UniProtKB - P03888 (NU1M_MOUSE)

BLAST

>sp|P03888|NU1M_MOUSE NADH-ubiquinone oxidoreductase chain 1 OS=Mus musculus OX=10090 GN=Mtnd1 PE=1 SV=3
MFFINILTLLVPILIAMAFLTLVERKILGYMQLRKGPNIVGPYGILQPFADAMKLFMKEP
MRPLTTSMSLFIIAPTLSLTLALSLWVPLPMPHPLINLNLGILFILATSSLSVYSILWSG
WASNSKYSLFGALRAVAQTISYEVTMAIILLSVLLMNGSYSLQTLITTQEHMWLLLPAWP
MAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFMAEYTNIILMNALTTI
IFLGPLYYINLPELYSTNFMMEALLLSSTFLWIRASYPRFRYDQLMHLLWKNFLPLTLAL
CMWHISLPIFTAGVPPYM

Align
Format
Add to basket Added to basket
History
Entry version 135 (07 Nov 2018)
Sequence version 3 (04 Jan 2005)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

NADH-ubiquinone oxidoreductase chain 1

Gene

Mtnd1

Organism

Mus musculus (Mouse)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).By similarity

Catalytic activityⁱ

NADH + ubiquinone + 5 H⁺(In) = NAD⁺ + ubiquinol + 4 H⁺(Out).

GO - Molecular functionⁱ

NADH dehydrogenase (ubiquinone) activity Source: UniProtKB-EC

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

aerobic respiration
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
response to drug Source: Ensembl
response to hydroperoxide Source: MGI
response to organic cyclic compound Source: Ensembl

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Translocase
Biological process	Electron transport, Respiratory chain, Transport
Ligand	NAD, Ubiquinone

Enzyme and pathway databases

Reactomeⁱ	R-MMU-611105 Respiratory electron transport R-MMU-6799198 Complex I biogenesis

Reactomeⁱ

R-MMU-611105 Respiratory electron transport
R-MMU-6799198 Complex I biogenesis

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: NADH-ubiquinone oxidoreductase chain 1 (EC:7.1.1.2) Alternative name(s): NADH dehydrogenase subunit 1
Gene namesⁱ	Name:Mtnd1 Synonyms:mt-Nd1, Nd1
Encoded onⁱ	Mitochondrion
Organismⁱ	Mus musculus (Mouse)
Taxonomic identifierⁱ	10090 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
Proteomesⁱ	UP000000589 Componentⁱ: Mitochondrion

Organism-specific databases

MGIⁱ	MGI:101787 mt-Nd1

Topology

Feature key	Position(s)	DescriptionActions	Length
Transmembraneⁱ	2 – 22	HelicalSequence analysisAdd BLAST	21
Transmembraneⁱ	70 – 90	HelicalSequence analysisAdd BLAST	21
Transmembraneⁱ	100 – 120	HelicalSequence analysisAdd BLAST	21
Transmembraneⁱ	136 – 156	HelicalSequence analysisAdd BLAST	21
Transmembraneⁱ	171 – 191	HelicalSequence analysisAdd BLAST	21
Transmembraneⁱ	231 – 251	HelicalSequence analysisAdd BLAST	21
Transmembraneⁱ	253 – 273	HelicalSequence analysisAdd BLAST	21
Transmembraneⁱ	293 – 313	HelicalSequence analysisAdd BLAST	21

Keywords - Cellular componentⁱ

Membrane, Mitochondrion, Mitochondrion inner membrane

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000117431	1 – 318	NADH-ubiquinone oxidoreductase chain 1Add BLAST		318

Proteomic databases

EPDⁱ	P03888
PaxDbⁱ	P03888
PRIDEⁱ	P03888

Expressionⁱ

Gene expression databases

Bgeeⁱ	ENSMUSG00000064341 Expressed in 20 organ(s), highest expression level in female gonad
ExpressionAtlasⁱ	P03888 baseline and differential

Interactionⁱ

Protein-protein interaction databases

BioGridⁱ	201547, 2 interactors
ComplexPortalⁱ	CPX-266 Mitochondrial respiratory chain complex I
CORUMⁱ	P03888
Database of interacting proteins More...DIPⁱ	DIP-61655N
IntActⁱ	P03888, 3 interactors
STRINGⁱ	10090.ENSMUSP00000080991

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Helixⁱ	3 – 31	Combined sources	29
Beta strandⁱ	39 – 44	Combined sources	6
Helixⁱ	47 – 55	Combined sources	9
Beta strandⁱ	64 – 66	Combined sources	3
Helixⁱ	68 – 84	Combined sources	17
Beta strandⁱ	91 – 93	Combined sources	3
Turnⁱ	99 – 102	Combined sources	4
Helixⁱ	103 – 122	Combined sources	20
Helixⁱ	126 – 142	Combined sources	17
Helixⁱ	145 – 151	Combined sources	7
Turnⁱ	152 – 155	Combined sources	4
Helixⁱ	162 – 164	Combined sources	3
Helixⁱ	165 – 168	Combined sources	4
Beta strandⁱ	170 – 172	Combined sources	3
Turnⁱ	174 – 178	Combined sources	5
Helixⁱ	179 – 191	Combined sources	13
Beta strandⁱ	196 – 198	Combined sources	3
Turnⁱ	204 – 206	Combined sources	3
Turnⁱ	208 – 211	Combined sources	4
Beta strandⁱ	212 – 214	Combined sources	3
Helixⁱ	217 – 236	Combined sources	20
Helixⁱ	238 – 241	Combined sources	4
Helixⁱ	253 – 274	Combined sources	22
Turnⁱ	281 – 283	Combined sources	3
Turnⁱ	285 – 289	Combined sources	5
Beta strandⁱ	290 – 292	Combined sources	3
Helixⁱ	293 – 303	Combined sources	11
Turnⁱ	304 – 310	Combined sources	7

Show more details

3D structure databases

ProteinModelPortalⁱ	P03888
SMRⁱ	P03888
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Family & Domainsⁱ

Sequence similaritiesⁱ

Belongs to the complex I subunit 1 family.Curated

Keywords - Domainⁱ

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGⁱ	KOG4770 Eukaryota COG1005 LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00390000006621
HOGENOMⁱ	HOG000228276
HOVERGENⁱ	HBG016682
InParanoidⁱ	P03888
KEGG Orthology (KO) More...KOⁱ	K03878
OMAⁱ	MKFALFY
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G0F0D
PhylomeDBⁱ	P03888

Family and domain databases

HAMAPⁱ	MF_01350 NDH1_NuoH, 1 hit
InterProⁱ	View protein in InterPro IPR001694 NADH_UbQ_OxRdtase_su1/FPO IPR018086 NADH_UbQ_OxRdtase_su1_CS
PANTHERⁱ	PTHR11432 PTHR11432, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF00146 NADHdh, 1 hit
PROSITEⁱ	View protein in PROSITE PS00667 COMPLEX1_ND1_1, 1 hit PS00668 COMPLEX1_ND1_2, 1 hit

Sequenceⁱ

Sequence statusⁱ: Complete.

P03888-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MFFINILTLL VPILIAMAFL TLVERKILGY MQLRKGPNIV GPYGILQPFA 
        60         70         80         90        100
DAMKLFMKEP MRPLTTSMSL FIIAPTLSLT LALSLWVPLP MPHPLINLNL 
       110        120        130        140        150
GILFILATSS LSVYSILWSG WASNSKYSLF GALRAVAQTI SYEVTMAIIL 
       160        170        180        190        200
LSVLLMNGSY SLQTLITTQE HMWLLLPAWP MAMMWFISTL AETNRAPFDL 
       210        220        230        240        250
TEGESELVSG FNVEYAAGPF ALFFMAEYTN IILMNALTTI IFLGPLYYIN 
       260        270        280        290        300
LPELYSTNFM MEALLLSSTF LWIRASYPRF RYDQLMHLLW KNFLPLTLAL 
       310 
CMWHISLPIF TAGVPPYM

Length:318

Mass (Da):36,059

Last modified:January 4, 2005 - v3

Checksum:ⁱECFAB96696610024

Sequence cautionⁱ

The sequence AAB48644 differs from that shown. Reason: Erroneous initiation.Curated

The sequence CAA24080 differs from that shown. Reason: Erroneous initiation.Curated

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	V00711 Genomic DNA Translation: CAA24080.1 Different initiation. J01420 Genomic DNA Translation: AAB48644.1 Different initiation. AB042523 Genomic DNA Translation: BAA95653.2 AB042524 Genomic DNA Translation: BAA95640.2 AB042809 Genomic DNA Translation: BAA95795.2 AB049357 Genomic DNA Translation: BAB13801.2 AJ512208 Genomic DNA Translation: CAD54432.1 AY172335 Genomic DNA Translation: AAN85122.1 AY339599 Genomic DNA Translation: AAP89023.2 AJ489607 Genomic DNA Translation: CAD33907.1 AY533105 Genomic DNA Translation: AAS01439.1 AY533106 Genomic DNA Translation: AAS01452.1 AY533107 Genomic DNA Translation: AAS01465.1 AY533108 Genomic DNA Translation: AAS01478.1
PIRⁱ	A00409 QXMS1M
NCBI Reference Sequences More...RefSeqⁱ	NP_904328.1, NC_005089.1 YP_220550.1, NC_006914.1

Genome annotation databases

Ensemblⁱ	ENSMUST00000082392; ENSMUSP00000080991; ENSMUSG00000064341
GeneIDⁱ	17716 3338902
KEGGⁱ	mmu:17716

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
P03888	NADH-ubiquinone oxidoreductase chain 1		western European house mouse		318	UniRef100_P03888
NADH-ubiquinone oxidoreductase chain 1		MOUSE		318
NADH-ubiquinone oxidoreductase chain 1 (Fragment)		MOUSE		317
Mitochondrial maternally transmitted antigen-alpha (Mta-alpha) (Fragment)		MOUSE		26

Protein	Similar proteins		Species	Score	Length	Source
P03888	NADH-ubiquinone oxidoreductase chain 1	)	RAT		318	UniRef90_P03889
NADH-ubiquinone oxidoreductase chain 1		servant mouse		319
Uncharacterized protein (Fragment)		MOUSE		28
NADH-ubiquinone oxidoreductase chain 1		western European house mouse		318
NADH-ubiquinone oxidoreductase chain 1		MUSCO		318
+94

Protein	Similar proteins		Species	Score	Length	Source
P03888	NADH-ubiquinone oxidoreductase chain 1	)	HUMAN		318	UniRef50_P03886
NADH-ubiquinone oxidoreductase chain 1		VARBA		321
NADH-ubiquinone oxidoreductase chain 1 (Fragment)		ANAPL		117
NADH-ubiquinone oxidoreductase chain 1		DANRE		324
NADH-ubiquinone oxidoreductase chain 1		PELSU		322
+10514

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	V00711 Genomic DNA Translation: CAA24080.1 Different initiation. J01420 Genomic DNA Translation: AAB48644.1 Different initiation. AB042523 Genomic DNA Translation: BAA95653.2 AB042524 Genomic DNA Translation: BAA95640.2 AB042809 Genomic DNA Translation: BAA95795.2 AB049357 Genomic DNA Translation: BAB13801.2 AJ512208 Genomic DNA Translation: CAD54432.1 AY172335 Genomic DNA Translation: AAN85122.1 AY339599 Genomic DNA Translation: AAP89023.2 AJ489607 Genomic DNA Translation: CAD33907.1 AY533105 Genomic DNA Translation: AAS01439.1 AY533106 Genomic DNA Translation: AAS01452.1 AY533107 Genomic DNA Translation: AAS01465.1 AY533108 Genomic DNA Translation: AAS01478.1
PIRⁱ	A00409 QXMS1M
RefSeqⁱ	NP_904328.1, NC_005089.1 YP_220550.1, NC_006914.1

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	6G2J	electron microscopy	3.30	H	1-318	[»]
	6G72	electron microscopy	3.90	H	1-318	[»]
ProteinModelPortalⁱ	P03888
SMRⁱ	P03888
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	201547, 2 interactors
ComplexPortalⁱ	CPX-266 Mitochondrial respiratory chain complex I
CORUMⁱ	P03888
DIPⁱ	DIP-61655N
IntActⁱ	P03888, 3 interactors
STRINGⁱ	10090.ENSMUSP00000080991

Proteomic databases

EPDⁱ	P03888
PaxDbⁱ	P03888
PRIDEⁱ	P03888

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

Ensemblⁱ	ENSMUST00000082392; ENSMUSP00000080991; ENSMUSG00000064341
GeneIDⁱ	17716 3338902
KEGGⁱ	mmu:17716

Organism-specific databases

CTDⁱ	4535
MGIⁱ	MGI:101787 mt-Nd1

Phylogenomic databases

eggNOGⁱ	KOG4770 Eukaryota COG1005 LUCA
GeneTreeⁱ	ENSGT00390000006621
HOGENOMⁱ	HOG000228276
HOVERGENⁱ	HBG016682
InParanoidⁱ	P03888
KOⁱ	K03878
OMAⁱ	MKFALFY
OrthoDBⁱ	EOG091G0F0D
PhylomeDBⁱ	P03888

Enzyme and pathway databases

Reactomeⁱ	R-MMU-611105 Respiratory electron transport R-MMU-6799198 Complex I biogenesis

Reactomeⁱ

R-MMU-611105 Respiratory electron transport
R-MMU-6799198 Complex I biogenesis

Miscellaneous databases

Protein Ontology More...PROⁱ	PR:P03888
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSMUSG00000064341 Expressed in 20 organ(s), highest expression level in female gonad
ExpressionAtlasⁱ	P03888 baseline and differential

Family and domain databases

HAMAPⁱ	MF_01350 NDH1_NuoH, 1 hit
InterProⁱ	View protein in InterPro IPR001694 NADH_UbQ_OxRdtase_su1/FPO IPR018086 NADH_UbQ_OxRdtase_su1_CS
PANTHERⁱ	PTHR11432 PTHR11432, 1 hit
Pfamⁱ	View protein in Pfam PF00146 NADHdh, 1 hit
PROSITEⁱ	View protein in PROSITE PS00667 COMPLEX1_ND1_1, 1 hit PS00668 COMPLEX1_ND1_2, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	NU1M_MOUSE
Accessionⁱ	P03888Primary (citable) accession number: P03888 Secondary accession number(s): Q9G0S6
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	July 21, 1986
	Last sequence update:	January 4, 2005
	Last modified:	November 7, 2018
	This is version 135 of the entry and version 3 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

SIMILARITY comments
Index of protein domains and families
MGD cross-references
Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
PDB cross-references
Index of Protein Data Bank (PDB) cross-references

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P03888 (NU1M_MOUSE)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

NADH-ubiquinone oxidoreductase chain 1

Mtnd1

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Mitochondrion

Mitochondrion

Other locations

Topology

Keywords - Cellular componenti

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Proteomic databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Phylogenomic databases

Family and domain databases

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

PTM / Processingⁱ

Expressionⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Keywords - Domainⁱ

Sequence cautionⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ