Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Insulin-like growth factor II

Gene

IGF2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

The insulin-like growth factors possess growth-promoting activity. Major fetal growth hormone in mammals. Plays a key role in regulating fetoplacental development. IGF-II is influenced by placental lactogen. Also involved in tissue differentiation. Positively regulates myogenic transcription factor MYOD1 function by facilitating the recruitment of transcriptional coactivators, thereby controlling muscle terminal differentiation (By similarity). In adults, involved in glucose metabolism in adipose tissue, skeletal muscle and liver (Probable). Acts as a ligand for integrin which is required for IGF2 signaling (PubMed:28873464).By similarity1 Publication1 Publication
Preptin undergoes glucose-mediated co-secretion with insulin, and acts as physiological amplifier of glucose-mediated insulin secretion. Exhibits osteogenic properties by increasing osteoblast mitogenic activity through phosphoactivation of MAPK1 and MAPK3.1 Publication

Miscellaneous

The IGF2 locus is imprinted. Paternal inherited gene is expressed, while the maternal inherited gene is imprinted, hence silenced. Transcripts from 5 promoters P0, P1, P2, P3 and P4 code for the same protein but are differentially regulated in a developmental stage and tissue specificity.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei48Important for interaction with integrin1 Publication1
Sitei58Important for interaction with integrin1 Publication1
Sitei61Important for interaction with integrin1 Publication1
Sitei62Important for interaction with integrin1 Publication1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • growth factor activity Source: BHF-UCL
  • hormone activity Source: UniProtKB-KW
  • insulin-like growth factor receptor binding Source: AgBase
  • insulin receptor binding Source: BHF-UCL
  • integrin binding Source: UniProtKB
  • protein serine/threonine kinase activator activity Source: BHF-UCL
  • receptor ligand activity Source: BHF-UCL

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGrowth factor, Hormone, Mitogen
Biological processCarbohydrate metabolism, Glucose metabolism, Osteogenesis

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-114608 Platelet degranulation
R-HSA-2404192 Signaling by Type 1 Insulin-like Growth Factor 1 Receptor (IGF1R)
R-HSA-2428928 IRS-related events triggered by IGF1R
R-HSA-2428933 SHC-related events triggered by IGF1R
R-HSA-381426 Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
P01344

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P01344

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Insulin-like growth factor II
Short name:
IGF-II
Alternative name(s):
Somatomedin-A
T3M-11-derived growth factor
Cleaved into the following 3 chains:
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:IGF2
ORF Names:PP1446
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000167244.18

Human Gene Nomenclature Database

More...
HGNCi
HGNC:5466 IGF2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
147470 gene+phenotype

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P01344

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Silver-Russell syndrome (SRS)1 Publication
The gene represented in this entry is involved in disease pathogenesis. Most of the cases of Silver-Russell syndrome are caused by the epigenetic changes of DNA hypomethylation at the telomeric imprinting control region (ICR1) on chromosome 11p15, involving the H19 and IGF2 genes.
Disease descriptionA clinically heterogeneous condition characterized by severe intrauterine growth retardation, poor postnatal growth, craniofacial features such as a triangular shaped face and a broad forehead, body asymmetry, and a variety of minor malformations. The phenotypic expression changes during childhood and adolescence, with the facial features and asymmetry usually becoming more subtle with age.
See also OMIM:180860
Growth restriction, severe, with distinctive facies (GRDF)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA disease characterized by severe prenatal and postnatal growth restriction, facial dysmorphism, and short stature in the presence of normal or slightly elevated growth hormone levels.
See also OMIM:616489

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi48R → E: Does not affect integrin binding. Defective integrin binding and IGF2 signaling; when associated with E-58; E-61 and E-62. 1 Publication1
Mutagenesisi58R → E: Does not affect integrin binding. Defective integrin binding and IGF2 signaling; when associated with E-48; E-61 and E-62. 1 Publication1
Mutagenesisi61R → E: Does not affect integrin binding. Defective integrin binding and IGF2 signaling; when associated with E-48; E-58 and E-62. 1 Publication1
Mutagenesisi62R → E: Does not affect integrin binding. Defective integrin binding and IGF2 signaling; when associated with E-48; E-58 and E-61. 1 Publication1
Mutagenesisi64R → E: Slight but significant increase in integrin binding. 1 Publication1
Mutagenesisi92R → A: Decreases mature IGF2 levels. 1 Publication1
Mutagenesisi112K → A: No effect in proteolytical processing. 1 Publication1
Mutagenesisi128R → A: Abolishes proteolytical processing. 1 Publication1

Keywords - Diseasei

Dwarfism

Organism-specific databases

DisGeNET

More...
DisGeNETi
3481

GeneReviews a resource of expert-authored, peer-reviewed disease descriptions.

More...
GeneReviewsi
IGF2

MalaCards human disease database

More...
MalaCardsi
IGF2
MIMi147470 gene+phenotype
180860 phenotype
616489 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000167244

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
231117 Beckwith-Wiedemann syndrome due to imprinting defect of 11p15
2128 Isolated hemihyperplasia
231144 Silver-Russell syndrome due to 11p15 microduplication
397590 Silver-Russell syndrome due to a point mutation
231140 Silver-Russell syndrome due to an imprinting defect of 11p15

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA29699

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL3712957

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
IGF2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
124255

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 242 PublicationsAdd BLAST24
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001571725 – 91Insulin-like growth factor IIAdd BLAST67
ChainiPRO_000001571826 – 91Insulin-like growth factor II Ala-25 DelAdd BLAST66
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes a propeptide, which is a part of a protein that is cleaved during maturation or activation. Once cleaved, a propeptide generally has no independent biological function.<p><a href='/help/propep' target='_top'>More...</a></p>PropeptideiPRO_000001571992 – 180E peptideAdd BLAST89
<p>This subsection of the ‘PTM / Processing’ section describes the position and length of an active peptide in the mature protein.<p><a href='/help/peptide' target='_top'>More...</a></p>PeptideiPRO_000037037693 – 126PreptinAdd BLAST34

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi33 ↔ 711 Publication
Disulfide bondi45 ↔ 841 Publication
Disulfide bondi70 ↔ 751 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi96O-linked (GalNAc...) threonine2 Publications1
Glycosylationi99O-linked (GalNAc...) threonine2 Publications1
Glycosylationi163O-linked (GalNAc...) threonine2 Publications1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

O-glycosylated with core 1 or possibly core 8 glycans. Thr-96 is a minor glycosylation site compared to Thr-99.4 Publications
Proteolytically processed by PCSK4, proIGF2 is cleaved at Arg-128 and Arg-92 to generate big-IGF2 and mature IGF2.1 Publication

Keywords - PTMi

Cleavage on pair of basic residues, Disulfide bond, Glycoprotein

Proteomic databases

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P01344

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P01344

PeptideAtlas

More...
PeptideAtlasi
P01344

PRoteomics IDEntifications database

More...
PRIDEi
P01344

ProteomicsDB human proteome resource

More...
ProteomicsDBi
12641 [P01344-2]
51375
51376 [P01344-2]

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
760

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P01344

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P01344

UniCarbKB; an annotated and curated database of glycan structures

More...
UniCarbKBi
P01344

Miscellaneous databases

CutDB - Proteolytic event database

More...
PMAP-CutDBi
P01344

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in heart, placenta, lung, liver, muscle, kidney, tongue, limb, eye and pancreas.1 Publication

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

During embryogenesis, detected in liver, lung, skeletal muscle and placenta.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000167244 Expressed in 212 organ(s), highest expression level in metanephros

CleanEx database of gene expression profiles

More...
CleanExi
HS_IGF2

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P01344 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA007556
HPA007993

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with MYORG; this interaction is required for IGF2 secretion (By similarity). Interacts with integrins ITGAV:ITGB3 and ITGA6:ITGB4; integrin-binding is required for IGF2 signaling (PubMed:28873464).By similarity1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
109702, 30 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
P01344

Database of interacting proteins

More...
DIPi
DIP-29508N

Protein interaction database and analysis system

More...
IntActi
P01344, 10 interactors

Molecular INTeraction database

More...
MINTi
P01344

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000391826

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1180
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P01344

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P01344

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P01344

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni25 – 52BAdd BLAST28
Regioni53 – 64CAdd BLAST12
Regioni65 – 85AAdd BLAST21
Regioni86 – 91D6

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the insulin family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IY3P Eukaryota
ENOG4111KP2 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000160745

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000233362

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG006137

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P01344

KEGG Orthology (KO)

More...
KOi
K13769

Identification of Orthologs from Complete Genome Data

More...
OMAi
WQRKAAQ

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0H56

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P01344

TreeFam database of animal gene trees

More...
TreeFami
TF332820

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR022334 IGF2
IPR013576 IGF2_C
IPR016179 Insulin-like
IPR022350 Insulin-like_growth_factor
IPR036438 Insulin-like_sf
IPR022353 Insulin_CS
IPR022352 Insulin_family

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF08365 IGF2_C, 1 hit
PF00049 Insulin, 2 hits

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR02002 INSLNLIKEGF
PR02006 INSLNLIKEGF2
PR00276 INSULINFAMLY

ProDom; a protein domain database

More...
ProDomi
View protein in ProDom or Entries sharing at least one domain
PD005188 IGF2_C, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00078 IlGF, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF56994 SSF56994, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00262 INSULIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: P01344-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGIPMGKSML VLLTFLAFAS CCIAAYRPSE TLCGGELVDT LQFVCGDRGF
60 70 80 90 100
YFSRPASRVS RRSRGIVEEC CFRSCDLALL ETYCATPAKS ERDVSTPPTV
110 120 130 140 150
LPDNFPRYPV GKFFQYDTWK QSTQRLRRGL PALLRARRGH VLAKELEAFR
160 170 180
EAKRHRPLIA LPTQDPAHGG APPEMASNRK
Note: Product of 5 different transcripts regulated by 5 different promoters, denominated P0, P1, P2, P3 and P4.1 Publication
Length:180
Mass (Da):20,140
Last modified:July 21, 1986 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC1B0EB1E016BA37A
GO
Isoform 2 (identifier: P01344-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     53-53: S → RLPG

Show »
Length:183
Mass (Da):20,477
Checksum:iA54CD97B56C2B96F
GO
Isoform 3 (identifier: P01344-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MVSPDPQIIVVAPETELASMQVQRTEDGVTIIQIFWVGRKGELLRRTPVSSAMQTPM

Note: Gene prediction based on EST data.
Show »
Length:236
Mass (Da):26,331
Checksum:iCF1395E851055BF6
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti3I → M in AAA52544 (PubMed:3683205).Curated1
Sequence conflicti107 – 110RYPV → EIPL in CAA27249 (PubMed:6382022).Curated4
Sequence conflicti147E → ELE in AAA60088 (PubMed:3476948).Curated1

<p>This subsection of the ‘Sequence’ section reports information derived from mass spectrometry experiments done on the entire protein or on biologically active derived peptide(s).<p><a href='/help/mass_spectrometry' target='_top'>More...</a></p>Mass spectrometryi

Molecular mass is 7469.4 Da from positions 25 - 91. Determined by MALDI. 2 Publications
Molecular mass is 7398.3 Da from positions 26 - 91. Determined by MALDI. 2 Publications

<p>This subsection of the ‘Sequence’ section provides information on polymorphic variants. If the variant is associated with a disease state, the description of the latter can be found in the <a href="http://www.uniprot.org/manual/involvement_in_disease">'Involvement in disease'</a> subsection.<p><a href='/help/polymorphism' target='_top'>More...</a></p>Polymorphismi

Genetic variations in IGF2 are associated with body mass index (BMI). The BMI is a statistical measurement which compares a person's weight and height.1 Publication

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_011959120K → N. Corresponds to variant dbSNP:rs14367Ensembl.1
Natural variantiVAR_011960173P → Q. Corresponds to variant dbSNP:rs1050342Ensembl.1
Natural variantiVAR_011961180K → N. Corresponds to variant dbSNP:rs12993Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0456241M → MVSPDPQIIVVAPETELASM QVQRTEDGVTIIQIFWVGRK GELLRRTPVSSAMQTPM in isoform 3. 1 Publication1
Alternative sequenceiVSP_00270853S → RLPG in isoform 2. 2 Publications1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X03562 Genomic DNA Translation: CAA27249.1
X00910 mRNA Translation: CAA25426.1
J03242 mRNA Translation: AAA52545.1
X03425 Genomic DNA Translation: CAA27155.1
X03426 Genomic DNA Translation: CAA27156.1
X03427 Genomic DNA Translation: CAA27157.1
M17426 mRNA Translation: AAA60088.1
M29645 mRNA Translation: AAA52544.1
M17863 mRNA Translation: AAA52443.1 Sequence problems.
S77035 mRNA Translation: AAB34155.1
DQ104203 mRNA Translation: ABD93451.1
HM481219 mRNA Translation: ADO21454.1
AF217977 mRNA Translation: AAG17220.1
BT007013 mRNA Translation: AAP35659.1
AF517226 Genomic DNA Translation: AAM51825.1
AC132217 Genomic DNA No translation available.
AK126688 mRNA Translation: BAG54360.1
CH471158 Genomic DNA Translation: EAX02485.1
BC000531 mRNA Translation: AAH00531.1
X07868 Genomic DNA Translation: CAA30717.1
X06159 mRNA Translation: CAA29516.1
X06160 Transcribed RNA Translation: CAA29517.1
X06161 mRNA Translation: CAA29518.1
M22373 Genomic DNA Translation: AAA52536.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS44517.1 [P01344-3]
CCDS7728.1 [P01344-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
B23614 IGHU2
I67610
S02423

NCBI Reference Sequences

More...
RefSeqi
NP_000603.1, NM_000612.5 [P01344-1]
NP_001007140.2, NM_001007139.5 [P01344-1]
NP_001121070.1, NM_001127598.2 [P01344-3]
NP_001278790.1, NM_001291861.2 [P01344-1]
NP_001278791.1, NM_001291862.2 [P01344-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.272259

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000381389; ENSP00000370796; ENSG00000167244 [P01344-1]
ENST00000381392; ENSP00000370799; ENSG00000167244 [P01344-2]
ENST00000381395; ENSP00000370802; ENSG00000167244 [P01344-1]
ENST00000381406; ENSP00000370813; ENSG00000167244 [P01344-2]
ENST00000416167; ENSP00000414497; ENSG00000167244 [P01344-1]
ENST00000418738; ENSP00000402047; ENSG00000167244 [P01344-1]
ENST00000434045; ENSP00000391826; ENSG00000167244 [P01344-3]
ENST00000641326; ENSP00000493122; ENSG00000167244 [P01344-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
3481

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:3481

UCSC genome browser

More...
UCSCi
uc001lvf.4 human [P01344-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Wikipedia

Insulin-like growth factor 2 entry

SeattleSNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X03562 Genomic DNA Translation: CAA27249.1
X00910 mRNA Translation: CAA25426.1
J03242 mRNA Translation: AAA52545.1
X03425 Genomic DNA Translation: CAA27155.1
X03426 Genomic DNA Translation: CAA27156.1
X03427 Genomic DNA Translation: CAA27157.1
M17426 mRNA Translation: AAA60088.1
M29645 mRNA Translation: AAA52544.1
M17863 mRNA Translation: AAA52443.1 Sequence problems.
S77035 mRNA Translation: AAB34155.1
DQ104203 mRNA Translation: ABD93451.1
HM481219 mRNA Translation: ADO21454.1
AF217977 mRNA Translation: AAG17220.1
BT007013 mRNA Translation: AAP35659.1
AF517226 Genomic DNA Translation: AAM51825.1
AC132217 Genomic DNA No translation available.
AK126688 mRNA Translation: BAG54360.1
CH471158 Genomic DNA Translation: EAX02485.1
BC000531 mRNA Translation: AAH00531.1
X07868 Genomic DNA Translation: CAA30717.1
X06159 mRNA Translation: CAA29516.1
X06160 Transcribed RNA Translation: CAA29517.1
X06161 mRNA Translation: CAA29518.1
M22373 Genomic DNA Translation: AAA52536.1
CCDSiCCDS44517.1 [P01344-3]
CCDS7728.1 [P01344-1]
PIRiB23614 IGHU2
I67610
S02423
RefSeqiNP_000603.1, NM_000612.5 [P01344-1]
NP_001007140.2, NM_001007139.5 [P01344-1]
NP_001121070.1, NM_001127598.2 [P01344-3]
NP_001278790.1, NM_001291861.2 [P01344-1]
NP_001278791.1, NM_001291862.2 [P01344-1]
UniGeneiHs.272259

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1GF2model-A25-91[»]
1IGLNMR-A25-91[»]
2L29NMR-B25-91[»]
2V5PX-ray4.10C/D25-91[»]
3E4ZX-ray2.28C/D25-91[»]
3KR3X-ray2.20D25-91[»]
5L3LNMR-A25-91[»]
5L3MNMR-A25-91[»]
5L3NNMR-A25-91[»]
ProteinModelPortaliP01344
SMRiP01344
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi109702, 30 interactors
CORUMiP01344
DIPiDIP-29508N
IntActiP01344, 10 interactors
MINTiP01344
STRINGi9606.ENSP00000391826

Chemistry databases

ChEMBLiCHEMBL3712957

PTM databases

GlyConnecti760
iPTMnetiP01344
PhosphoSitePlusiP01344
UniCarbKBiP01344

Polymorphism and mutation databases

BioMutaiIGF2
DMDMi124255

Proteomic databases

MaxQBiP01344
PaxDbiP01344
PeptideAtlasiP01344
PRIDEiP01344
ProteomicsDBi12641 [P01344-2]
51375
51376 [P01344-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
3481
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000381389; ENSP00000370796; ENSG00000167244 [P01344-1]
ENST00000381392; ENSP00000370799; ENSG00000167244 [P01344-2]
ENST00000381395; ENSP00000370802; ENSG00000167244 [P01344-1]
ENST00000381406; ENSP00000370813; ENSG00000167244 [P01344-2]
ENST00000416167; ENSP00000414497; ENSG00000167244 [P01344-1]
ENST00000418738; ENSP00000402047; ENSG00000167244 [P01344-1]
ENST00000434045; ENSP00000391826; ENSG00000167244 [P01344-3]
ENST00000641326; ENSP00000493122; ENSG00000167244 [P01344-1]
GeneIDi3481
KEGGihsa:3481
UCSCiuc001lvf.4 human [P01344-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
3481
DisGeNETi3481
EuPathDBiHostDB:ENSG00000167244.18

GeneCards: human genes, protein and diseases

More...
GeneCardsi
IGF2
GeneReviewsiIGF2

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0128667
HGNCiHGNC:5466 IGF2
HPAiHPA007556
HPA007993
MalaCardsiIGF2
MIMi147470 gene+phenotype
180860 phenotype
616489 phenotype
neXtProtiNX_P01344
OpenTargetsiENSG00000167244
Orphaneti231117 Beckwith-Wiedemann syndrome due to imprinting defect of 11p15
2128 Isolated hemihyperplasia
231144 Silver-Russell syndrome due to 11p15 microduplication
397590 Silver-Russell syndrome due to a point mutation
231140 Silver-Russell syndrome due to an imprinting defect of 11p15
PharmGKBiPA29699

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IY3P Eukaryota
ENOG4111KP2 LUCA
GeneTreeiENSGT00940000160745
HOGENOMiHOG000233362
HOVERGENiHBG006137
InParanoidiP01344
KOiK13769
OMAiWQRKAAQ
OrthoDBiEOG091G0H56
PhylomeDBiP01344
TreeFamiTF332820

Enzyme and pathway databases

ReactomeiR-HSA-114608 Platelet degranulation
R-HSA-2404192 Signaling by Type 1 Insulin-like Growth Factor 1 Receptor (IGF1R)
R-HSA-2428928 IRS-related events triggered by IGF1R
R-HSA-2428933 SHC-related events triggered by IGF1R
R-HSA-381426 Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
SignaLinkiP01344
SIGNORiP01344

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
IGF2 human
EvolutionaryTraceiP01344

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
Insulin-like_growth_factor_2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
3481
PMAP-CutDBiP01344

Protein Ontology

More...
PROi
PR:P01344

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000167244 Expressed in 212 organ(s), highest expression level in metanephros
CleanExiHS_IGF2
GenevisibleiP01344 HS

Family and domain databases

InterProiView protein in InterPro
IPR022334 IGF2
IPR013576 IGF2_C
IPR016179 Insulin-like
IPR022350 Insulin-like_growth_factor
IPR036438 Insulin-like_sf
IPR022353 Insulin_CS
IPR022352 Insulin_family
PfamiView protein in Pfam
PF08365 IGF2_C, 1 hit
PF00049 Insulin, 2 hits
PRINTSiPR02002 INSLNLIKEGF
PR02006 INSLNLIKEGF2
PR00276 INSULINFAMLY
ProDomiView protein in ProDom or Entries sharing at least one domain
PD005188 IGF2_C, 1 hit
SMARTiView protein in SMART
SM00078 IlGF, 1 hit
SUPFAMiSSF56994 SSF56994, 1 hit
PROSITEiView protein in PROSITE
PS00262 INSULIN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiIGF2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P01344
Secondary accession number(s): B3KX48
, B7WP08, C9JAF2, E3UN45, P78449, Q14299, Q1WM26, Q9UC68, Q9UC69
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 21, 1986
Last sequence update: July 21, 1986
Last modified: December 5, 2018
This is version 230 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again