Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ig gamma-3 chain C region

Gene
N/A
Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  • antigen binding Source: UniProtKB-KW
  • immunoglobulin receptor binding Source: AgBase

Names & Taxonomyi

Protein namesi
Recommended name:
Ig gamma-3 chain C region
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Unplaced

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei350 – 370HelicalSequence analysisAdd BLAST21
Topological domaini371 – 398CytoplasmicSequence analysisAdd BLAST28

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_0000153590‹1 – 398Ig gamma-3 chain C regionAdd BLAST›398

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi179N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi322N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi332N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

MaxQBiP03987
PeptideAtlasiP03987
PRIDEiP03987

PTM databases

iPTMnetiP03987
PhosphoSitePlusiP03987

Interactioni

GO - Molecular functioni

  • immunoglobulin receptor binding Source: AgBase

Protein-protein interaction databases

IntActiP03987, 2 interactors
MINTiP03987

Structurei

3D structure databases

ProteinModelPortaliP03987
SMRiP03987
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP03987

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 97CH1Add BLAST97
Regioni98 – 113HingeAdd BLAST16
Regioni114 – 223CH2Add BLAST110
Regioni224 – 327CH3Add BLAST104

Keywords - Domaini

Immunoglobulin C region, Immunoglobulin domain, Transmembrane, Transmembrane helix

Phylogenomic databases

HOVERGENiHBG005814

Family and domain databases

Gene3Di2.60.40.10, 3 hits
InterProiView protein in InterPro
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003006 Ig/MHC_CS
IPR003597 Ig_C1-set
PfamiView protein in Pfam
PF07654 C1-set, 3 hits
SMARTiView protein in SMART
SM00407 IGc1, 3 hits
SUPFAMiSSF48726 SSF48726, 3 hits
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 3 hits
PS00290 IG_MHC, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P03987-1) [UniParc]FASTAAdd to basket
Also known as: Membrane bound

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
TTTAPSVYPL VPGCSDTSGS SVTLGCLVKG YFPEPVTVKW NYGALSSGVR
60 70 80 90 100
TVSSVLQSGF YSLSSLVTVP SSTWPSQTVI CNVAHPASKT ELIKRIEPRI
110 120 130 140 150
PKPSTPPGSS CPPGNILGGP SVFIFPPKPK DALMISLTPK VTCVVVDVSE
160 170 180 190 200
DDPDVHVSWF VDNKEVHTAW TQPREAQYNS TFRVVSALPI QHQDWMRGKE
210 220 230 240 250
FKCKVNNKAL PAPIERTISK PKGRAQTPQV YTIPPPREQM SKKKVSLTCL
260 270 280 290 300
VTNFFSEAIS VEWERNGELE QDYKNTPPIL DSDGTYFLYS KLTVDTDSWL
310 320 330 340 350
QGEIFTCSVV HEALHNHHTQ KNLSRSPELE LNETCAEAQD GELDGLWTTI
360 370 380 390
TIFISLFLLS VCYSASVTLF KVKWIFSSVV QVKQTAIPDY RNMIGQGA
Length:398
Mass (Da):43,929
Last modified:August 1, 1991 - v2
Checksum:iCF7F264B50A41B95
GO
Isoform 2 (identifier: P03987-2) [UniParc]FASTAAdd to basket
Also known as: Secreted

The sequence of this isoform differs from the canonical sequence as follows:
     328-398: ELELNETCAEAQDGELDGLWTTITIFISLFLLSVCYSASVTLFKVKWIFSSVVQVKQTAIPDYRNMIGQGA → GK

Show »
Length:329
Mass (Da):36,228
Checksum:iF45827174182BAD6
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Non-terminal residuei11
Sequence conflicti329L → M in CAA24767 (PubMed:6314258).Curated1
Sequence conflicti333E → G in CAA24767 (PubMed:6314258).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_034613328 – 398ELELN…IGQGA → GK in isoform 2. CuratedAdd BLAST71

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
J00451 Genomic DNA Translation: AAB59655.1
V01526 Genomic DNA Translation: CAA24767.1 Sequence problems.
PIRiA02156 G3MSM
B02156 G3MSC
UniGeneiMm.342177

Genome annotation databases

UCSCiuc007pgp.1 mouse [P03987-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiIGHG3_MOUSE
AccessioniPrimary (citable) accession number: P03987
Secondary accession number(s): P22436
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 23, 1986
Last sequence update: August 1, 1991
Last modified: July 18, 2018
This is version 116 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health