CD3D

Functionⁱ

Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways (PubMed:2470098). In addition of this role of signal transduction in T-cell activation, CD3D plays an essential role in thymocyte differentiation. Indeed, participates in correct intracellular TCR-CD3 complex assembly and surface expression. In absence of a functional TCR-CD3 complex, thymocytes are unable to differentiate properly. Interacts with CD4 and CD8 and thus serves to establish a functional link between the TCR and coreceptors CD4 and CD8, which is needed for activation and positive selection of CD4 or CD8 T-cells(PubMed:12215456).3 Publications

GO - Molecular functionⁱ

protein heterodimerization activity
Source: UniProtKB
Inferred from physical interactionⁱ
- 9485181
protein homodimerization activity
Source: CAFA
Inferred from mutant phenotypeⁱ
- 14967045
transcription coactivator activity
Source: MGI
Inferred from direct assayⁱ
- 2017177
transmembrane signaling receptor activity
Source: UniProtKB
Inferred by curatorⁱ
- 9485181

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

adaptive immune response Source: UniProtKB-KW
cell surface receptor signaling pathway
Source: UniProtKB
Inferred by curatorⁱ
- 9485181
membrane organization Source: Reactome
positive regulation of transcription by RNA polymerase II
Source: MGI
Inferred from direct assayⁱ
- 2017177
positive thymic T cell selection Source: UniProtKB
protein homooligomerization
Source: CAFA
Inferred from mutant phenotypeⁱ
- 14967045
regulation of immune response Source: Reactome
T cell differentiation
Source: MGI
Inferred from direct assayⁱ
- 2017177
T cell receptor signaling pathway Source: Reactome

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Receptor
Biological process	Adaptive immunity, Immunity

Enzyme and pathway databases

Reactomeⁱ	R-HSA-198933 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell R-HSA-202424 Downstream TCR signaling R-HSA-202427 Phosphorylation of CD3 and TCR zeta chains R-HSA-202430 Translocation of ZAP-70 to Immunological synapse R-HSA-202433 Generation of second messenger molecules R-HSA-389948 PD-1 signaling R-HSA-8856825 Cargo recognition for clathrin-mediated endocytosis R-HSA-8856828 Clathrin-mediated endocytosis
SIGNORⁱ	P04234

Reactomeⁱ

R-HSA-198933 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
R-HSA-202424 Downstream TCR signaling
R-HSA-202427 Phosphorylation of CD3 and TCR zeta chains
R-HSA-202430 Translocation of ZAP-70 to Immunological synapse
R-HSA-202433 Generation of second messenger molecules
R-HSA-389948 PD-1 signaling
R-HSA-8856825 Cargo recognition for clathrin-mediated endocytosis
R-HSA-8856828 Clathrin-mediated endocytosis

SIGNORⁱ

P04234

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: T-cell surface glycoprotein CD3 delta chain Alternative name(s): T-cell receptor T3 delta chain CD_antigen: CD3d
Gene namesⁱ	Name:CD3D Synonyms:T3D
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 11

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000167286.9
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:1673 CD3D
MIMⁱ	186790 gene
neXtProtⁱ	NX_P04234

Topology

Feature key	Position(s)	DescriptionActions	Length
Topological domainⁱ	22 – 105	ExtracellularSequence analysisAdd BLAST	84
Transmembraneⁱ	106 – 126	HelicalSequence analysisAdd BLAST	21
Topological domainⁱ	127 – 171	CytoplasmicSequence analysisAdd BLAST	45

Keywords - Cellular componentⁱ

Cell membrane, Membrane

Pathology & Biotechⁱ

Involvement in diseaseⁱ

Immunodeficiency 19 (IMD19)3 Publications

The disease is caused by mutations affecting the gene represented in this entry.

Disease descriptionAn autosomal recessive form of severe combined immunodeficiency characterized by onset in early infancy of recurrent bacterial, viral, and fungal infections. Patients usually have chronic diarrhea, recurrent respiratory infections, and failure to thrive. Immunologic work-up shows a T-cell negative, B-cell positive, NK-cell positive phenotype.

Keywords - Diseaseⁱ

SCID

Organism-specific databases

DisGeNET More...DisGeNETⁱ	915
MalaCards human disease database More...MalaCardsⁱ	CD3D
MIMⁱ	615617 phenotype
Open Targets More...OpenTargetsⁱ	ENSG00000167286
Orphanetⁱ	169160 T-B+ severe combined immunodeficiency due to CD3delta/CD3epsilon/CD3zeta
PharmGKBⁱ	PA26215

Chemistry databases

ChEMBLⁱ	CHEMBL2364168
Drug and drug target database More...DrugBankⁱ	DB09052 Blinatumomab DB00075 Muromonab

Polymorphism and mutation databases

BioMutaⁱ	CD3D
DMDMⁱ	115985

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Signal peptideⁱ	1 – 21	Add BLAST		21
ChainⁱPRO_0000016487	22 – 171	T-cell surface glycoprotein CD3 delta chainAdd BLAST		150

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Length
Disulfide bondⁱ	37 ↔ 73	1 Publication
Glycosylationⁱ	38	N-linked (GlcNAc...) asparagineSequence analysis	1
Glycosylationⁱ	74	N-linked (GlcNAc...) asparagineSequence analysis	1
Modified residueⁱ	149	PhosphotyrosineCombined sources	1
Modified residueⁱ	160	PhosphotyrosineCombined sources	1

Post-translational modificationⁱ

Phosphorylated on Tyr residues after T-cell receptor triggering by LCK in association with CD4/CD8.1 Publication

Keywords - PTMⁱ

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

MaxQB - The MaxQuant DataBase More...MaxQBⁱ	P04234
PaxDbⁱ	P04234
PeptideAtlas More...PeptideAtlasⁱ	P04234
PRIDEⁱ	P04234
ProteomicsDBⁱ	51692

PTM databases

iPTMnetⁱ	P04234
PhosphoSitePlusⁱ	P04234
SwissPalmⁱ	P04234

Expressionⁱ

Tissue specificityⁱ

CD3D is mostly present on T-lymphocytes with its TCR-CD3 partners. Present also in fetal NK-cells.1 Publication

Gene expression databases

Bgeeⁱ	ENSG00000167286 Expressed in 166 organ(s), highest expression level in thymus
CleanExⁱ	HS_CD3D
ExpressionAtlasⁱ	P04234 baseline and differential
Genevisibleⁱ	P04234 HS

Organism-specific databases

Human Protein Atlas More...HPAⁱ	CAB013055

HPAⁱ

CAB013055

Interactionⁱ

Subunit structureⁱ

The TCR-CD3 complex is composed of a CD3D/CD3E and a CD3G/CD3E heterodimers that preferentially associate with TCRalpha and TCRbeta, respectively, to form TCRalpha/CD3E/CD3G and TCRbeta/CD3G/CD3E trimers. In turn, the hexamer interacts with CD3Z homodimer to form the TCR-CD3 complex. Alternatively, TCRalpha and TCRbeta can be replaced by TCRgamma and TCRdelta. Interacts with coreceptors CD4 and CD8 (PubMed:1396954, PubMed:12215456).5 Publications

GO - Molecular functionⁱ

protein heterodimerization activity
Source: UniProtKB
Inferred from physical interactionⁱ
- 9485181
protein homodimerization activity
Source: CAFA
Inferred from mutant phenotypeⁱ
- 14967045

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

BioGridⁱ	107353, 9 interactors
Database of interacting proteins More...DIPⁱ	DIP-42855N
ELMⁱ	P04234
IntActⁱ	P04234, 6 interactors
Molecular INTeraction database More...MINTⁱ	P04234
STRINGⁱ	9606.ENSP00000300692

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Beta strandⁱ	26 – 29	Combined sources	4
Beta strandⁱ	32 – 36	Combined sources	5
Beta strandⁱ	41 – 46	Combined sources	6
Beta strandⁱ	50 – 52	Combined sources	3
Helixⁱ	53 – 55	Combined sources	3
Beta strandⁱ	57 – 62	Combined sources	6
Helixⁱ	63 – 65	Combined sources	3
Beta strandⁱ	68 – 73	Combined sources	6
Beta strandⁱ	84 – 91	Combined sources	8

Show more details

3D structure databases

Database of protein disorder More...DisProtⁱ	DP00505
ProteinModelPortalⁱ	P04234
SMRⁱ	P04234
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ	P04234

EvolutionaryTraceⁱ

P04234

Family & Domainsⁱ

Domains and Repeats

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Domainⁱ	138 – 166	ITAMPROSITE-ProRule annotationAdd BLAST		29

Keywords - Domainⁱ

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGⁱ	ENOG410IWAX Eukaryota ENOG410Y2TD LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00510000046930
HOGENOMⁱ	HOG000015287
HOVERGENⁱ	HBG005278
InParanoidⁱ	P04234
KEGG Orthology (KO) More...KOⁱ	K06450
OMAⁱ	MCQSCVE
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G0U7X
PhylomeDBⁱ	P04234
TreeFamⁱ	TF335892

Family and domain databases

Gene3Dⁱ	2.60.40.10, 1 hit
InterProⁱ	View protein in InterPro IPR015484 CD3_esu/gsu/dsu IPR015485 CD3D IPR036179 Ig-like_dom_sf IPR013783 Ig-like_fold IPR032052 Ig_4 IPR003110 Phos_immunorcpt_sig_ITAM
PANTHERⁱ	PTHR10570 PTHR10570, 1 hit PTHR10570:SF5 PTHR10570:SF5, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF16680 Ig_4, 1 hit PF02189 ITAM, 1 hit
SMARTⁱ	View protein in SMART SM00077 ITAM, 1 hit
SUPFAMⁱ	SSF48726 SSF48726, 1 hit
PROSITEⁱ	View protein in PROSITE PS51055 ITAM_1, 1 hit

Sequences (2+)ⁱ

Sequence statusⁱ: Complete.

Sequence processingⁱ: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsⁱ produced by alternative splicing. Align Add to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show all Align All

Isoform 1 (identifier: P04234-1) [UniParc]FASTA Add to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEHSTFLSGL VLATLLSQVS PFKIPIEELE DRVFVNCNTS ITWVEGTVGT 
        60         70         80         90        100
LLSDITRLDL GKRILDPRGI YRCNGTDIYK DKESTVQVHY RMCQSCVELD 
       110        120        130        140        150
PATVAGIIVT DVIATLLLAL GVFCFAGHET GRLSGAADTQ ALLRNDQVYQ 
       160        170 
PLRDRDDAQY SHLGGNWARN K

Length:171

Mass (Da):18,930

Last modified:March 20, 1987 - v1

Checksum:ⁱ6C1F248150186D21

GO

Isoform 2 (identifier: P04234-2) [UniParc]FASTA Add to basket

The sequence of this isoform differs from the canonical sequence as follows:
92-136: MCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGA → T

« Hide

        10         20         30         40         50
MEHSTFLSGL VLATLLSQVS PFKIPIEELE DRVFVNCNTS ITWVEGTVGT 
        60         70         80         90        100
LLSDITRLDL GKRILDPRGI YRCNGTDIYK DKESTVQVHY RTADTQALLR 
       110        120 
NDQVYQPLRD RDDAQYSHLG GNWARNK

Note: No experimental confirmation available.

Show »

Length:127

Mass (Da):14,484

Checksum:ⁱ1E879A1CC76B9856

GO

Computationally mapped potential isoform sequencesⁱ

There are 2 potential isoforms mapped to this entry.BLAST Align Show all Add to basket

Entry	Entry name	Protein names	Gene names	Length	Annotation

E9PMT5	E9PMT5_HUMAN	T-cell surface glycoprotein CD3 del... T-cell surface glycoprotein CD3 delta chain	CD3D	98	Annotation score:
H0YE18	H0YE18_HUMAN	T-cell surface glycoprotein CD3 del... T-cell surface glycoprotein CD3 delta chain	CD3D	132	Annotation score:

Natural variant

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Natural variantⁱVAR_049646	147	Q → R. Corresponds to variant dbSNP:rs45510201Ensembl.		1

Alternative sequence

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Alternative sequenceⁱVSP_045800	92 – 136	MCQSC…RLSGA → T in isoform 2. 1 PublicationAdd BLAST		45

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	X03934 Genomic DNA Translation: CAA27573.1 M12727, M12726 Genomic DNA Translation: AAA51792.1 CD014058 mRNA No translation available. AP001582 Genomic DNA No translation available. BC039035 mRNA Translation: AAH39035.1 BC070321 mRNA Translation: AAH70321.1 X01451 Genomic DNA Translation: CAA25683.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS41724.1 [P04234-2] CCDS8394.1 [P04234-1]
PIRⁱ	A94706 RWHUD1
NCBI Reference Sequences More...RefSeqⁱ	NP_000723.1, NM_000732.4 [P04234-1] NP_001035741.1, NM_001040651.1 [P04234-2] XP_016874032.1, XM_017018543.1
UniGeneⁱ	Hs.504048

Genome annotation databases

Ensemblⁱ	ENST00000300692; ENSP00000300692; ENSG00000167286 [P04234-1] ENST00000392884; ENSP00000376622; ENSG00000167286 [P04234-2]
GeneIDⁱ	915
KEGGⁱ	hsa:915
UCSC genome browser More...UCSCⁱ	uc001pss.2 human [P04234-1]

Keywords - Coding sequence diversityⁱ

Alternative splicing, Polymorphism

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
P04234	CD3d antigen, delta polypeptide (TiT3 complex), isoform CRA_a		HUMAN		171	UniRef100_P04234
CD3 delta (Fragment)		HUMAN		72

Protein	Similar proteins		Species	Score	Length	Source
P04234	CD3d antigen, delta polypeptide (TiT3 complex), isoform CRA_a		HUMAN		171	UniRef90_P04234
CD3D isoform 1		PANTR		171
Uncharacterized protein		PANPA		171
Uncharacterized protein		RHIRO		171
Uncharacterized protein		RHIBE		171
+9
P04234-2	CD3D isoform 4		PANTR		127	UniRef90_P04234-2
Uncharacterized protein		PANPA		127
Uncharacterized protein		MACMU		127
Uncharacterized protein		MACFA		127
Uncharacterized protein		COLAP		127
+9

Protein	Similar proteins		Species	Score	Length	Source
P04234	CD3d antigen, delta polypeptide (TiT3 complex), isoform CRA_a		HUMAN		171	UniRef50_P04234
Uncharacterized protein		CHLSB		171
Uncharacterized protein		MACNE		171
Uncharacterized protein		RHIRO		171
Uncharacterized protein		RHIBE		171
+61
P04234-2	CD3d molecule		GORGO		127	UniRef50_P04234-2
Uncharacterized protein		RHIRO		127
Uncharacterized protein		RHIBE		127
Uncharacterized protein		MANLE		127
Uncharacterized protein		CERAT		127
+39

Cross-referencesⁱ

Web resourcesⁱ

CD3Dbase

CD3D mutation db

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	X03934 Genomic DNA Translation: CAA27573.1 M12727, M12726 Genomic DNA Translation: AAA51792.1 CD014058 mRNA No translation available. AP001582 Genomic DNA No translation available. BC039035 mRNA Translation: AAH39035.1 BC070321 mRNA Translation: AAH70321.1 X01451 Genomic DNA Translation: CAA25683.1
CCDSⁱ	CCDS41724.1 [P04234-2] CCDS8394.1 [P04234-1]
PIRⁱ	A94706 RWHUD1
RefSeqⁱ	NP_000723.1, NM_000732.4 [P04234-1] NP_001035741.1, NM_001040651.1 [P04234-2] XP_016874032.1, XM_017018543.1
UniGeneⁱ	Hs.504048

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	1XIW	X-ray	1.90	B/F	23-100	[»]
DisProtⁱ	DP00505
ProteinModelPortalⁱ	P04234
SMRⁱ	P04234
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	107353, 9 interactors
DIPⁱ	DIP-42855N
ELMⁱ	P04234
IntActⁱ	P04234, 6 interactors
MINTⁱ	P04234
STRINGⁱ	9606.ENSP00000300692

Chemistry databases

ChEMBLⁱ	CHEMBL2364168
DrugBankⁱ	DB09052 Blinatumomab DB00075 Muromonab

PTM databases

iPTMnetⁱ	P04234
PhosphoSitePlusⁱ	P04234
SwissPalmⁱ	P04234

Polymorphism and mutation databases

BioMutaⁱ	CD3D
DMDMⁱ	115985

Proteomic databases

MaxQBⁱ	P04234
PaxDbⁱ	P04234
PeptideAtlasⁱ	P04234
PRIDEⁱ	P04234
ProteomicsDBⁱ	51692

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

Ensemblⁱ	ENST00000300692; ENSP00000300692; ENSG00000167286 [P04234-1] ENST00000392884; ENSP00000376622; ENSG00000167286 [P04234-2]
GeneIDⁱ	915
KEGGⁱ	hsa:915
UCSCⁱ	uc001pss.2 human [P04234-1]

Organism-specific databases

CTDⁱ	915
DisGeNETⁱ	915
EuPathDBⁱ	HostDB:ENSG00000167286.9
GeneCardsⁱ	CD3D
HGNCⁱ	HGNC:1673 CD3D
HPAⁱ	CAB013055
MalaCardsⁱ	CD3D
MIMⁱ	186790 gene 615617 phenotype
neXtProtⁱ	NX_P04234
OpenTargetsⁱ	ENSG00000167286
Orphanetⁱ	169160 T-B+ severe combined immunodeficiency due to CD3delta/CD3epsilon/CD3zeta
PharmGKBⁱ	PA26215
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	ENOG410IWAX Eukaryota ENOG410Y2TD LUCA
GeneTreeⁱ	ENSGT00510000046930
HOGENOMⁱ	HOG000015287
HOVERGENⁱ	HBG005278
InParanoidⁱ	P04234
KOⁱ	K06450
OMAⁱ	MCQSCVE
OrthoDBⁱ	EOG091G0U7X
PhylomeDBⁱ	P04234
TreeFamⁱ	TF335892

Enzyme and pathway databases

Reactomeⁱ	R-HSA-198933 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell R-HSA-202424 Downstream TCR signaling R-HSA-202427 Phosphorylation of CD3 and TCR zeta chains R-HSA-202430 Translocation of ZAP-70 to Immunological synapse R-HSA-202433 Generation of second messenger molecules R-HSA-389948 PD-1 signaling R-HSA-8856825 Cargo recognition for clathrin-mediated endocytosis R-HSA-8856828 Clathrin-mediated endocytosis
SIGNORⁱ	P04234

Reactomeⁱ

R-HSA-198933 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
R-HSA-202424 Downstream TCR signaling
R-HSA-202427 Phosphorylation of CD3 and TCR zeta chains
R-HSA-202430 Translocation of ZAP-70 to Immunological synapse
R-HSA-202433 Generation of second messenger molecules
R-HSA-389948 PD-1 signaling
R-HSA-8856825 Cargo recognition for clathrin-mediated endocytosis
R-HSA-8856828 Clathrin-mediated endocytosis

SIGNORⁱ

P04234

Miscellaneous databases

ChiTaRSⁱ	CD3D human
EvolutionaryTraceⁱ	P04234
GeneWikiⁱ	CD3D
GenomeRNAiⁱ	915
Protein Ontology More...PROⁱ	PR:P04234
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000167286 Expressed in 166 organ(s), highest expression level in thymus
CleanExⁱ	HS_CD3D
ExpressionAtlasⁱ	P04234 baseline and differential
Genevisibleⁱ	P04234 HS

Family and domain databases

Gene3Dⁱ	2.60.40.10, 1 hit
InterProⁱ	View protein in InterPro IPR015484 CD3_esu/gsu/dsu IPR015485 CD3D IPR036179 Ig-like_dom_sf IPR013783 Ig-like_fold IPR032052 Ig_4 IPR003110 Phos_immunorcpt_sig_ITAM
PANTHERⁱ	PTHR10570 PTHR10570, 1 hit PTHR10570:SF5 PTHR10570:SF5, 1 hit
Pfamⁱ	View protein in Pfam PF16680 Ig_4, 1 hit PF02189 ITAM, 1 hit
SMARTⁱ	View protein in SMART SM00077 ITAM, 1 hit
SUPFAMⁱ	SSF48726 SSF48726, 1 hit
PROSITEⁱ	View protein in PROSITE PS51055 ITAM_1, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	CD3D_HUMAN
Accessionⁱ	P04234Primary (citable) accession number: P04234 Secondary accession number(s): A8MVP6
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	March 20, 1987
	Last sequence update:	March 20, 1987
	Last modified:	October 10, 2018
	This is version 188 of the entry and version 1 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

Human chromosome 11
Human chromosome 11: entries, gene names and cross-references to MIM
PDB cross-references
Index of Protein Data Bank (PDB) cross-references
Human cell differentiation molecules
CD nomenclature of surface proteins of human leucocytes and list of entries
Human polymorphisms and disease mutations
Index of human polymorphisms and disease mutations
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
Human entries with polymorphisms or disease mutations
List of human entries with polymorphisms or disease mutations

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P04234 (CD3D_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

T-cell surface glycoprotein CD3 delta chain

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Plasma membrane

Plasma Membrane

Other locations

Topology

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Keywords - Diseasei

Organism-specific databases

Chemistry databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Keywords - Domaini

Phylogenomic databases

Family and domain databases

Natural variant

Alternative sequence

Sequence databases

Genome annotation databases

Keywords - Coding sequence diversityi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Chemistry databases

PTM databases

Polymorphism and mutation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

Keywords - Diseaseⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

GO - Molecular functionⁱ

Structureⁱ

Family & Domainsⁱ

Keywords - Domainⁱ

Keywords - Coding sequence diversityⁱ

Cross-referencesⁱ

Web resourcesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ