Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
The new UniProt website is here! Take me to UniProt BETA

UniProtKB - P04234 (CD3D_HUMAN)

Entry version 211 (25 May 2022)
Sequence version 1 (20 Mar 1987)
Previous versions | rss
Add a publicationFeedback
Protein

T-cell surface glycoprotein CD3 delta chain

Gene

CD3D

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways (PubMed:2470098).

In addition of this role of signal transduction in T-cell activation, CD3D plays an essential role in thymocyte differentiation. Indeed, participates in correct intracellular TCR-CD3 complex assembly and surface expression. In absence of a functional TCR-CD3 complex, thymocytes are unable to differentiate properly. Interacts with CD4 and CD8 and thus serves to establish a functional link between the TCR and coreceptors CD4 and CD8, which is needed for activation and positive selection of CD4 or CD8 T-cells(PubMed:12215456).

3 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionReceptor
Biological processAdaptive immunity, Immunity

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		P04234

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-198933, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
R-HSA-202424, Downstream TCR signaling
R-HSA-202427, Phosphorylation of CD3 and TCR zeta chains
R-HSA-202430, Translocation of ZAP-70 to Immunological synapse
R-HSA-202433, Generation of second messenger molecules
R-HSA-389948, PD-1 signaling
R-HSA-8856825, Cargo recognition for clathrin-mediated endocytosis
R-HSA-8856828, Clathrin-mediated endocytosis

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		P04234

SIGNOR Signaling Network Open Resource

More...SIGNORi		P04234

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
T-cell surface glycoprotein CD3 delta chain
Alternative name(s):
T-cell receptor T3 delta chain
CD_antigen: CD3d
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CD3D
Synonyms:T3D
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:1673, CD3D

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		186790, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P04234

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000167286

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini22 – 105ExtracellularSequence analysisAdd BLAST84
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei106 – 126HelicalSequence analysisAdd BLAST21
Topological domaini127 – 171CytoplasmicSequence analysisAdd BLAST45

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Immunodeficiency 19 (IMD19)3 Publications
The disease is caused by variants affecting the gene represented in this entry.
Disease descriptionAn autosomal recessive form of severe combined immunodeficiency characterized by onset in early infancy of recurrent bacterial, viral, and fungal infections. Patients usually have chronic diarrhea, recurrent respiratory infections, and failure to thrive. Immunologic work-up shows a T-cell negative, B-cell positive, NK-cell positive phenotype.
Related information in OMIM

Keywords - Diseasei

SCID

Organism-specific databases

DisGeNET

More...DisGeNETi		915

MalaCards human disease database

More...MalaCardsi		CD3D
MIMi615617, phenotype

Open Targets

More...OpenTargetsi		ENSG00000167286

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		169160, T-B+ severe combined immunodeficiency due to CD3delta/CD3epsilon/CD3zeta

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA26215

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P04234, Tclin

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL2364168

Drug and drug target database

More...DrugBanki		DB09052, Blinatumomab
DB00075, Muromonab

DrugCentral

More...DrugCentrali		P04234

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		CD3D

Domain mapping of disease mutations (DMDM)

More...DMDMi		115985

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 21Add BLAST21
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001648722 – 171T-cell surface glycoprotein CD3 delta chainAdd BLAST150

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi37 ↔ 731 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi38N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi74N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei149PhosphotyrosineCombined sources1
Modified residuei160PhosphotyrosineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated on Tyr residues after T-cell receptor triggering by LCK in association with CD4/CD8.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P04234

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P04234

MaxQB - The MaxQuant DataBase

More...MaxQBi		P04234

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P04234

PeptideAtlas

More...PeptideAtlasi		P04234

PRoteomics IDEntifications database

More...PRIDEi		P04234

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		2194
51692 [P04234-1]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		P04234, 2 sites

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P04234

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P04234

SwissPalm database of S-palmitoylation events

More...SwissPalmi		P04234

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

CD3D is mostly present on T-lymphocytes with its TCR-CD3 partners. Present also in fetal NK-cells.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000167286, Expressed in thymus and 187 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P04234, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P04234, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000167286, Tissue enriched (lymphoid)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

The TCR-CD3 complex is composed of a CD3D/CD3E and a CD3G/CD3E heterodimers that preferentially associate with TCRalpha and TCRbeta, respectively, to form TCRalpha/CD3E/CD3G and TCRbeta/CD3G/CD3E trimers. In turn, the hexamer interacts with CD3Z homodimer to form the TCR-CD3 complex. Alternatively, TCRalpha and TCRbeta can be replaced by TCRgamma and TCRdelta.

Interacts with coreceptors CD4 and CD8 (PubMed:1396954, PubMed:12215456).

5 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		107353, 83 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...ComplexPortali		CPX-6482, Alpha-beta T cell receptor complex, TRBC2 variant
CPX-6581, Alpha-beta T cell receptor complex, TRBC1 variant

Database of interacting proteins

More...DIPi		DIP-42855N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...ELMi		P04234

Protein interaction database and analysis system

More...IntActi		P04234, 6 interactors

Molecular INTeraction database

More...MINTi		P04234

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000300692

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P04234, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1171
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

AlphaFold Protein Structure Database

More...AlphaFoldDBi		P04234

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P04234

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		P04234

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini138 – 166ITAMPROSITE-ProRule annotationAdd BLAST29

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502S4XC, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000153312

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_115449_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P04234

Identification of Orthologs from Complete Genome Data

More...OMAi		YQPLRDH

Database for complete collections of gene phylogenies

More...PhylomeDBi		P04234

TreeFam database of animal gene trees

More...TreeFami		TF335892

Family and domain databases

Database of protein disorder

More...DisProti		DP00505

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.60.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR015484, CD3_esu/gsu/dsu
IPR015485, CD3D
IPR036179, Ig-like_dom_sf
IPR013783, Ig-like_fold
IPR032052, Ig_4
IPR003110, Phos_immunorcpt_sig_ITAM

The PANTHER Classification System

More...PANTHERi		PTHR10570, PTHR10570, 1 hit
PTHR10570:SF5, PTHR10570:SF5, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF16680, Ig_4, 1 hit
PF02189, ITAM, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00077, ITAM, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF48726, SSF48726, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS51055, ITAM_1, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P04234-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEHSTFLSGL VLATLLSQVS PFKIPIEELE DRVFVNCNTS ITWVEGTVGT 
        60         70         80         90        100
LLSDITRLDL GKRILDPRGI YRCNGTDIYK DKESTVQVHY RMCQSCVELD 
       110        120        130        140        150
PATVAGIIVT DVIATLLLAL GVFCFAGHET GRLSGAADTQ ALLRNDQVYQ 
       160        170 
PLRDRDDAQY SHLGGNWARN K
Length:171
Mass (Da):18,930
Last modified:March 20, 1987 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i6C1F248150186D21
GO
Isoform 2 (identifier: P04234-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     92-136: MCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGA → T

Show »
Length:127
Mass (Da):14,484
Checksum:i1E879A1CC76B9856
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YE18H0YE18_HUMAN
T-cell surface glycoprotein CD3 del...
CD3D
132Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PMT5E9PMT5_HUMAN
CD3 delta
CD3D
98Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_049646147Q → R. Corresponds to variant dbSNP:rs45510201EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04580092 – 136MCQSC…RLSGA → T in isoform 2. 1 PublicationAdd BLAST45

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
X03934 Genomic DNA Translation: CAA27573.1
M12727, M12726 Genomic DNA Translation: AAA51792.1
CD014058 mRNA No translation available.
AP001582 Genomic DNA No translation available.
BC039035 mRNA Translation: AAH39035.1
BC070321 mRNA Translation: AAH70321.1
X01451 Genomic DNA Translation: CAA25683.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS41724.1 [P04234-2]
CCDS8394.1 [P04234-1]

Protein sequence database of the Protein Information Resource

More...PIRi		A94706, RWHUD1

NCBI Reference Sequences

More...RefSeqi		NP_000723.1, NM_000732.4 [P04234-1]
NP_001035741.1, NM_001040651.1 [P04234-2]
XP_016874032.1, XM_017018543.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000300692.9; ENSP00000300692.4; ENSG00000167286.10
ENST00000392884.2; ENSP00000376622.2; ENSG00000167286.10 [P04234-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		915

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:915

Matched Annotation from NCBI and EMBL-EBI (MANE) - Phase one

More...MANE-Selecti		ENST00000300692.9; ENSP00000300692.4; NM_000732.6; NP_000723.1

UCSC genome browser

More...UCSCi		uc001pss.2, human [P04234-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

CD3Dbase

CD3D mutation db

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X03934 Genomic DNA Translation: CAA27573.1
M12727, M12726 Genomic DNA Translation: AAA51792.1
CD014058 mRNA No translation available.
AP001582 Genomic DNA No translation available.
BC039035 mRNA Translation: AAH39035.1
BC070321 mRNA Translation: AAH70321.1
X01451 Genomic DNA Translation: CAA25683.1
CCDSiCCDS41724.1 [P04234-2]
CCDS8394.1 [P04234-1]
PIRiA94706, RWHUD1
RefSeqiNP_000723.1, NM_000732.4 [P04234-1]
NP_001035741.1, NM_001040651.1 [P04234-2]
XP_016874032.1, XM_017018543.1

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1XIWX-ray1.90B/F23-100[»]
6JXRelectron microscopy3.70d1-171[»]
AlphaFoldDBiP04234
SMRiP04234
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi107353, 83 interactors
ComplexPortaliCPX-6482, Alpha-beta T cell receptor complex, TRBC2 variant
CPX-6581, Alpha-beta T cell receptor complex, TRBC1 variant
DIPiDIP-42855N
ELMiP04234
IntActiP04234, 6 interactors
MINTiP04234
STRINGi9606.ENSP00000300692

Chemistry databases

ChEMBLiCHEMBL2364168
DrugBankiDB09052, Blinatumomab
DB00075, Muromonab
DrugCentraliP04234

PTM databases

GlyGeniP04234, 2 sites
iPTMnetiP04234
PhosphoSitePlusiP04234
SwissPalmiP04234

Genetic variation databases

BioMutaiCD3D
DMDMi115985

Proteomic databases

jPOSTiP04234
MassIVEiP04234
MaxQBiP04234
PaxDbiP04234
PeptideAtlasiP04234
PRIDEiP04234
ProteomicsDBi2194
51692 [P04234-1]

Protocols and materials databases

ABCD curated depository of sequenced antibodies

More...ABCDi		P04234, 1 sequenced antibody

Antibodypedia a portal for validated antibodies

More...Antibodypediai		4581, 873 antibodies from 41 providers

The DNASU plasmid repository

More...DNASUi		915

Genome annotation databases

EnsembliENST00000300692.9; ENSP00000300692.4; ENSG00000167286.10
ENST00000392884.2; ENSP00000376622.2; ENSG00000167286.10 [P04234-2]
GeneIDi915
KEGGihsa:915
MANE-SelectiENST00000300692.9; ENSP00000300692.4; NM_000732.6; NP_000723.1
UCSCiuc001pss.2, human [P04234-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		915
DisGeNETi915

GeneCards: human genes, protein and diseases

More...GeneCardsi		CD3D
HGNCiHGNC:1673, CD3D
HPAiENSG00000167286, Tissue enriched (lymphoid)
MalaCardsiCD3D
MIMi186790, gene
615617, phenotype
neXtProtiNX_P04234
OpenTargetsiENSG00000167286
Orphaneti169160, T-B+ severe combined immunodeficiency due to CD3delta/CD3epsilon/CD3zeta
PharmGKBiPA26215
VEuPathDBiHostDB:ENSG00000167286

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG502S4XC, Eukaryota
GeneTreeiENSGT00940000153312
HOGENOMiCLU_115449_0_0_1
InParanoidiP04234
OMAiYQPLRDH
PhylomeDBiP04234
TreeFamiTF335892

Enzyme and pathway databases

PathwayCommonsiP04234
ReactomeiR-HSA-198933, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
R-HSA-202424, Downstream TCR signaling
R-HSA-202427, Phosphorylation of CD3 and TCR zeta chains
R-HSA-202430, Translocation of ZAP-70 to Immunological synapse
R-HSA-202433, Generation of second messenger molecules
R-HSA-389948, PD-1 signaling
R-HSA-8856825, Cargo recognition for clathrin-mediated endocytosis
R-HSA-8856828, Clathrin-mediated endocytosis
SignaLinkiP04234
SIGNORiP04234

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		915, 119 hits in 1074 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		CD3D, human
EvolutionaryTraceiP04234

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		CD3D

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		915
PharosiP04234, Tclin

Protein Ontology

More...PROi		PR:P04234
RNActiP04234, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000167286, Expressed in thymus and 187 other tissues
ExpressionAtlasiP04234, baseline and differential
GenevisibleiP04234, HS

Family and domain databases

DisProtiDP00505
Gene3Di2.60.40.10, 1 hit
InterProiView protein in InterPro
IPR015484, CD3_esu/gsu/dsu
IPR015485, CD3D
IPR036179, Ig-like_dom_sf
IPR013783, Ig-like_fold
IPR032052, Ig_4
IPR003110, Phos_immunorcpt_sig_ITAM
PANTHERiPTHR10570, PTHR10570, 1 hit
PTHR10570:SF5, PTHR10570:SF5, 1 hit
PfamiView protein in Pfam
PF16680, Ig_4, 1 hit
PF02189, ITAM, 1 hit
SMARTiView protein in SMART
SM00077, ITAM, 1 hit
SUPFAMiSSF48726, SSF48726, 1 hit
PROSITEiView protein in PROSITE
PS51055, ITAM_1, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCD3D_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P04234
Secondary accession number(s): A8MVP6
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 20, 1987
Last sequence update: March 20, 1987
Last modified: May 25, 2022
This is version 211 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Direct protein sequencing, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  3. Human entries with genetic variants
    List of human entries with genetic variants
  4. Human variants curated from literature reports
    Index of human variants curated from literature reports
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again