Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P01871 (IGHM_HUMAN)

Entry version 192 (16 Oct 2019)
Sequence version 4 (15 Mar 2017)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Immunoglobulin heavy constant mu

Gene

IGHM

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Constant region of immunoglobulin heavy chains. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens (PubMed:22158414, PubMed:20176268). The antigen binding site is formed by the variable domain of one heavy chain, together with that of its associated light chain. Thus, each immunoglobulin has two antigen binding sites with remarkable affinity for a particular antigen. The variable domains are assembled by a process called V-(D)-J rearrangement and can then be subjected to somatic hypermutations which, after exposure to antigen and selection, allow affinity maturation for a particular antigen (PubMed:17576170, PubMed:20176268). IgM antibodies play an important role in primary defense mechanisms. They have been shown to be involved in early recognition of external invaders like bacteria and viruses, cellular waste and modified self, as well as in recognition and elimination of precancerous and cancerous lesions. The membrane-bound form is found in the majority of normal B-cells alongside with IgD. Membrane-bound IgM induces the phosphorylation of CD79A and CD79B by the Src family of protein tyrosine kinases. It may cause death of cells by apoptosis. It is also found in soluble form, which represents about 30% of the total serum immunoglobulins where it is found almost exclusively as a homopentamer. After the antigen binds to the B-cell receptor, the secreted form is secreted in large amounts (PubMed:3137579, PubMed:16895553).4 Publications1 Publication

Caution

For an example of a full-length immunoglobulin mu heavy chain see AC P0DOX6.Curated

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processAdaptive immunity, Immunity

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-202733 Cell surface interactions at the vascular wall
R-HSA-5690714 CD22 mediated BCR regulation
R-HSA-983695 Antigen activates B Cell Receptor (BCR) leading to generation of second messengers

Protein family/group databases

IMGT/GENE-DBIGHM

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Immunoglobulin heavy constant mu2 Publications
Alternative name(s):
Ig mu chain C regionCurated
Ig mu chain C region BOT1 Publication
Ig mu chain C region GAL1 Publication
Ig mu chain C region OU1 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:IGHM2 Publications
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 14

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:5541 IGHM

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		147020 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P01871

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Immunoglobulin, Membrane, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Agammaglobulinemia 1, autosomal recessive (AGM1)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA primary immunodeficiency characterized by profoundly low or absent serum antibodies and low or absent circulating B cells due to an early block of B-cell development. Affected individuals develop severe infections in the first years of life.
Related information in OMIM

Organism-specific databases

DisGeNET

More...DisGeNETi		3507

MalaCards human disease database

More...MalaCardsi		IGHM
MIMi601495 phenotype

Open Targets

More...OpenTargetsi		ENSG00000211899

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		33110 Autosomal agammaglobulinemia

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P01871

Chemistry databases

Drug and drug target database

More...DrugBanki		DB01593 Zinc
DB14487 Zinc acetate
DB14533 Zinc chloride

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		IGHM

Domain mapping of disease mutations (DMDM)

More...DMDMi		127506

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_0000153619‹1 – 453Immunoglobulin heavy constant muAdd BLAST›453

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi14Interchain (with light chain)1 Publication
Disulfide bondi28 ↔ 88Combined sources2 Publications
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi46N-linked (GlcNAc...) (complex) asparagineCombined sources4 Publications1
Disulfide bondi134 ↔ 197PROSITE-ProRule annotation
Glycosylationi209N-linked (GlcNAc...) (complex) asparagine1 Publication1
Disulfide bondi214Interchain (with heavy chain)1 Publication
Disulfide bondi244 ↔ 303PROSITE-ProRule annotation
Glycosylationi272N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi279N-linked (GlcNAc...) asparagine2 Publications1
Disulfide bondi291Interchain (with heavy chain of another subunit)1 Publication
Disulfide bondi351 ↔ 413PROSITE-ProRule annotation
GlycosylationiCAR_000219440N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi452Interchain (with heavy chain)1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

The CPTAC Assay portal

More...CPTACi		non-CPTAC-2676

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P01871

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P01871

PeptideAtlas

More...PeptideAtlasi		P01871

PRoteomics IDEntifications database

More...PRIDEi		P01871

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		51498 [P01871-1]
51499 [P01871-2]
51686

2D gel databases

University College Dublin 2-DE Proteome Database

More...UCD-2DPAGEi		P01871

PTM databases

CarbonylDB database of protein carbonylation sites

More...CarbonylDBi		P01871

GlyConnect protein glycosylation platform

More...GlyConnecti		280
691 [P01871-2]

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P01871

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P01871

SwissPalm database of S-palmitoylation events

More...SwissPalmi		P01871

UniCarbKB; an annotated and curated database of glycan structures

More...UniCarbKBi		P01871

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000211899 Expressed in 178 organ(s), highest expression level in lymph node

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P01871 baseline and differential

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Immunoglobulins are composed of two identical heavy chains and two identical light chains; disulfide-linked.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
CD19P153912EBI-953797,EBI-79902

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		P01871

Protein interaction database and analysis system

More...IntActi		P01871, 66 interactors

Molecular INTeraction database

More...MINTi		P01871

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1453
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P01871

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		P01871

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini6 – 102Ig-like 1PROSITE-ProRule annotationAdd BLAST97
Domaini111 – 211Ig-like 2PROSITE-ProRule annotationAdd BLAST101
Domaini229 – 319Ig-like 3PROSITE-ProRule annotationAdd BLAST91
Domaini329 – 430Ig-like 4PROSITE-ProRule annotationAdd BLAST102

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 105CH1Add BLAST105
Regioni106 – 217CH2Add BLAST112
Regioni218 – 323CH3Add BLAST106
Regioni324 – 452CH4Add BLAST129

Keywords - Domaini

Immunoglobulin domain, Transmembrane

Phylogenomic databases

Ensembl GeneTree

More...GeneTreei		ENSGT00940000161491

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000202819

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P01871

Identification of Orthologs from Complete Genome Data

More...OMAi		ENLWATA

Database for complete collections of gene phylogenies

More...PhylomeDBi		P01871

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.60.40.10, 4 hits

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003006 Ig/MHC_CS
IPR003597 Ig_C1-set

Pfam protein domain database

More...Pfami		View protein in Pfam
PF07654 C1-set, 4 hits

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00407 IGc1, 4 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF48726 SSF48726, 4 hits

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50835 IG_LIKE, 4 hits
PS00290 IG_MHC, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: P01871-1) [UniParc]FASTAAdd to basket
Also known as: Secreted

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
GSASAPTLFP LVSCENSPSD TSSVAVGCLA QDFLPDSITF SWKYKNNSDI 
        60         70         80         90        100
SSTRGFPSVL RGGKYAATSQ VLLPSKDVMQ GTDEHVVCKV QHPNGNKEKN 
       110        120        130        140        150
VPLPVIAELP PKVSVFVPPR DGFFGNPRKS KLICQATGFS PRQIQVSWLR 
       160        170        180        190        200
EGKQVGSGVT TDQVQAEAKE SGPTTYKVTS TLTIKESDWL GQSMFTCRVD 
       210        220        230        240        250
HRGLTFQQNA SSMCVPDQDT AIRVFAIPPS FASIFLTKST KLTCLVTDLT 
       260        270        280        290        300
TYDSVTISWT RQNGEAVKTH TNISESHPNA TFSAVGEASI CEDDWNSGER 
       310        320        330        340        350
FTCTVTHTDL PSPLKQTISR PKGVALHRPD VYLLPPAREQ LNLRESATIT 
       360        370        380        390        400
CLVTGFSPAD VFVQWMQRGQ PLSPEKYVTS APMPEPQAPG RYFAHSILTV 
       410        420        430        440        450
SEEEWNTGET YTCVVAHEAL PNRVTERTVD KSTGKPTLYN VSLVMSDTAG 

TCY
Length:453
Mass (Da):49,440
Last modified:March 15, 2017 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i607CA2FA7BFA0D39
GO
Isoform 2 (identifier: P01871-2) [UniParc]FASTAAdd to basket
Also known as: Membrane-bound

The sequence of this isoform differs from the canonical sequence as follows:
     434-453: GKPTLYNVSLVMSDTAGTCY → EGEVSADEEGFENLWATASTFIVLFLLSLFYSTTVTLFKVK

Show »
Length:474
Mass (Da):51,924
Checksum:i7A66A47C8810BDF1
GO

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence CAA33065 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence CAA33069 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence CAA33071 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence CAA34971 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated
The sequence CAE82013 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence CAE82014 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section is used for sequence fragments to indicate that the residue at the extremity of the sequence is not the actual terminal residue in the complete protein sequence.<p><a href='/help/non_ter' target='_top'>More...</a></p>Non-terminal residuei11
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti128R → RS in CAA34971 (PubMed:2115996).Curated1
Sequence conflicti145Q → E AA sequence (PubMed:6425189).Curated1
Sequence conflicti163 – 165QVQ → EVE AA sequence (PubMed:6425189).Curated3
Sequence conflicti220T → I in CAB37838 (Ref. 6) Curated1
Sequence conflicti263N → D AA sequence (PubMed:6425189).Curated1
Sequence conflicti296N → D AA sequence (PubMed:6425189).Curated1
Isoform 2 (identifier: P01871-2)
Sequence conflicti438S → N in AAB59422 (PubMed:6795593).Curated1
Sequence conflicti440D → E in AAB59422 (PubMed:6795593).Curated1
Sequence conflicti449A → T in AAB59422 (PubMed:6795593).Curated1
Sequence conflicti472 – 474KVK → K in AAB59422 (PubMed:6795593).Curated3
Sequence conflicti472 – 474KVK → K in CAA33065 (PubMed:2505237).Curated3

<p>This subsection of the ‘Sequence’ section provides information on polymorphic variants. If the variant is associated with a disease state, the description of the latter can be found in the <a href="http://www.uniprot.org/manual/involvement_in_disease">'Involvement in disease'</a> subsection.<p><a href='/help/polymorphism' target='_top'>More...</a></p>Polymorphismi

There are several alleles. The sequence shown is that of IMGT allele IGHM*04.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_07789340F → L in IMGT allele IGHM*01. 1 Publication1
Natural variantiVAR_003903191G → S in IMGT allele IGHM*03. 1 Publication1
Natural variantiVAR_003904215V → G1 PublicationCorresponds to variant dbSNP:rs12365Ensembl.1
Natural variantiVAR_077894414Missing in IMGT allele IGHM*01 IMGT allele IGHM*02. 2 Publications1
Natural variantiVAR_077895418E → D in IMGT allele IGHM*02. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_034488434 – 453GKPTL…AGTCY → EGEVSADEEGFENLWATAST FIVLFLLSLFYSTTVTLFKV K in isoform 2. 2 PublicationsAdd BLAST20

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
X14940 Genomic DNA Translation: CAE82013.1 Different initiation.
X14940 Genomic DNA Translation: CAE82014.1 Different initiation.
X14940 Genomic DNA Translation: CAA33069.1 Different initiation.
X14940 Genomic DNA Translation: CAA33070.1
X14940 Genomic DNA Translation: CAA33071.1 Sequence problems.
X14939 Genomic DNA Translation: CAA33065.1 Different initiation.
X17115 mRNA Translation: CAA34971.1 Different initiation.
X57086 mRNA Translation: CAB37838.1
AC244226 Genomic DNA No translation available.
AC245166 Genomic DNA No translation available.
AC246787 Genomic DNA No translation available.
AC247036 Genomic DNA No translation available.
K01310 Genomic DNA Translation: AAB59422.1

Protein sequence database of the Protein Information Resource

More...PIRi		A02163 MHHUBT
S14683
S16510 MHHUM

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000390559; ENSP00000375001; ENSG00000211899 [P01871-1]
ENST00000626472; ENSP00000485962; ENSG00000282657 [P01871-1]
ENST00000637539; ENSP00000490253; ENSG00000211899 [P01871-2]

UCSC genome browser

More...UCSCi		uc059gdp.1 human

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

IGHMbase

IGHM mutation db

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X14940 Genomic DNA Translation: CAE82013.1 Different initiation.
X14940 Genomic DNA Translation: CAE82014.1 Different initiation.
X14940 Genomic DNA Translation: CAA33069.1 Different initiation.
X14940 Genomic DNA Translation: CAA33070.1
X14940 Genomic DNA Translation: CAA33071.1 Sequence problems.
X14939 Genomic DNA Translation: CAA33065.1 Different initiation.
X17115 mRNA Translation: CAA34971.1 Different initiation.
X57086 mRNA Translation: CAB37838.1
AC244226 Genomic DNA No translation available.
AC245166 Genomic DNA No translation available.
AC246787 Genomic DNA No translation available.
AC247036 Genomic DNA No translation available.
K01310 Genomic DNA Translation: AAB59422.1
PIRiA02163 MHHUBT
S14683
S16510 MHHUM

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1HEZX-ray2.70B/D1-104[»]
2AGJX-ray2.60H1-105[»]
2RCJX-ray-C/D/G/H/K/L/O/P/S/T1-326[»]
SMRiP01871
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

CORUMiP01871
IntActiP01871, 66 interactors
MINTiP01871

Chemistry databases

DrugBankiDB01593 Zinc
DB14487 Zinc acetate
DB14533 Zinc chloride

Protein family/group databases

IMGT/GENE-DBIGHM

PTM databases

CarbonylDBiP01871
GlyConnecti280
691 [P01871-2]
iPTMnetiP01871
PhosphoSitePlusiP01871
SwissPalmiP01871
UniCarbKBiP01871

Polymorphism and mutation databases

BioMutaiIGHM
DMDMi127506

2D gel databases

UCD-2DPAGEiP01871

Proteomic databases

CPTACinon-CPTAC-2676
jPOSTiP01871
MassIVEiP01871
PeptideAtlasiP01871
PRIDEiP01871
ProteomicsDBi51498 [P01871-1]
51499 [P01871-2]
51686

Genome annotation databases

EnsembliENST00000390559; ENSP00000375001; ENSG00000211899 [P01871-1]
ENST00000626472; ENSP00000485962; ENSG00000282657 [P01871-1]
ENST00000637539; ENSP00000490253; ENSG00000211899 [P01871-2]
UCSCiuc059gdp.1 human

Organism-specific databases

DisGeNETi3507

GeneCards: human genes, protein and diseases

More...GeneCardsi		IGHM
HGNCiHGNC:5541 IGHM
MalaCardsiIGHM
MIMi147020 gene
601495 phenotype
neXtProtiNX_P01871
OpenTargetsiENSG00000211899
Orphaneti33110 Autosomal agammaglobulinemia

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

GeneTreeiENSGT00940000161491
HOGENOMiHOG000202819
InParanoidiP01871
OMAiENLWATA
PhylomeDBiP01871

Enzyme and pathway databases

ReactomeiR-HSA-202733 Cell surface interactions at the vascular wall
R-HSA-5690714 CD22 mediated BCR regulation
R-HSA-983695 Antigen activates B Cell Receptor (BCR) leading to generation of second messengers

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		IGHM human
EvolutionaryTraceiP01871
PharosiP01871

Protein Ontology

More...PROi		PR:P01871

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000211899 Expressed in 178 organ(s), highest expression level in lymph node
ExpressionAtlasiP01871 baseline and differential

Family and domain databases

Gene3Di2.60.40.10, 4 hits
InterProiView protein in InterPro
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003006 Ig/MHC_CS
IPR003597 Ig_C1-set
PfamiView protein in Pfam
PF07654 C1-set, 4 hits
SMARTiView protein in SMART
SM00407 IGc1, 4 hits
SUPFAMiSSF48726 SSF48726, 4 hits
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 4 hits
PS00290 IG_MHC, 3 hits

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiIGHM_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P01871
Secondary accession number(s): A0A075B6N9
, A0A0G2JQL4, P04220, P20769
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 21, 1986
Last sequence update: March 15, 2017
Last modified: October 16, 2019
This is version 192 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again