We will be switching to the new UniProt website on Tuesday, June 28. Please explore and share your feedback. Take me to UniProt BETA

UniProtKB - P03423 (GLYC_HRSVA)

>sp|P03423|GLYC_HRSVA Major surface glycoprotein G OS=Human respiratory syncytial virus A (strain A2) OX=11259 GN=G PE=1 SV=1
MSKNKDQRTAKTLERTWDTLNHLLFISSCLYKLNLKSVAQITLSILAMIISTSLIIAAII
FIASANHKVTPTTAIIQDATSQIKNTTPTYLTQNPQLGISPSNPSEITSQITTILASTTP
GVKSTLQSTTVKTKNTTTTQTQPSKPTTKQRQNKPPSKPNNDFHFEVFNFVPCSICSNNP
TCWAICKRIPNKKPGKKTTTKPTKKPTLKTTKKDPKPQTTKSKEVPTTKPTEEPTINTTK
TNIITTLLTSNTTGNPELTSQMETFHSTSSEGNPSPSQVSTTSEYPSQPSSPPNTPRQ

Entry version 111 (23 Feb 2022)
Sequence version 1 (21 Jul 1986)
Previous versions | rss

Add a publication Feedback

Protein

Major surface glycoprotein G

Gene

G

Organism

Human respiratory syncytial virus A (strain A2)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Isoform Membrane-bound glycoprotein G:

Attaches the virion to the host cell membrane by interacting with heparan sulfate, initiating the infection (PubMed:3655746, PubMed:10400758, PubMed:10864656).

Interacts with host CX3CR1, the receptor for the CX3C chemokine fractalkine, to modulate the immune response and facilitate infection (PubMed:26658574, PubMed:11477410, PubMed:26107373).

Unlike the other paramyxovirus attachment proteins, lacks both neuraminidase and hemagglutinating activities (Probable).

Curated6 Publications

Isoform Secreted glycoprotein G:

Helps the virus escape antibody-dependent restriction of replication by acting as an antigen decoy and by modulating the activity of leukocytes bearing Fc-gamma receptors.

1 Publication

GO - Biological processⁱ

adhesion receptor-mediated virion attachment to host cell Source: UniProtKB-KW
mitigation of host immune response by virus Source: UniProtKB-KW
viral entry into host cell Source: UniProtKB-KW

Complete GO annotation on QuickGO ...

Keywordsⁱ

Biological process	Host-virus interaction, Viral attachment to host adhesion receptor, Viral attachment to host cell, Viral immunoevasion, Virus entry into host cell

Biological process

Host-virus interaction, Viral attachment to host adhesion receptor, Viral attachment to host cell, Viral immunoevasion, Virus entry into host cell

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Major surface glycoprotein G Alternative name(s): Attachment glycoprotein G Membrane-bound glycoprotein Short name: mG Cleaved into the following chain: Mature secreted glycoprotein GBy similarity Short name: Mature sGBy similarity
Gene namesⁱ	Name:G
Organismⁱ	Human respiratory syncytial virus A (strain A2)
Taxonomic identifierⁱ	11259 [NCBI]
Taxonomic lineageⁱ	Viruses › Riboviria › Orthornavirae › Negarnaviricota › Haploviricotina › Monjiviricetes › Mononegavirales › Pneumoviridae › Orthopneumovirus › Human respiratory syncytial virus › Human respiratory syncytial virus A
Virus hostⁱ	Homo sapiens (Human) [TaxID: 9606]
Proteomesⁱ	UP000181559 Componentⁱ: Genome UP000181262 Componentⁱ: Genome UP000181145 Componentⁱ: Genome UP000007678 Componentⁱ: Genome UP000134464 Componentⁱ: Genome

Subcellular locationⁱ

Isoform Membrane-bound glycoprotein G:

Isoform Secreted glycoprotein G:

Secreted
By similarity
Manual assertion inferred from sequence similarity toⁱ
- UniProtKB:P20895 (GLYC_HRSVL)

Note:

The protein is shed from infected cells before the appearance of progeny virus (By similarity). The initiation at the downstream methionine removes a portion of the transmembrane domain. The remaining hydrophobic portion of the sG protein is essential for translocating it into the lumen of the ER during translation and would likely maintain its membrane association until a proteolytic event releases the mature sG protein into the medium (By similarity).By similarity

Topology

Feature key	Position(s)	DescriptionActions	Length
Topological domainⁱ	1 – 42	Cytoplasmic1 PublicationAdd BLAST	42
Transmembraneⁱ	43 – 63	HelicalSequence analysisAdd BLAST	21
Topological domainⁱ	64 – 298	Extracellular1 PublicationAdd BLAST	235

Keywords - Cellular componentⁱ

Host cell membrane, Host membrane, Membrane, Secreted, Virion

Pathology & Biotechⁱ

Mutagenesis

Feature key	Position(s)	DescriptionActions	Length
Mutagenesisⁱ	2	S → A: Complete loss of interaction with protein M. 1 Publication	1
Mutagenesisⁱ	3	K → A: Partial loss of interaction with protein M. 1 Publication	1
Mutagenesisⁱ	4	N → A: Partial loss of interaction with protein M. 1 Publication	1
Mutagenesisⁱ	5	K → A: Partial loss of interaction with protein M. 1 Publication	1
Mutagenesisⁱ	6	D → A: Complete loss of interaction with protein M. 1 Publication	1
Mutagenesisⁱ	7	Q → AQ: Partial loss of interaction with protein M. 1 Publication	1

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000142855	1 – 298	Major surface glycoprotein GAdd BLAST		298
ChainⁱPRO_0000451323	66 – 298	Mature secreted glycoprotein GAdd BLAST		233

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Length
Glycosylationⁱ	70	O-linked (GalNAc...) threonine; by host1 Publication	1
Glycosylationⁱ	72	O-linked (GalNAc...) threonine; by host1 Publication	1
Glycosylationⁱ	80	O-linked (GalNAc...) threonine; by host1 Publication	1
Glycosylationⁱ	86	O-linked (GalNAc...) threonine; by host1 Publication	1
Glycosylationⁱ	87	O-linked (GalNAc...) threonine; by host1 Publication	1
Glycosylationⁱ	92	O-linked (GalNAc...) threonine; by host1 Publication	1
Glycosylationⁱ	100	O-linked (GalNAc...) serine; by hostSequence analysis	1
Glycosylationⁱ	105	O-linked (GalNAc...) serine; by hostSequence analysis	1
Glycosylationⁱ	113	O-linked (GalNAc...) threonine; by hostSequence analysis	1
Glycosylationⁱ	117	O-linked (GalNAc...) serine; by hostSequence analysis	1
Glycosylationⁱ	119	O-linked (GalNAc...) threonine; by hostSequence analysis	1
Glycosylationⁱ	135	N-linked (GlcNAc...) asparagine; by hostSequence analysis	1
Glycosylationⁱ	137	O-linked (GalNAc...) threonine; by hostSequence analysis	1
Glycosylationⁱ	138	O-linked (GalNAc...) threonine; by hostSequence analysis	1
Glycosylationⁱ	139	O-linked (GalNAc...) threonine; by hostSequence analysis	1
Glycosylationⁱ	141	O-linked (GalNAc...) threonine; by hostSequence analysis	1
Glycosylationⁱ	144	O-linked (GalNAc...) serine; by hostSequence analysis	1
Glycosylationⁱ	147	O-linked (GalNAc...) threonine; by hostSequence analysis	1
Disulfide bondⁱ	173 ↔ 186	1 Publication
Disulfide bondⁱ	176 ↔ 182	1 Publication
Glycosylationⁱ	199	O-linked (GalNAc...) threonine; by hostSequence analysis	1
Glycosylationⁱ	203	O-linked (GalNAc...) threonine; by hostSequence analysis	1
Glycosylationⁱ	219	O-linked (GalNAc...) threonine; by hostSequence analysis	1
Glycosylationⁱ	231	O-linked (GalNAc...) threonine; by hostSequence analysis	1
Glycosylationⁱ	235	O-linked (GalNAc...) threonine; by hostSequence analysis	1
Glycosylationⁱ	237	N-linked (GlcNAc...) asparagine; by hostSequence analysis	1
Glycosylationⁱ	251	N-linked (GlcNAc...) asparagine; by hostSequence analysis	1
Glycosylationⁱ	253	O-linked (GalNAc...) threonine; by hostSequence analysis	1
Glycosylationⁱ	269	O-linked (GalNAc...) serine; by hostSequence analysis	1
Glycosylationⁱ	270	O-linked (GlcNAc...) serine; by hostSequence analysis	1
Glycosylationⁱ	275	O-linked (GalNAc...) serine; by hostSequence analysis	1
Glycosylationⁱ	282	O-linked (GalNAc...) threonine; by hostSequence analysis	1
Glycosylationⁱ	283	O-linked (GalNAc...) serine; by hostSequence analysis	1
Glycosylationⁱ	287	O-linked (GalNAc...) serine; by hostSequence analysis	1
Glycosylationⁱ	290	O-linked (GalNAc...) serine; by hostSequence analysis	1

Post-translational modificationⁱ

Isoform Secreted glycoprotein G:

Cleaved to give rise to the mature sG protein which lacks the transmembrane domain.By similarity

Isoform Membrane-bound glycoprotein G:

N- and O-glycosylated (PubMed:4069997). May carry 30-40 separate O-linked carbohydrate chains distributed among the 91 serine and threonine residues (PubMed:1634876, PubMed:3858865, PubMed:2164608).4 Publications

Isoform Membrane-bound glycoprotein G:

Palmitoylated.1 Publication

Sites

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Siteⁱ	65 – 66	Cleavage1 Publication		2

Keywords - PTMⁱ

Disulfide bond, Glycoprotein

Interactionⁱ

Subunit structureⁱ

Isoform Membrane-bound glycoprotein G:

Homooligomer (PubMed:1634876).

Interacts (via N-terminus) with protein M (PubMed:15958665).

Part of a complex composed of F1, F2 and G glycoproteins (PubMed:18036342).

Interacts with protein SH (PubMed:15659757).

Interacts with host heparate sulfate; this interaction probably participates in the viral attachment to the host cell (PubMed:10400758).

Interacts with host CX3CR1; this interaction plays an important role in viral entry (PubMed:11477410, PubMed:26658574).

Interacts with the host lectins CD209/DC-SIGN and CD209L/L-SIGN on dendritic cells; these interactions stimulate the phosphorylation of MAPK3/ERK1 and MAPK1/ERK2, which inhibits dendritic cell activation and could participate in the limited immunity against RSV reinfection (PubMed:22090124).

8 Publications

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Helixⁱ	165 – 168	Combined sources	4
Helixⁱ	173 – 175	Combined sources	3
Turnⁱ	176 – 178	Combined sources	3
Helixⁱ	180 – 185	Combined sources	6

Show more details

3D structure databases

SMRⁱ	P03423
ModBaseⁱ	Search...
PDBe-KBⁱ	Search...

Family & Domainsⁱ

Region

Feature key	Position(s)	DescriptionActions	Length
Regionⁱ	125 – 161	DisorderedSequence analysisAdd BLAST	37
Regionⁱ	187 – 198	Binding to host heparan sulfate1 PublicationAdd BLAST	12
Regionⁱ	190 – 298	DisorderedSequence analysisAdd BLAST	109

Compositional bias

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Compositional biasⁱ	125 – 159	Polar residuesSequence analysisAdd BLAST		35
Compositional biasⁱ	221 – 288	Polar residuesSequence analysisAdd BLAST		68

Domainⁱ

Isoform Membrane-bound glycoprotein G:

Contains a linear heparin binding domain essential for virus attachment to the host.1 Publication

Sequence similaritiesⁱ

Belongs to the pneumoviruses glycoprotein G family.Curated

Keywords - Domainⁱ

Transmembrane, Transmembrane helix

Family and domain databases

InterProⁱ	View protein in InterPro IPR000925, G_prot
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF00802, Glycoprotein_G, 1 hit

Sequences (2)ⁱ

Sequence statusⁱ: Complete.

Sequence processingⁱ: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsⁱ produced by alternative initiation. Align Add to basket

Isoform Membrane-bound glycoprotein G (identifier: P03423-1) [UniParc]FASTA Add to basket

This isoform has been chosen as the canonicalⁱ sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSKNKDQRTA KTLERTWDTL NHLLFISSCL YKLNLKSVAQ ITLSILAMII 
        60         70         80         90        100
STSLIIAAII FIASANHKVT PTTAIIQDAT SQIKNTTPTY LTQNPQLGIS 
       110        120        130        140        150
PSNPSEITSQ ITTILASTTP GVKSTLQSTT VKTKNTTTTQ TQPSKPTTKQ 
       160        170        180        190        200
RQNKPPSKPN NDFHFEVFNF VPCSICSNNP TCWAICKRIP NKKPGKKTTT 
       210        220        230        240        250
KPTKKPTLKT TKKDPKPQTT KSKEVPTTKP TEEPTINTTK TNIITTLLTS 
       260        270        280        290 
NTTGNPELTS QMETFHSTSS EGNPSPSQVS TTSEYPSQPS SPPNTPRQ

Length:298

Mass (Da):32,586

Last modified:July 21, 1986 - v1

Checksum:ⁱ993C3D2DD68BC634

Isoform Secreted glycoprotein G (identifier: P03423-2) [UniParc]FASTA Add to basket

Also known as: sG

The sequence of this isoform differs from the canonical sequence as follows:
1-47: Missing.

« Hide

        10         20         30         40         50
MIISTSLIIA AIIFIASANH KVTPTTAIIQ DATSQIKNTT PTYLTQNPQL 
        60         70         80         90        100
GISPSNPSEI TSQITTILAS TTPGVKSTLQ STTVKTKNTT TTQTQPSKPT 
       110        120        130        140        150
TKQRQNKPPS KPNNDFHFEV FNFVPCSICS NNPTCWAICK RIPNKKPGKK 
       160        170        180        190        200
TTTKPTKKPT LKTTKKDPKP QTTKSKEVPT TKPTEEPTIN TTKTNIITTL 
       210        220        230        240        250
LTSNTTGNPE LTSQMETFHS TSSEGNPSPS QVSTTSEYPS QPSSPPNTPR 

Q

Show »

Length:251

Mass (Da):27,196

Checksum:ⁱB90B2B074522E41F

Alternative sequence

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Alternative sequenceⁱVSP_036039	1 – 47	Missing in isoform Secreted glycoprotein G. 1 PublicationAdd BLAST		47

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	M11486 Genomic RNA Translation: AAB59857.1 X03149 mRNA Translation: CAA26928.1 U50362 Genomic RNA Translation: AAB86663.1 U50363 Genomic RNA Translation: AAB86675.1 U63644 Genomic RNA Translation: AAC55969.1 AF035006 Genomic RNA Translation: AAC14901.1
PIRⁱ	A94048, MGNZ

Keywords - Coding sequence diversityⁱ

Alternative initiation

Protein	Similar proteins		Species	Score	Length	Source
P03423	Major surface glycoprotein G		HRSV		298	UniRef100_P03423
Major surface glycoprotein G		Human respiratory syncytial virus MinFLC		298
Major surface glycoprotein G		Human respiratory syncytial virus MinL		298
Major surface glycoprotein G		Human respiratory syncytial virus MinB		298
Major surface glycoprotein G		Human respiratory syncytial virus MaxB		298
+7

Protein	Similar proteins		Species	Score	Length	Source
P03423	Major surface glycoprotein G	)	HRSVL		298	UniRef90_P03423
Major surface glycoprotein G		HRSV2		297
Major surface glycoprotein G		HRSV3		297
Major surface glycoprotein G		HRSV		298
Major surface glycoprotein G		Human respiratory syncytial virus MinFLC		298
+84

Protein	Similar proteins		Species	Score	Length	Source
P03423	Major surface glycoprotein G	)	HRSVL		298	UniRef50_P03423
Major surface glycoprotein G		HRSV2		297
Major surface glycoprotein G		HRSV3		297
Major surface glycoprotein G		HRSV5		298
Major surface glycoprotein G		HRSV7		297
+7145

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	M11486 Genomic RNA Translation: AAB59857.1 X03149 mRNA Translation: CAA26928.1 U50362 Genomic RNA Translation: AAB86663.1 U50363 Genomic RNA Translation: AAB86675.1 U63644 Genomic RNA Translation: AAC55969.1 AF035006 Genomic RNA Translation: AAC14901.1
PIRⁱ	A94048, MGNZ

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	5WN9	X-ray	1.55	A	168-196	[»]
	5WNA	X-ray	2.40	A/B	161-197	[»]
	5WNB	X-ray	2.40	A/B	162-172	[»]
	6UVO	X-ray	2.90	D	157-197	[»]
SMRⁱ	P03423
ModBaseⁱ	Search...
PDBe-KBⁱ	Search...

Protocols and materials databases

ABCDⁱ	P03423, 2 sequenced antibodies

ABCDⁱ

P03423, 2 sequenced antibodies

Family and domain databases

InterProⁱ	View protein in InterPro IPR000925, G_prot
Pfamⁱ	View protein in Pfam PF00802, Glycoprotein_G, 1 hit
MobiDBⁱ	Search...

Entry informationⁱ

Entry nameⁱ	GLYC_HRSVA
Accessionⁱ	P03423Primary (citable) accession number: P03423 Secondary accession number(s): Q77YB0
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	July 21, 1986
	Last sequence update:	July 21, 1986
	Last modified:	February 23, 2022
	This is version 111 of the entry and version 1 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Viral Protein Annotation Program

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P03423 (GLYC_HRSVA)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the 'basket' to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Major surface glycoprotein G

G

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Sites

Keywords - PTMi

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Compositional bias

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Family and domain databases

Alternative sequence

Sequence databases

Keywords - Coding sequence diversityi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protocols and materials databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Keywords - Domainⁱ

Keywords - Coding sequence diversityⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ