | [»] | |
1LHU | X-ray | 1.80 | A | 30-218 | [»] | |
1LHV | X-ray | 2.00 | A | 30-218 | [»] | |
1LHW | X-ray | 1.75 | A | 30-218 | [»] | |
6PYA | X-ray | 1.71 | A | 30-234 | [»] | |
6PYB | X-ray | 1.80 | A | 30-234 | [»] | |
6PYF | X-ray | 1.73 | A | 30-234 | [»] | |
SMRi | P04278 | |||||
ModBasei | Search... | |||||
PDBe-KBi | Search... |
Protein-protein interaction databases
BioGRIDi | 112359, 58 interactors |
IntActi | P04278, 5 interactors |
STRINGi | 9606.ENSP00000369816 |
Chemistry databases
BindingDBi | P04278 |
ChEMBLi | CHEMBL3305 |
DrugBanki | DB02342, 2-Methoxyestradiol DB04429, 4'-Hydroxyflavanone DB03882, 5-Alpha-Androstane-3-Beta,17beta-Diol DB03926, 5alpha-androstane-3beta,17alpha-diol DB04468, Afimoxifene DB00882, Clomifene DB00286, Conjugated estrogens DB01406, Danazol DB00304, Desogestrel DB00890, Dienestrol DB00255, Diethylstilbestrol DB11221, Dioxybenzone DB00858, Drostanolone DB11674, Equol DB00783, Estradiol DB13952, Estradiol acetate DB13953, Estradiol benzoate DB13954, Estradiol cypionate DB13955, Estradiol dienanthate DB13956, Estradiol valerate DB04573, Estriol DB14641, Estriol tripropionate DB00655, Estrone DB04574, Estrone sulfate DB00977, Ethinylestradiol DB00294, Etonogestrel DB15690, Fluoroestradiol F-18 DB01185, Fluoxymesterone DB01645, Genistein DB11619, Gestrinone DB01094, Hesperetin DB00741, Hydrocortisone DB14538, Hydrocortisone aceponate DB14539, Hydrocortisone acetate DB14540, Hydrocortisone butyrate DB14541, Hydrocortisone cypionate DB14542, Hydrocortisone phosphate DB14543, Hydrocortisone probutate DB14544, Hydrocortisone valerate DB01026, Ketoconazole DB00367, Levonorgestrel DB00179, Masoprocol DB09124, Medrogestone DB06710, Methyltestosterone DB00648, Mitotane DB03467, Naringenin DB00717, Norethisterone DB09371, Norethynodrel DB00957, Norgestimate DB06412, Oxymetholone DB04824, Phenolphthalein DB00396, Progesterone DB04216, Quercetin DB00421, Spironolactone DB02901, Stanolone DB13951, Stanolone acetate DB00675, Tamoxifen DB00624, Testosterone DB13943, Testosterone cypionate DB13944, Testosterone enanthate DB01420, Testosterone propionate DB13946, Testosterone undecanoate DB00539, Toremifene DB11478, Zeranol DB01593, Zinc DB14487, Zinc acetate DB14533, Zinc chloride DB14548, Zinc sulfate, unspecified form |
DrugCentrali | P04278 |
Protein family/group databases
MoonDBi | P04278, Predicted |
PTM databases
GlyConnecti | 562, 5 N-Linked glycans (2 sites), 3 O-Linked glycans (1 site) |
GlyGeni | P04278, 3 sites, 8 N-linked glycans (2 sites), 4 O-linked glycans (1 site) |
iPTMneti | P04278 |
PhosphoSitePlusi | P04278 |
UniCarbKBi | P04278 |
Polymorphism and mutation databases
BioMutai | SHBG |
DMDMi | 134907 |
Proteomic databases
jPOSTi | P04278 |
MassIVEi | P04278 |
PaxDbi | P04278 |
PeptideAtlasi | P04278 |
PRIDEi | P04278 |
ProteomicsDBi | 20405 2543 27033 46697 51697 [P04278-1] 51698 [P04278-2] |
Protocols and materials databases
Antibodypediai | 24226, 698 antibodies |
DNASUi | 6462 |
Genome annotation databases
Ensembli | ENST00000380450; ENSP00000369816; ENSG00000129214 [P04278-1] ENST00000416273; ENSP00000388867; ENSG00000129214 [P04278-3] ENST00000441599; ENSP00000393426; ENSG00000129214 [P04278-4] ENST00000575903; ENSP00000458973; ENSG00000129214 [P04278-5] |
GeneIDi | 6462 |
KEGGi | hsa:6462 |
UCSCi | uc002gie.4, human [P04278-1] |
Organism-specific databases
CTDi | 6462 |
DisGeNETi | 6462 |
EuPathDBi | HostDB:ENSG00000129214.14 |
GeneCardsi | SHBG |
HGNCi | HGNC:10839, SHBG |
HPAi | ENSG00000129214, Group enriched (intestine, liver) |
MIMi | 182205, gene |
neXtProti | NX_P04278 |
OpenTargetsi | ENSG00000129214 |
PharmGKBi | PA35745 |
GenAtlasi | Search... |
Phylogenomic databases
eggNOGi | KOG3927, Eukaryota |
GeneTreei | ENSGT00940000154035 |
InParanoidi | P04278 |
OMAi | WRPLIHT |
PhylomeDBi | P04278 |
TreeFami | TF334367 |
Enzyme and pathway databases
PathwayCommonsi | P04278 |
Miscellaneous databases
BioGRID-ORCSi | 6462, 5 hits in 842 CRISPR screens |
ChiTaRSi | SHBG, human |
EvolutionaryTracei | P04278 |
GeneWikii | Sex_hormone-binding_globulin |
GenomeRNAii | 6462 |
Pharosi | P04278, Tchem |
PROi | PR:P04278 |
RNActi | P04278, protein |
SOURCEi | Search... |
Gene expression databases
Bgeei | ENSG00000129214, Expressed in right lobe of liver and 114 other tissues |
ExpressionAtlasi | P04278, baseline and differential |
Genevisiblei | P04278, HS |
Family and domain databases
InterProi | View protein in InterPro IPR013320, ConA-like_dom_sf IPR001791, Laminin_G |
Pfami | View protein in Pfam PF00054, Laminin_G_1, 1 hit |
SMARTi | View protein in SMART SM00282, LamG, 1 hit |
SUPFAMi | SSF49899, SSF49899, 2 hits |
PROSITEi | View protein in PROSITE PS50025, LAM_G_DOMAIN, 1 hit |
ProtoNeti | Search... |
MobiDBi | Search... |
Entry informationi
Entry namei | SHBG_HUMAN | |
Accessioni | P04278Primary (citable) accession number: P04278 Secondary accession number(s): B0FWH4 Q6ISD2 | |
Entry historyi | Integrated into UniProtKB/Swiss-Prot: | March 20, 1987 |
Last sequence update: | April 1, 1990 | |
Last modified: | December 2, 2020 | |
This is version 200 of the entry and version 2 of the sequence. See complete history. | ||
Entry statusi | Reviewed (UniProtKB/Swiss-Prot) | |
Annotation program | Chordata Protein Annotation Program | |
Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. |
Miscellaneousi
Keywords - Technical termi
3D-structure, Direct protein sequencing, Reference proteomeDocuments
- Human polymorphisms and disease mutations
Index of human polymorphisms and disease mutations - MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot - PDB cross-references
Index of Protein Data Bank (PDB) cross-references - Human chromosome 17
Human chromosome 17: entries, gene names and cross-references to MIM - Human entries with polymorphisms or disease mutations
List of human entries with polymorphisms or disease mutations