UniProtKB - P01910 (HA2K_MOUSE)

BLAST

>sp|P01910|HA2K_MOUSE H-2 class II histocompatibility antigen, A-K alpha chain OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=2
MPRSRALILGVLALTTMLSLCGGEDDIEADHVGSYGITVYQSPGDIGQYTFEFDGDELFY
VDLDKKETVWMLPEFAQLRRFEPQGGLQNIATGKHNLEILTKRSNSTPATNEAPQATVFP
KSPVLLGQPNTLICFVDNIFPPVINITWLRNSKSVTDGVYETSFFVNRDYSFHKLSYLTF
IPSDDDIYDCKVEHWGLEEPVLKHWEPEIPAPMSELTETVVCALGLSVGLVGIVVGTIFI
IQGLRSGGTSRHPGPL

Align
Format
Add to basket Added to basket
History
Entry version 148 (12 Sep 2018)
Sequence version 2 (01 Oct 1996)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

H-2 class II histocompatibility antigen, A-K alpha chain

Gene

H2-Aa

Organism

Mus musculus (Mouse)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

GO - Molecular functionⁱ

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

antigen processing and presentation
Source: MGI
Inferred from direct assayⁱ
- 9432982
antigen processing and presentation of exogenous peptide antigen via MHC class II
Source: MGI
Inferred from direct assayⁱ
antigen processing and presentation of peptide antigen
Source: MGI
Inferred from direct assayⁱ
- 11069069
immune response Source: InterPro
negative regulation of T cell proliferation Source: MGI
positive regulation of T cell differentiation
Source: MGI
Inferred from direct assayⁱ
- 8598041

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Biological process	Immunity

Biological process

Immunity

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: H-2 class II histocompatibility antigen, A-K alpha chain
Gene namesⁱ	Name:H2-Aa
Organismⁱ	Mus musculus (Mouse)
Taxonomic identifierⁱ	10090 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
Proteomesⁱ	UP000000589 Componentⁱ: Unplaced

Organism-specific databases

MGIⁱ	MGI:95895 H2-Aa

Topology

Feature key	Position(s)	DescriptionActions	Length
Topological domainⁱ	24 – 218	ExtracellularSequence analysisAdd BLAST	195
Transmembraneⁱ	219 – 241	HelicalSequence analysisAdd BLAST	23
Topological domainⁱ	242 – 256	CytoplasmicSequence analysisAdd BLAST	15

Keywords - Cellular componentⁱ

Membrane, MHC II

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Signal peptideⁱ	1 – 23	By similarityAdd BLAST		23
ChainⁱPRO_0000018977	24 – 256	H-2 class II histocompatibility antigen, A-K alpha chainAdd BLAST		233

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Length
Glycosylationⁱ	105	N-linked (GlcNAc...) asparagine1 Publication	1
Disulfide bondⁱ	134 ↔ 190	PROSITE-ProRule annotation
Glycosylationⁱ	145	N-linked (GlcNAc...) asparagine1 Publication	1

Keywords - PTMⁱ

Disulfide bond, Glycoprotein

Proteomic databases

MaxQB - The MaxQuant DataBase More...MaxQBⁱ	P01910
PeptideAtlas More...PeptideAtlasⁱ	P01910
PRIDEⁱ	P01910

PTM databases

iPTMnetⁱ	P01910

iPTMnetⁱ

P01910

Expressionⁱ

Gene expression databases

CleanExⁱ	MM_H2-AA

CleanExⁱ

MM_H2-AA

Interactionⁱ

GO - Molecular functionⁱ

protein heterodimerization activity Source: MGI

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

Database of interacting proteins More...DIPⁱ	DIP-6133N
IntActⁱ	P01910, 1 interactor
Molecular INTeraction database More...MINTⁱ	P01910

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Beta strandⁱ	30 – 42	Combined sources	13
Turnⁱ	43 – 45	Combined sources	3
Beta strandⁱ	46 – 53	Combined sources	8
Beta strandⁱ	56 – 62	Combined sources	7
Turnⁱ	63 – 66	Combined sources	4
Beta strandⁱ	67 – 72	Combined sources	6
Helixⁱ	73 – 77	Combined sources	5
Helixⁱ	83 – 104	Combined sources	22
Beta strandⁱ	115 – 122	Combined sources	8
Beta strandⁱ	126 – 128	Combined sources	3
Beta strandⁱ	130 – 139	Combined sources	10
Beta strandⁱ	145 – 150	Combined sources	6
Beta strandⁱ	152 – 155	Combined sources	4
Beta strandⁱ	159 – 161	Combined sources	3
Beta strandⁱ	172 – 180	Combined sources	9
Beta strandⁱ	188 – 193	Combined sources	6
Beta strandⁱ	201 – 205	Combined sources	5

Show more details

3D structure databases

ProteinModelPortalⁱ	P01910
SMRⁱ	P01910
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ

P01910

Family & Domainsⁱ

Domains and Repeats

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Domainⁱ	114 – 206	Ig-like C1-typeAdd BLAST		93

Region

Feature key	Position(s)	DescriptionActions	Length
Regionⁱ	24 – 111	Alpha-1Add BLAST	88
Regionⁱ	112 – 205	Alpha-2Add BLAST	94
Regionⁱ	206 – 218	Connecting peptideAdd BLAST	13

Sequence similaritiesⁱ

Belongs to the MHC class II family.Curated

Keywords - Domainⁱ

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGⁱ	ENOG410IZMF Eukaryota ENOG410YHX9 LUCA
HOVERGENⁱ	HBG006862
InParanoidⁱ	P01910

Family and domain databases

Gene3Dⁱ	2.60.40.10, 1 hit 3.10.320.10, 1 hit
InterProⁱ	View protein in InterPro IPR007110 Ig-like_dom IPR036179 Ig-like_dom_sf IPR013783 Ig-like_fold IPR003006 Ig/MHC_CS IPR003597 Ig_C1-set IPR011162 MHC_I/II-like_Ag-recog IPR014745 MHC_II_a/b_N IPR001003 MHC_II_a_N
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF07654 C1-set, 1 hit PF00993 MHC_II_alpha, 1 hit
SMARTⁱ	View protein in SMART SM00407 IGc1, 1 hit SM00920 MHC_II_alpha, 1 hit
SUPFAMⁱ	SSF48726 SSF48726, 1 hit SSF54452 SSF54452, 1 hit
PROSITEⁱ	View protein in PROSITE PS50835 IG_LIKE, 1 hit PS00290 IG_MHC, 1 hit

Sequence (1+)ⁱ

Sequence statusⁱ: Complete.

Sequence processingⁱ: The displayed sequence is further processed into a mature form.

This entry has 1 described isoform and 9 potential isoforms that are computationally mapped.Show all Align All

P01910-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MPRSRALILG VLALTTMLSL CGGEDDIEAD HVGSYGITVY QSPGDIGQYT 
        60         70         80         90        100
FEFDGDELFY VDLDKKETVW MLPEFAQLRR FEPQGGLQNI ATGKHNLEIL 
       110        120        130        140        150
TKRSNSTPAT NEAPQATVFP KSPVLLGQPN TLICFVDNIF PPVINITWLR 
       160        170        180        190        200
NSKSVTDGVY ETSFFVNRDY SFHKLSYLTF IPSDDDIYDC KVEHWGLEEP 
       210        220        230        240        250
VLKHWEPEIP APMSELTETV VCALGLSVGL VGIVVGTIFI IQGLRSGGTS 

RHPGPL

Length:256

Mass (Da):28,351

Last modified:October 1, 1996 - v2

Checksum:ⁱ78E7D4A33CCE4582

Computationally mapped potential isoform sequencesⁱ

There are 9 potential isoforms mapped to this entry.BLAST Align Show all Add to basket

Entry	Entry name	Protein names	Gene names	Length	Annotation

P14434	HA2B_MOUSE	H-2 class II histocompatibility ant... H-2 class II histocompatibility antigen, A-B alpha chain, IAalpha	H2-Aa	256	Annotation score:
P23150	HA2J_MOUSE	H-2 class II histocompatibility ant... H-2 class II histocompatibility antigen, I-E alpha chain		254	Annotation score:
P04228	HA2D_MOUSE	H-2 class II histocompatibility ant... H-2 class II histocompatibility antigen, A-D alpha chain	H2-Aa	256	Annotation score:
P14438	HA2U_MOUSE	H-2 class II histocompatibility ant... H-2 class II histocompatibility antigen, A-U alpha chain	H2-Aa	227	Annotation score:
P14435	HA2F_MOUSE	H-2 class II histocompatibility ant... H-2 class II histocompatibility antigen, A-F alpha chain	H2-Aa	233	Annotation score:
P04227	HA2Q_MOUSE	H-2 class II histocompatibility ant... H-2 class II histocompatibility antigen, A-Q alpha chain	H2-Aa	221	Annotation score:
P14437	HA2S_MOUSE	H-2 class II histocompatibility ant... H-2 class II histocompatibility antigen, A-S alpha chain	H2-Aa	233	Annotation score:
P14436	HA2R_MOUSE	H-2 class II histocompatibility ant... H-2 class II histocompatibility antigen, A-R alpha chain	H2-Aa	233	Annotation score:
G3UWR9	G3UWR9_MOUSE	H-2 class II histocompatibility ant... H-2 class II histocompatibility antigen, A-Q alpha chain	H2-Aa	173	Annotation score:

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	M21931 mRNA Translation: AAA39636.1 V00832 mRNA Translation: CAA24215.1 M11357 mRNA Translation: AAA39613.1
PIRⁱ	A02217 HLMSAA I54447
UniGeneⁱ	Mm.235338

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
P01910	MHC class II antigen (Fragment)		MOUSE		84	UniRef100_P01910
MHC class II antigen (Fragment)		MOUSE		84
MHC class II antigen (Fragment)		MOUSE		84
UPI0000111CE7		MOUSE		199
UPI0000111F9D		MOUSE		178
+1

Protein	Similar proteins		Species	Score	Length	Source
P01910	H-2 class II histocompatibility antigen, A-B alpha chain	)	MOUSE		256	UniRef90_P14434
H-2 class II histocompatibility antigen, A-B alpha chain		Daphnia magna		256
MHC class II antigen alpha chain (Fragment)		western European house mouse		69
MHC class II antigen alpha chain (Fragment)		eastern European house mouse		69
MHC class II antigen alpha chain (Fragment)		Mus musculus musculus x M. m. domesticus		69
+46

Protein	Similar proteins		Species	Score	Length	Source
P01910	HLA class II histocompatibility antigen, DR alpha chain	)	HUMAN		254	UniRef50_P01903
Mamu class II histocompatibility antigen, DR alpha chain		MACMU		254
Rano class II histocompatibility antigen, B alpha chain		RAT		256
H-2 class II histocompatibility antigen, A-B alpha chain	)	MOUSE		256
MHC class II antigen (Fragment)		western gorilla		81
+460

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	M21931 mRNA Translation: AAA39636.1 V00832 mRNA Translation: CAA24215.1 M11357 mRNA Translation: AAA39613.1
PIRⁱ	A02217 HLMSAA I54447
UniGeneⁱ	Mm.235338

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	1D9K	X-ray	3.20	C/G	27-209	[»]
	1IAK	X-ray	1.90	A	24-222	[»]
	1JL4	X-ray	4.30	A	31-208	[»]
ProteinModelPortalⁱ	P01910
SMRⁱ	P01910
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

DIPⁱ	DIP-6133N
IntActⁱ	P01910, 1 interactor
MINTⁱ	P01910

PTM databases

iPTMnetⁱ	P01910

iPTMnetⁱ

P01910

Proteomic databases

MaxQBⁱ	P01910
PeptideAtlasⁱ	P01910
PRIDEⁱ	P01910

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Organism-specific databases

MGIⁱ	MGI:95895 H2-Aa

Phylogenomic databases

eggNOGⁱ	ENOG410IZMF Eukaryota ENOG410YHX9 LUCA
HOVERGENⁱ	HBG006862
InParanoidⁱ	P01910

Miscellaneous databases

EvolutionaryTraceⁱ	P01910
SOURCEⁱ	Search...

Gene expression databases

CleanExⁱ	MM_H2-AA

CleanExⁱ

MM_H2-AA

Family and domain databases

Gene3Dⁱ	2.60.40.10, 1 hit 3.10.320.10, 1 hit
InterProⁱ	View protein in InterPro IPR007110 Ig-like_dom IPR036179 Ig-like_dom_sf IPR013783 Ig-like_fold IPR003006 Ig/MHC_CS IPR003597 Ig_C1-set IPR011162 MHC_I/II-like_Ag-recog IPR014745 MHC_II_a/b_N IPR001003 MHC_II_a_N
Pfamⁱ	View protein in Pfam PF07654 C1-set, 1 hit PF00993 MHC_II_alpha, 1 hit
SMARTⁱ	View protein in SMART SM00407 IGc1, 1 hit SM00920 MHC_II_alpha, 1 hit
SUPFAMⁱ	SSF48726 SSF48726, 1 hit SSF54452 SSF54452, 1 hit
PROSITEⁱ	View protein in PROSITE PS50835 IG_LIKE, 1 hit PS00290 IG_MHC, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	HA2K_MOUSE
Accessionⁱ	P01910Primary (citable) accession number: P01910
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	July 21, 1986
	Last sequence update:	October 1, 1996
	Last modified:	September 12, 2018
	This is version 148 of the entry and version 2 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Reference proteome

Documents

SIMILARITY comments
Index of protein domains and families
MGD cross-references
Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
PDB cross-references
Index of Protein Data Bank (PDB) cross-references

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P01910 (HA2K_MOUSE)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

H-2 class II histocompatibility antigen, A-K alpha chain

H2-Aa

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Other locations

Lysosome

Plasma Membrane

Other locations

Topology

Keywords - Cellular componenti

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Region

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Phylogenomic databases

Family and domain databases

Sequence databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

PTM databases

Proteomic databases

Protocols and materials databases

Organism-specific databases

Phylogenomic databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

GO - Molecular functionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Keywords - Domainⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ