UniProtKB - P01889 (HLAB_HUMAN)

>sp|P01889|HLAB_HUMAN HLA class I histocompatibility antigen, B alpha chain OS=Homo sapiens OX=9606 GN=HLA-B PE=1 SV=3
MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRF
DSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTLQ
SMYGCDVGPDGRLLRGHDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQR
RAYLEGECVEWLRRYLENGKDKLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
SSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGKGGSYSQAACSDSAQGSDVSL
TA

Entry version 200 (16 Oct 2019)
Sequence version 3 (01 Feb 1991)
Previous versions | rss

Help video Add a publication Feedback

Protein

HLA class I histocompatibility antigen, B alpha chain

Gene

HLA-B

Organism

Homo sapiens (Human)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Antigen-presenting major histocompatibility complex class I (MHCI) molecule. In complex with B2M/beta 2 microglobulin displays primarily viral and tumor-derived peptides on antigen-presenting cells for recognition by alpha-beta T cell receptor (TCR) on HLA-A-restricted CD8-positive T cells, guiding antigen-specific T cell immune response to eliminate infected or transformed cells (PubMed:25808313, PubMed:29531227). May also present self-peptides derived from the signal sequence of secreted or membrane proteins, although T cells specific for these peptides are usually inactivated to prevent autoreactivity. Both the peptide and the MHC molecule are recognized by TCR, the peptide is responsible for the fine specificity of antigen recognition and MHC residues account for the MHC restriction of T cells (PubMed:29531227). Typically presents intracellular peptide antigens of 8 to 13 amino acids that arise from cytosolic proteolysis via constitutive proteasome and IFNG-induced immunoproteasome. Can bind different peptides containing allele-specific binding motifs, which are mainly defined by anchor residues at position 2 and 9 (PubMed:25808313, PubMed:29531227).2 Publications

Allele B*07:02: Presents a long peptide (APRGPHGGAASGL) derived from the cancer-testis antigen CTAG1A/NY-ESO-1, eliciting a polyclonal CD8-positive T cell response against tumor cells.2 Publications

Sites

Feature key	Position(s)	DescriptionActions	Length
Binding siteⁱ	87	Pathogen-derived peptide antigen1 Publication	1
Binding siteⁱ	108	Pathogen-derived peptide antigen1 Publication	1
Binding siteⁱ	167	Pathogen-derived peptide antigen1 Publication	1
Binding siteⁱ	170	Pathogen-derived peptide antigen1 Publication	1
Binding siteⁱ	176	Pathogen-derived peptide antigen1 Publication	1
Binding siteⁱ	183	Pathogen-derived peptide antigen1 Publication	1
Binding siteⁱ	195	Pathogen-derived peptide antigen1 Publication	1

Keywordsⁱ

Biological process	Adaptive immunity, Host-virus interaction, Immunity, Innate immunity

Biological process

Adaptive immunity, Host-virus interaction, Immunity, Innate immunity

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: HLA class I histocompatibility antigen, B alpha chain Alternative name(s): Human leukocyte antigen B Short name: HLA-B
Gene namesⁱ	Name:HLA-BImported Synonyms:HLAB
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 6

Organism-specific databases

Human Gene Nomenclature Database More...HGNCⁱ	HGNC:4932 HLA-B

HGNCⁱ

HGNC:4932 HLA-B

Subcellular locationⁱ

UniProt annotation

Topology

Feature key	Position(s)	DescriptionActions	Length
Topological domainⁱ	25 – 309	ExtracellularSequence analysisAdd BLAST	285
Transmembraneⁱ	310 – 333	HelicalSequence analysisAdd BLAST	24
Topological domainⁱ	334 – 362	CytoplasmicSequence analysisAdd BLAST	29

Keywords - Cellular componentⁱ

Cell membrane, Endoplasmic reticulum, Membrane, MHC I

Pathology & Biotechⁱ

Involvement in diseaseⁱ

Stevens-Johnson syndrome (SJS)

Disease susceptibility is associated with variations affecting the gene represented in this entry. Increased susceptibility to Stevens-Johnson syndrome is conferred by allele B*15:02.1 Publication

Disease descriptionA rare blistering mucocutaneous disease that share clinical and histopathologic features with toxic epidermal necrolysis. Both disorders are characterized by high fever, malaise, and a rapidly developing blistering exanthema of macules and target-like lesions accompanied by mucosal involvement. Stevens-Johnson syndrome is a milder disease characterized by destruction and detachment of the skin epithelium and mucous membranes involving less than 10% of the body surface area. Ocular symptoms include ulcerative conjunctivitis, keratitis, iritis, uveitis and sometimes blindness. It can be caused by a severe adverse reaction to particular types of medication, although Mycoplasma infections may induce some cases.

Related information in OMIM

Spondyloarthropathy 1 (SPDA1)

Disease susceptibility is associated with variations affecting the gene represented in this entry. A restricted number of HLA-B27 subtypes can be associated with ankylosing spondylitis and other B27-related diseases, and an elevated frequency of the B*27:02 allele in ankylosing spondylitis patients is identified. The allele B*27:07 seems to have a protective role some populations because it was found only in the healthy controls.1 Publication

Disease descriptionA chronic rheumatic disease with multifactorial inheritance. It includes a spectrum of related disorders comprising ankylosing spondylitis, a subset of psoriatic arthritis, reactive arthritis (e.g. Reiter syndrome), arthritis associated with inflammatory bowel disease and undifferentiated spondyloarthropathy. These disorders may occur simultaneously or sequentially in the same patient, probably representing various phenotypic expressions of the same disease. Ankylosing spondylitis is the form of rheumatoid arthritis affecting the spine and is considered the prototype of seronegative spondyloarthropathies. It produces pain and stiffness as a result of inflammation of the sacroiliac, intervertebral, and costovertebral joints.

Related information in OMIM

There is evidence that HLA-B51 is associated with susceptibility to Behcet disease. However, it is not certain whether HLA-B51 itself or a closely linked gene is responsible for susceptibility. The world distribution of HLA-B51 in healthy people corresponds to the global distribution of Behcet disease; in Southern hemisphere countries (Africa, South Pacific, etc.) and in some parts of Europe, the prevalence of HLA-B51 in healthy people is low or null, corresponding to a low prevalence of Behcet disease. The wide variation that exists in the relative risk of HLA-B51 would support other nongenetic risk factors.1 Publication

Organism-specific databases

MIMⁱ	106300 phenotype 608579 phenotype

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Signal peptideⁱ	1 – 24	1 PublicationAdd BLAST		24
ChainⁱPRO_0000018833	25 – 362	HLA class I histocompatibility antigen, B alpha chainAdd BLAST		338

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Length
Glycosylationⁱ	110	N-linked (GlcNAc...) asparagine1 Publication	1
Disulfide bondⁱ	125 ↔ 188	PROSITE-ProRule annotation3 Publications
Disulfide bondⁱ	227 ↔ 283	PROSITE-ProRule annotation3 Publications

Keywords - PTMⁱ

Disulfide bond, Glycoprotein, Phosphoprotein

Interactionⁱ

Subunit structureⁱ

Heterotrimer that consists of an alpha chain HLA-B, a beta chain B2M and a peptide (peptide-HLA-B-B2M) (PubMed:25808313, PubMed:29531227). Early in biogenesis, HLA-B-B2M dimer interacts with the components of the peptide-loading complex composed of TAPBP, TAP1-TAP2, TAPBPL, PDIA3/ERP57 and CALR.

Interacts with TAP1-TAP2 transporter via TAPBP; this interaction is obligatory for the loading of peptide epitopes delivered to the ER by TAP1-TAP2 transporter.

Interacts with TAPBPL; TAPBPL binds peptide-free HLA-B-B2M complexes or those loaded with low affinity peptides, likely facilitating peptide exchange for higher affinity peptides. Only optimally assembled peptide-HLA-B-B2M trimer translocates to the surface of antigen-presenting cells, where it interacts with TCR and CD8 coreceptor on the surface of T cells. HLA-B (via polymorphic alpha-1 and alpha-2 domains) interacts with antigen-specific TCR (via CDR1, CDR2 and CDR3 domains) (PubMed:29531227). One HLA-B molecule (mainly via nonpolymorphic alpha-3 domain) interacts with one CD8A homodimer (via CDR-like loop); this interaction insures peptide-HLA-B-B2M recognition by CD8-positive T cells only (PubMed:29531227).

2 Publications

(Microbial infection) Interacts with HTLV-1 accessory protein p12I.

1 Publication

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Beta strandⁱ	27 – 36	Combined sources	10
Beta strandⁱ	41 – 43	Combined sources	3
Beta strandⁱ	45 – 52	Combined sources	8
Beta strandⁱ	55 – 61	Combined sources	7
Beta strandⁱ	64 – 66	Combined sources	3
Beta strandⁱ	70 – 73	Combined sources	4
Helixⁱ	74 – 76	Combined sources	3
Helixⁱ	81 – 108	Combined sources	28
Beta strandⁱ	113 – 115	Combined sources	3
Beta strandⁱ	118 – 127	Combined sources	10
Beta strandⁱ	133 – 142	Combined sources	10
Beta strandⁱ	145 – 150	Combined sources	6
Beta strandⁱ	157 – 161	Combined sources	5
Helixⁱ	162 – 173	Combined sources	12
Helixⁱ	176 – 185	Combined sources	10
Helixⁱ	187 – 198	Combined sources	12
Helixⁱ	200 – 203	Combined sources	4
Beta strandⁱ	210 – 219	Combined sources	10
Beta strandⁱ	222 – 235	Combined sources	14
Beta strandⁱ	238 – 243	Combined sources	6
Turnⁱ	249 – 251	Combined sources	3
Beta strandⁱ	252 – 254	Combined sources	3
Beta strandⁱ	261 – 263	Combined sources	3
Beta strandⁱ	265 – 274	Combined sources	10
Helixⁱ	278 – 280	Combined sources	3
Beta strandⁱ	281 – 286	Combined sources	6
Beta strandⁱ	290 – 292	Combined sources	3
Beta strandⁱ	294 – 296	Combined sources	3

Show more details

3D structure databases

ModBaseⁱ	Search...
SWISS-MODEL-Workspaceⁱ	Submit a new modelling project...
PDBe-KBⁱ	Search...

Family & Domainsⁱ

Domains and Repeats

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Domainⁱ	209 – 295	Ig-like C1-typeAdd BLAST		87

Region

Feature key	Position(s)	DescriptionActions	Length
Regionⁱ	25 – 114	Alpha-1Sequence analysisAdd BLAST	90
Regionⁱ	115 – 206	Alpha-2Sequence analysisAdd BLAST	92
Regionⁱ	207 – 298	Alpha-3Sequence analysisAdd BLAST	92
Regionⁱ	299 – 309	Connecting peptideSequence analysisAdd BLAST	11

Motif

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Motifⁱ	101 – 107	Bw6 motif involved in the recognition of inhibitory receptor KIR3DL1 on NK cells1 Publication		7

Domainⁱ

The alpha-1 domain is a structural part of the peptide-binding cleft.1 Publication

The alpha-2 domain is a structural part of the peptide-binding cleft (PubMed:25808313). Mediates the interaction with TAP1-TAP2 complex.1 Publication

The alpha-3 Ig-like domain mediates the interaction with CD8 coreceptor.

Keywords - Domainⁱ

Signal, Transmembrane, Transmembrane helix

Sequence (1+)ⁱ

Sequence statusⁱ: Complete.

Sequence processingⁱ: The displayed sequence is further processed into a mature form.

This entry has 1 described isoform and 20 potential isoforms that are computationally mapped.Show all Align All

P01889-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MLVMAPRTVL LLLSAALALT ETWAGSHSMR YFYTSVSRPG RGEPRFISVG 
        60         70         80         90        100
YVDDTQFVRF DSDAASPREE PRAPWIEQEG PEYWDRNTQI YKAQAQTDRE 
       110        120        130        140        150
SLRNLRGYYN QSEAGSHTLQ SMYGCDVGPD GRLLRGHDQY AYDGKDYIAL 
       160        170        180        190        200
NEDLRSWTAA DTAAQITQRK WEAAREAEQR RAYLEGECVE WLRRYLENGK 
       210        220        230        240        250
DKLERADPPK THVTHHPISD HEATLRCWAL GFYPAEITLT WQRDGEDQTQ 
       260        270        280        290        300
DTELVETRPA GDRTFQKWAA VVVPSGEEQR YTCHVQHEGL PKPLTLRWEP 
       310        320        330        340        350
SSQSTVPIVG IVAGLAVLAV VVIGAVVAAV MCRRKSSGGK GGSYSQAACS 
       360 
DSAQGSDVSL TA

Length:362

Mass (Da):40,460

Last modified:February 1, 1991 - v3

Checksum:ⁱ5E5A7BDE031403D6

Computationally mapped potential isoform sequencesⁱ

There are 20 potential isoforms mapped to this entry.BLAST Align Show all Add to basket

	Entry	Entry name	Protein names	Gene names	Length	Annotation

	A0A1W2PPR8	A0A1W2PPR8_HUMAN	HLA class I histocompatibility anti... HLA class I histocompatibility antigen, B-46 alpha chain	HLA-B	363	Annotation score:
	A0A140T9G0	A0A140T9G0_HUMAN	HLA class I histocompatibility anti... HLA class I histocompatibility antigen, B-46 alpha chain	HLA-B	241	Annotation score:
	A0A140T9S9	A0A140T9S9_HUMAN	HLA class I histocompatibility anti... HLA class I histocompatibility antigen, B-46 alpha chain	HLA-B	241	Annotation score:
	A0A140T951	A0A140T951_HUMAN	HLA class I histocompatibility anti... HLA class I histocompatibility antigen, B-46 alpha chain	HLA-B	241	Annotation score:
	A0A140T9A9	A0A140T9A9_HUMAN	HLA class I histocompatibility anti... HLA class I histocompatibility antigen, B-46 alpha chain	HLA-B	241	Annotation score:
	A0A140T9H3	A0A140T9H3_HUMAN	HLA class I histocompatibility anti... HLA class I histocompatibility antigen, B-46 alpha chain	HLA-B	241	Annotation score:
	A0A140TA02	A0A140TA02_HUMAN	HLA class I histocompatibility anti... HLA class I histocompatibility antigen, B-46 alpha chain	HLA-B	224	Annotation score:
	A0A1W2PNR7	A0A1W2PNR7_HUMAN	HLA class I histocompatibility anti... HLA class I histocompatibility antigen, B-46 alpha chain	HLA-B	253	Annotation score:
	A0A140TA11	A0A140TA11_HUMAN	HLA class I histocompatibility anti... HLA class I histocompatibility antigen, B-46 alpha chain	HLA-B	224	Annotation score:
	A0A140TA14	A0A140TA14_HUMAN	HLA class I histocompatibility anti... HLA class I histocompatibility antigen, B-46 alpha chain	HLA-B	224	Annotation score:
There are more potential isoformsShow all

Polymorphismⁱ

The most polymorphic of the mammalian genome. Polymorphic residues encode for alpha-1 and alpha-2 domains of the peptide-binding cleft, where they contribute to variations in peptide binding and TCR recognition among different alleles. The human population is estimated to have millions of HLA-B alleles. But only 17 common HLA-A alleles are considered core alleles, representing all functionally significant variation (polymorphism) in alpha-1 and alpha-2 domains. These are: B*07:02; B*08:01; B*13:02; B*15:01; B*18:01; B*27:05; B*35:01; B*37:01; B*38:01; B*40:01; B*44:02; B*45:01; B*51:01; B*54:01; B*57:01 and B*73:01. Among these, B*07:02; B*15:01; B*18:01; B*37:01; B*51:01; B*54:01; B*57:01 and B*73:01, were likely passed by introgression from archaic to modern humans. Functional alleles of more recent origin (non-core) were derived by recombination (PubMed:28650991). The sequence shown is that of B*07:02. The sequences of core alleles and common representative alleles of serologically distinct allele groups are described as variants of B*07:02.1 Publication

Natural variant

Feature key	Position(s)	DescriptionActions	Length
Natural variantⁱVAR_082483	2	L → R in allele B13:02, allele B15:01, allele B18:01, allele B27:01, allele B27:05, allele B35:01, allele B37:01, allele B40:01, allele B40:02, allele B41:01, allele B44:02, allele B45:01, allele B46:01, allele B47:01, allele B49:01, allele B50:01, allele B51:01, allele B52:01, allele B53:01, allele B54:01, allele B55:01, allele B56:01, allele B57:01, allele B58:01, allele B59:01, allele B78:01 and allele B*82:01. 34 Publications	1
Natural variantⁱVAR_082484	4	M → T in allele B13:02, allele B15:01, allele B18:01, allele B27:01, allele B27:05, allele B35:01, allele B37:01, allele B40:01, allele B40:02, allele B41:01, allele B44:02, allele B45:01, allele B46:01, allele B47:01, allele B49:01, allele B50:01, allele B51:01, allele B52:01, allele B53:01, allele B54:01, allele B55:01, allele B56:01, allele B57:01, allele B58:01, allele B59:01, allele B78:01 and allele B*82:01. 34 PublicationsCorresponds to variant dbSNP:rs1050458Ensembl.	1
Natural variantⁱVAR_082485	9	V → L in allele B13:02, allele B18:01, allele B27:01, allele B27:05, allele B37:01, allele B40:02, allele B44:02, allele B47:01, allele B54:01, allele B55:01, allele B56:01, allele B59:01 and allele B*82:01. 16 Publications	1
Natural variantⁱVAR_082486	14	S → W in allele B13:02, allele B18:01, allele B27:01, allele B27:05, allele B35:01, allele B37:01, allele B40:02, allele B44:02, allele B47:01, allele B51:01, allele B52:01, allele B53:01, allele B54:01, allele B55:01, allele B56:01, allele B57:01, allele B58:01, allele B59:01, allele B78:01, allele B81:01 and allele B*82:01. 30 Publications	1
Natural variantⁱVAR_082487	15	A → G in allele B13:02, allele B15:01, allele B18:01, allele B27:01, allele B27:05, allele B35:01, allele B37:01, allele B40:02, allele B44:02, allele B46:01, allele B47:01, allele B51:01, allele B52:01, allele B53:01, allele B54:01, allele B55:01, allele B56:01, allele B57:01, allele B58:01, allele B59:01, allele B78:01, allele B81:01 and allele B*82:01. 33 Publications	1
Natural variantⁱVAR_082488	17	L → V in allele B13:02, allele B18:01, allele B27:01, allele B27:05, allele B35:01, allele B37:01, allele B40:02, allele B44:02, allele B47:01, allele B51:01, allele B52:01, allele B53:01, allele B57:01, allele B58:01, allele B78:01 and allele B81:01. 24 Publications	1
Natural variantⁱVAR_082489	33	Y → D in allele B*08:01. 3 Publications	1
Natural variantⁱVAR_082490	33	Y → H in allele B18:01, allele B27:01, allele B27:05, allele B37:01, allele B40:01, allele B40:02, allele B41:01, allele B45:01, allele B49:01, allele B50:01 and allele B*73:01. 18 Publications	1
Natural variantⁱVAR_082491	35	S → A in allele B08:01, allele B13:02, allele B15:01, allele B35:01, allele B40:01, allele B41:01, allele B44:02, allele B45:01, allele B46:01, allele B47:01, allele B49:01, allele B50:01, allele B51:01, allele B52:01, allele B53:01, allele B54:01, allele B55:01, allele B56:01, allele B57:01, allele B58:01, allele B59:01, allele B78:01 and allele B*82:01. 30 PublicationsCorresponds to variant dbSNP:rs1131170Ensembl.	1
Natural variantⁱVAR_082492	36	V → M in allele B08:01, allele B13:02, allele B15:01, allele B35:01, allele B40:01, allele B41:01, allele B44:02, allele B45:01, allele B46:01, allele B47:01, allele B49:01, allele B50:01, allele B51:01, allele B52:01, allele B53:01, allele B54:01, allele B55:01, allele B56:01, allele B57:01, allele B58:01, allele B59:01, allele B78:01 and allele B*82:01. 30 PublicationsCorresponds to variant dbSNP:rs1050486Ensembl.	1
Natural variantⁱVAR_082493	48	S → A in allele B15:01, allele B35:01, allele B46:01, allele B51:01, allele B52:01, allele B53:01, allele B54:01, allele B55:01, allele B56:01, allele B57:01, allele B58:01, allele B59:01 and allele B*78:01. 20 PublicationsCorresponds to variant dbSNP:rs713031Ensembl.	1
Natural variantⁱVAR_082494	48	S → T in allele B13:02, allele B27:01, allele B27:05, allele B40:01, allele B40:02, allele B41:01, allele B44:02, allele B45:01, allele B47:01, allele B49:01, allele B50:01 and allele B73:01. 19 PublicationsCorresponds to variant dbSNP:rs713031Ensembl.	1
Natural variantⁱVAR_082495	54	D → G in allele B*18:01. 2 Publications	1
Natural variantⁱVAR_082496	56	Q → L in allele B27:01, allele B27:05, allele B40:01, allele B40:02, allele B41:01, allele B44:02, allele B45:01, allele B47:01, allele B49:01 and allele B50:01. 14 Publications	1
Natural variantⁱVAR_082497	65	A → T in allele B13:02, allele B40:01, allele B40:02, allele B41:01, allele B44:02, allele B45:01, allele B47:01, allele B49:01 and allele B*50:01. 12 Publications	1
Natural variantⁱVAR_082498	69	E → G in allele B*54:01. 1 Publication	1
Natural variantⁱVAR_082499	69	E → K in allele B40:01, allele B40:02, allele B41:01, allele B44:02, allele B45:01, allele B47:01, allele B49:01 and allele B50:01. 11 Publications	1
Natural variantⁱVAR_082500	69	E → M in allele B13:02, allele B15:01, allele B46:01 and allele B57:01; requires 2 nucleotide substitutions. 8 Publications	1
Natural variantⁱVAR_082501	69	E → T in allele B18:01, allele B35:01, allele B37:01, allele B51:01, allele B52:01, allele B53:01, allele B58:01 and allele B78:01; requires 2 nucleotide substitutions. 13 Publications	1
Natural variantⁱVAR_082502	70	E → A in allele B13:02, allele B15:01, allele B46:01 and allele B57:01. 8 Publications	1
Natural variantⁱVAR_082503	76	I → V in allele B*54:01. 1 Publication	1
Natural variantⁱVAR_082504	86	R → G in allele B57:01 and allele B58:01. 4 Publications	1
Natural variantⁱVAR_082505	87	N → E in allele B13:02, allele B15:01, allele B27:01, allele B27:05, allele B37:01, allele B39:02, allele B40:01, allele B40:02, allele B41:01, allele B44:02, allele B45:0, allele B46:01, allele B47:01, allele B48:01, allele B49:01,allele B50:01, allele B52:01, allele B57:01 and allele B*58:01; requires 2 nucleotide substitutions. 27 Publications	1
Natural variantⁱVAR_082506	89	Q → R in allele B57:01 and allele B58:01. 4 Publications	1
Natural variantⁱVAR_082507	90	I → K in allele B*46:01. 1 Publication	1
Natural variantⁱVAR_082508	90	I → N in allele B57:01 and allele B58:01. 4 Publications	1
Natural variantⁱVAR_082509	91	Y → C in allele B14:01, allele B27:01, allele B27:05, allele B38:01 and allele B*73:01. 10 Publications	1
Natural variantⁱVAR_082510	91	Y → F in allele B08:01, allele B35:01, allele B51:01, allele B53:01, allele B59:01 and allele B78:01. 12 Publications	1
Natural variantⁱVAR_082511	91	Y → M in allele B57:01 and allele B58:01; requires 2 nucleotide substitutions. 4 Publications	1
Natural variantⁱVAR_082512	91	Y → S in allele B13:02, allele B15:01, allele B18:01, allele B37:01, allele B39:02, allele B40:01, allele B40:02, allele B41:01, allele B44:02, allele B45:01, allele B47:01, allele B48:01, allele B49:01,allele B50:01 and allele B*52:01. 21 Publications	1
Natural variantⁱVAR_082513	93	A → R in allele B*46:01; requires 2 nucleotide substitutions. 1 Publication	1
Natural variantⁱVAR_082514	93	A → T in allele B08:01, allele B13:02, allele B14:01, allele B15:01, allele B18:01, allele B35:01, allele B37:01, allele B38:01, allele B39:02, allele B40:01, allele B40:02, allele B41:01, allele B44:02, allele B45:01, allele B47:01, allele B48:01, allele B49:01, allele B50:01, allele B51:01, allele B52:01, allele B53:01, allele B59:01 and allele B*78:01. 29 Publications	1
Natural variantⁱVAR_082515	94	Q → K in allele B27:01, allele B27:05 and allele B*73:01. 7 Publications	1
Natural variantⁱVAR_082516	94	Q → N in allele B08:01, allele B13:02, allele B14:01, allele B15:01, allele B18:01, allele B35:01, allele B37:01, allele B38:01, allele B39:02, allele B40:01, allele B40:02, allele B41:01, allele B44:02, allele B45:01, allele B47:01, allele B48:01, allele B49:01, allele B50:01, allele B51:01, allele B52:01, allele B53:01, allele B59:01 and allele B*78:01; requires 2 nucleotide substitutions. 29 Publications	1
Natural variantⁱVAR_082517	94	Q → S in allele B57:01 and allele B58:01; requires 2 nucleotide substitutions. 4 Publications	1
Natural variantⁱVAR_082518	95	A → T in allele B08:01, allele B13:02, allele B14:01, allele B15:01, allele B18:01, allele B35:01, allele B37:01, allele B38:01, allele B39:02, allele B40:01, allele B40:02, allele B41:01, allele B44:02, allele B45:01, allele B47:01, allele B48:01, allele B49:01, allele B50:01, allele B51:01, allele B52:01, allele B53:01, allele B59:01 and allele B*78:01. 29 Publications	1
Natural variantⁱVAR_082519	98	D → Y in allele B13:02, allele B15:01, allele B18:01, allele B27:01, allele B35:01, allele B37:01, allele B38:01, allele B40:01, allele B40:02, allele B41:01, allele B44:02, allele B45:01, allele B47:01, allele B48:01, allele B49:01, allele B50:01, allele B51:01, allele B52:01, allele B53:01, allele B57:01, allele B58:01 and allele B59:01. 30 Publications

UniProtKB - P01889 (HLAB_HUMAN)

Your basket is currently empty. ⁱ

HLA class I histocompatibility antigen, B alpha chain

HLA-B

Select a section on the left to see content.

Functionⁱ

Sites

Keywordsⁱ

Names & Taxonomyⁱ

Organism-specific databases

Subcellular locationⁱ

Plasma membrane

Endoplasmic reticulum

Topology

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

Involvement in diseaseⁱ

Stevens-Johnson syndrome (SJS)

Spondyloarthropathy 1 (SPDA1)

Organism-specific databases

PTM / Processingⁱ

Molecule processing

Amino acid modifications

Keywords - PTMⁱ

Interactionⁱ

Subunit structureⁱ

Structureⁱ

Secondary structure

3D structure databases

Family & Domainsⁱ

Domains and Repeats

Region

Motif

Domainⁱ

Keywords - Domainⁱ

Sequence (1+)ⁱ

Computationally mapped potential isoform sequencesⁱ

Polymorphismⁱ

Natural variant

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P01889 (HLAB_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

HLA class I histocompatibility antigen, B alpha chain

HLA-B

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Sites

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Plasma membrane

Endoplasmic reticulum

Topology

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Stevens-Johnson syndrome (SJS)

Spondyloarthropathy 1 (SPDA1)

Organism-specific databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Region

Motif

Keywords - Domaini

Natural variant

Your basket is currently empty. ⁱ

Functionⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Keywords - Domainⁱ