Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sex hormone-binding globulin

Gene

SHBG

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Functions as an androgen transport protein, but may also be involved in receptor mediated processes. Each dimer binds one molecule of steroid. Specific for 5-alpha-dihydrotestosterone, testosterone, and 17-beta-estradiol. Regulates the plasma metabolic clearance rate of steroid hormones by controlling their plasma concentration.

GO - Molecular functioni

  • androgen binding Source: ProtInc
  • steroid binding Source: UniProtKB-KW

Keywordsi

LigandLipid-binding, Steroid-binding

Protein family/group databases

MoonDBiP04278 Predicted

Names & Taxonomyi

Protein namesi
Recommended name:
Sex hormone-binding globulin
Short name:
SHBG
Alternative name(s):
Sex steroid-binding protein
Short name:
SBP
Testis-specific androgen-binding protein
Short name:
ABP
Testosterone-estradiol-binding globulin
Short name:
TeBG
Testosterone-estrogen-binding globulin
Gene namesi
Name:SHBG
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

EuPathDBiHostDB:ENSG00000129214.14
HGNCiHGNC:10839 SHBG
MIMi182205 gene
neXtProtiNX_P04278

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

DisGeNETi6462
OpenTargetsiENSG00000129214
PharmGKBiPA35745

Chemistry databases

ChEMBLiCHEMBL3305
DrugBankiDB02342 2-Methoxyestradiol
DB01406 Danazol
DB02901 Dihydrotestosterone
DB00858 Drostanolone
DB00783 Estradiol
DB04574 Estrone sulfate
DB01185 Fluoxymesterone
DB00741 Hydrocortisone
DB06710 Methyltestosterone
DB00648 Mitotane
DB00717 Norethisterone
DB06412 Oxymetholone
DB00421 Spironolactone
DB00624 Testosterone

Polymorphism and mutation databases

BioMutaiSHBG
DMDMi134907

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 292 PublicationsAdd BLAST29
ChainiPRO_000003255730 – 402Sex hormone-binding globulin1 PublicationAdd BLAST373

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
GlycosylationiCAR_00017436O-linked (GalNAc...) threonine1 Publication1
Disulfide bondi193 ↔ 217PROSITE-ProRule annotation1 Publication
Disulfide bondi362 ↔ 390PROSITE-ProRule annotation1 Publication
Glycosylationi380N-linked (GlcNAc...) asparagine3 Publications1
Glycosylationi396N-linked (GlcNAc...) asparagine2 Publications1

Post-translational modificationi

Variant Asn-356 contains one N-linked (GlcNAc...) at position 356.3 Publications

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiP04278
PeptideAtlasiP04278
PRIDEiP04278
ProteomicsDBi51697
51698 [P04278-2]

PTM databases

GlyConnecti562
iPTMnetiP04278
PhosphoSitePlusiP04278
UniCarbKBiP04278

Expressioni

Tissue specificityi

Isoform 1 and isoform 2 are present in liver and testis.

Gene expression databases

BgeeiENSG00000129214 Expressed in 92 organ(s), highest expression level in right lobe of liver
CleanExiHS_SHBG
ExpressionAtlasiP04278 baseline and differential
GenevisibleiP04278 HS

Interactioni

Subunit structurei

Homodimer.

Protein-protein interaction databases

BioGridi112359, 58 interactors
IntActiP04278, 2 interactors
STRINGi9606.ENSP00000369816

Chemistry databases

BindingDBiP04278

Structurei

Secondary structure

1402
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliP04278
SMRiP04278
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP04278

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini45 – 217Laminin G-like 1PROSITE-ProRule annotationAdd BLAST173
Domaini224 – 390Laminin G-like 2PROSITE-ProRule annotationAdd BLAST167

Keywords - Domaini

Repeat, Signal

Phylogenomic databases

eggNOGiENOG410IKW6 Eukaryota
ENOG410YKMT LUCA
GeneTreeiENSGT00930000150853
HOGENOMiHOG000285982
HOVERGENiHBG017800
InParanoidiP04278
OMAiTHAEFSL
OrthoDBiEOG091G0D6A
PhylomeDBiP04278
TreeFamiTF334367

Family and domain databases

InterProiView protein in InterPro
IPR013320 ConA-like_dom_sf
IPR001791 Laminin_G
PfamiView protein in Pfam
PF00054 Laminin_G_1, 1 hit
SMARTiView protein in SMART
SM00282 LamG, 1 hit
SUPFAMiSSF49899 SSF49899, 2 hits
PROSITEiView protein in PROSITE
PS50025 LAM_G_DOMAIN, 1 hit

Sequences (5+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 5 described isoforms and 14 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P04278-1) [UniParc]FASTAAdd to basket
Also known as: SHBG, SHBGr-1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MESRGPLATS RLLLLLLLLL LRHTRQGWAL RPVLPTQSAH DPPAVHLSNG
60 70 80 90 100
PGQEPIAVMT FDLTKITKTS SSFEVRTWDP EGVIFYGDTN PKDDWFMLGL
110 120 130 140 150
RDGRPEIQLH NHWAQLTVGA GPRLDDGRWH QVEVKMEGDS VLLEVDGEEV
160 170 180 190 200
LRLRQVSGPL TSKRHPIMRI ALGGLLFPAS NLRLPLVPAL DGCLRRDSWL
210 220 230 240 250
DKQAEISASA PTSLRSCDVE SNPGIFLPPG TQAEFNLRDI PQPHAEPWAF
260 270 280 290 300
SLDLGLKQAA GSGHLLALGT PENPSWLSLH LQDQKVVLSS GSGPGLDLPL
310 320 330 340 350
VLGLPLQLKL SMSRVVLSQG SKMKALALPP LGLAPLLNLW AKPQGRLFLG
360 370 380 390 400
ALPGEDSSTS FCLNGLWAQG QRLDVDQALN RSHEIWTHSC PQSPGNGTDA

SH
Length:402
Mass (Da):43,779
Last modified:April 1, 1990 - v2
Checksum:i5A3B1885E4E7A460
GO
Isoform 2 (identifier: P04278-2) [UniParc]FASTAAdd to basket
Also known as: Sex hormone binding globulin-gene-related protein (SHBGgrp), SHBGr-2

The sequence of this isoform differs from the canonical sequence as follows:
     1-37: MESRGPLATSRLLLLLLLLLLRHTRQGWALRPVLPTQ → PRFKGSPAVLFKLTYAVITCFSLRLTHPPRPW
     285-293: KVVLSSGSG → EKTLPPLFA
     294-402: Missing.

Note: Incomplete sequence.
Show »
Length:288
Mass (Da):31,829
Checksum:iF5BCCF800F560461
GO
Isoform 3 (identifier: P04278-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     285-293: KVVLSSGSG → EKTLPPLFA
     294-402: Missing.

Note: No experimental confirmation available.
Show »
Length:293
Mass (Da):32,363
Checksum:iB88FA1CEE7F97A7E
GO
Isoform 4 (identifier: P04278-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     239-353: Missing.

Show »
Length:287
Mass (Da):31,720
Checksum:i04D30318BC6B1191
GO
Isoform 5 (identifier: P04278-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     186-203: Missing.

Show »
Length:384
Mass (Da):41,712
Checksum:iACAF2C28914C13D1
GO

Computationally mapped potential isoform sequencesi

There are 14 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B4DYU0B4DYU0_HUMAN
cDNA FLJ51403, highly similar to Se...
SHBG
235Annotation score:
I3L0M1I3L0M1_HUMAN
Sex hormone-binding globulin
SHBG
181Annotation score:
I3L145I3L145_HUMAN
Sex hormone-binding globulin, isofo...
SHBG hCG_42018
344Annotation score:
I3L4D0I3L4D0_HUMAN
Sex hormone-binding globulin
SHBG
57Annotation score:
B0FWH6B0FWH6_HUMAN
Sex hormone-binding globulin
SHBG
206Annotation score:
I3L1J1I3L1J1_HUMAN
Sex hormone-binding globulin
SHBG
229Annotation score:
B0FWH7B0FWH7_HUMAN
Sex hormone-binding globulin
SHBG
113Annotation score:
I3L4B9I3L4B9_HUMAN
Sex hormone-binding globulin
SHBG
175Annotation score:
I3L2X4I3L2X4_HUMAN
Sex hormone-binding globulin
SHBG
290Annotation score:
I3L1C1I3L1C1_HUMAN
Sex hormone-binding globulin
SHBG
93Annotation score:
There are more potential isoformsShow all

Sequence cautioni

The sequence CAA29309 differs from that shown. Reason: Frameshift at positions 47, 52 and 54.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti22R → Q in CAA28987 (PubMed:15489334).Curated1
Sequence conflicti334A → L in AAC18778 (PubMed:2608061).Curated1
Sequence conflicti336L → S in AAC18778 (PubMed:2608061).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02200222R → H. Corresponds to variant dbSNP:rs9282845Ensembl.1
Natural variantiVAR_01394625R → H1 PublicationCorresponds to variant dbSNP:rs6260Ensembl.1
Natural variantiVAR_016182185P → L. Corresponds to variant dbSNP:rs6258Ensembl.1
Natural variantiVAR_013129356D → N Polymorphism; generates a N-glycosylation site. 3 PublicationsCorresponds to variant dbSNP:rs6259Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0060901 – 37MESRG…VLPTQ → PRFKGSPAVLFKLTYAVITC FSLRLTHPPRPW in isoform 2. CuratedAdd BLAST37
Alternative sequenceiVSP_045376186 – 203Missing in isoform 5. CuratedAdd BLAST18
Alternative sequenceiVSP_045358239 – 353Missing in isoform 4. 1 PublicationAdd BLAST115
Alternative sequenceiVSP_006091285 – 293KVVLSSGSG → EKTLPPLFA in isoform 2 and isoform 3. 1 Publication9
Alternative sequenceiVSP_006092294 – 402Missing in isoform 2 and isoform 3. 1 PublicationAdd BLAST109

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X16349 Genomic DNA Translation: CAA34398.1
X16350 Genomic DNA Translation: CAA34399.1
X16351 mRNA Translation: CAA34400.1
M31651 Genomic DNA Translation: AAC18778.1
CD013955 mRNA No translation available.
BC069597 mRNA Translation: AAH69597.1
BC101785 mRNA Translation: AAI01786.1
BC112186 mRNA Translation: AAI12187.1
AC007421 Genomic DNA No translation available.
X05403 mRNA Translation: CAA28987.1
EU352661 mRNA Translation: ABY67999.1
X05885 mRNA Translation: CAA29309.1 Frameshift.
X05792 mRNA Translation: CAA29234.1
CCDSiCCDS11117.1 [P04278-1]
CCDS54082.1 [P04278-3]
CCDS54083.1 [P04278-4]
CCDS58513.1 [P04278-5]
PIRiS09606 BOHUS
RefSeqiNP_001031.2, NM_001040.4 [P04278-1]
NP_001139751.1, NM_001146279.2 [P04278-5]
NP_001139752.1, NM_001146280.2 [P04278-3]
NP_001139753.1, NM_001146281.2 [P04278-4]
NP_001276042.1, NM_001289113.1
NP_001276043.1, NM_001289114.1
NP_001276044.1, NM_001289115.1
NP_001276045.1, NM_001289116.1
UniGeneiHs.632235

Genome annotation databases

EnsembliENST00000380450; ENSP00000369816; ENSG00000129214 [P04278-1]
ENST00000416273; ENSP00000388867; ENSG00000129214 [P04278-3]
ENST00000441599; ENSP00000393426; ENSG00000129214 [P04278-4]
ENST00000575903; ENSP00000458973; ENSG00000129214 [P04278-5]
GeneIDi6462
KEGGihsa:6462
UCSCiuc002gie.4 human [P04278-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Web resourcesi

Wikipedia

Androgen-binding protein entry

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X16349 Genomic DNA Translation: CAA34398.1
X16350 Genomic DNA Translation: CAA34399.1
X16351 mRNA Translation: CAA34400.1
M31651 Genomic DNA Translation: AAC18778.1
CD013955 mRNA No translation available.
BC069597 mRNA Translation: AAH69597.1
BC101785 mRNA Translation: AAI01786.1
BC112186 mRNA Translation: AAI12187.1
AC007421 Genomic DNA No translation available.
X05403 mRNA Translation: CAA28987.1
EU352661 mRNA Translation: ABY67999.1
X05885 mRNA Translation: CAA29309.1 Frameshift.
X05792 mRNA Translation: CAA29234.1
CCDSiCCDS11117.1 [P04278-1]
CCDS54082.1 [P04278-3]
CCDS54083.1 [P04278-4]
CCDS58513.1 [P04278-5]
PIRiS09606 BOHUS
RefSeqiNP_001031.2, NM_001040.4 [P04278-1]
NP_001139751.1, NM_001146279.2 [P04278-5]
NP_001139752.1, NM_001146280.2 [P04278-3]
NP_001139753.1, NM_001146281.2 [P04278-4]
NP_001276042.1, NM_001289113.1
NP_001276043.1, NM_001289114.1
NP_001276044.1, NM_001289115.1
NP_001276045.1, NM_001289116.1
UniGeneiHs.632235

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1D2SX-ray1.55A42-217[»]
1F5FX-ray1.70A30-234[»]
1KDKX-ray1.70A41-217[»]
1KDMX-ray2.35A41-217[»]
1LHNX-ray2.00A30-218[»]
1LHOX-ray2.00A30-218[»]
1LHUX-ray1.80A30-218[»]
1LHVX-ray2.00A30-218[»]
1LHWX-ray1.75A30-218[»]
ProteinModelPortaliP04278
SMRiP04278
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112359, 58 interactors
IntActiP04278, 2 interactors
STRINGi9606.ENSP00000369816

Chemistry databases

BindingDBiP04278
ChEMBLiCHEMBL3305
DrugBankiDB02342 2-Methoxyestradiol
DB01406 Danazol
DB02901 Dihydrotestosterone
DB00858 Drostanolone
DB00783 Estradiol
DB04574 Estrone sulfate
DB01185 Fluoxymesterone
DB00741 Hydrocortisone
DB06710 Methyltestosterone
DB00648 Mitotane
DB00717 Norethisterone
DB06412 Oxymetholone
DB00421 Spironolactone
DB00624 Testosterone

Protein family/group databases

MoonDBiP04278 Predicted

PTM databases

GlyConnecti562
iPTMnetiP04278
PhosphoSitePlusiP04278
UniCarbKBiP04278

Polymorphism and mutation databases

BioMutaiSHBG
DMDMi134907

Proteomic databases

PaxDbiP04278
PeptideAtlasiP04278
PRIDEiP04278
ProteomicsDBi51697
51698 [P04278-2]

Protocols and materials databases

DNASUi6462
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000380450; ENSP00000369816; ENSG00000129214 [P04278-1]
ENST00000416273; ENSP00000388867; ENSG00000129214 [P04278-3]
ENST00000441599; ENSP00000393426; ENSG00000129214 [P04278-4]
ENST00000575903; ENSP00000458973; ENSG00000129214 [P04278-5]
GeneIDi6462
KEGGihsa:6462
UCSCiuc002gie.4 human [P04278-1]

Organism-specific databases

CTDi6462
DisGeNETi6462
EuPathDBiHostDB:ENSG00000129214.14
GeneCardsiSHBG
HGNCiHGNC:10839 SHBG
MIMi182205 gene
neXtProtiNX_P04278
OpenTargetsiENSG00000129214
PharmGKBiPA35745
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IKW6 Eukaryota
ENOG410YKMT LUCA
GeneTreeiENSGT00930000150853
HOGENOMiHOG000285982
HOVERGENiHBG017800
InParanoidiP04278
OMAiTHAEFSL
OrthoDBiEOG091G0D6A
PhylomeDBiP04278
TreeFamiTF334367

Miscellaneous databases

ChiTaRSiSHBG human
EvolutionaryTraceiP04278
GeneWikiiSex_hormone-binding_globulin
GenomeRNAii6462
PROiPR:P04278
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000129214 Expressed in 92 organ(s), highest expression level in right lobe of liver
CleanExiHS_SHBG
ExpressionAtlasiP04278 baseline and differential
GenevisibleiP04278 HS

Family and domain databases

InterProiView protein in InterPro
IPR013320 ConA-like_dom_sf
IPR001791 Laminin_G
PfamiView protein in Pfam
PF00054 Laminin_G_1, 1 hit
SMARTiView protein in SMART
SM00282 LamG, 1 hit
SUPFAMiSSF49899 SSF49899, 2 hits
PROSITEiView protein in PROSITE
PS50025 LAM_G_DOMAIN, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiSHBG_HUMAN
AccessioniPrimary (citable) accession number: P04278
Secondary accession number(s): B0FWH4
, E9PGW1, F5H5Z8, I3L1N7, P14689, Q16616, Q3MIL0, Q6ISD2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 20, 1987
Last sequence update: April 1, 1990
Last modified: November 7, 2018
This is version 184 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again