UniProtKB - P01308 (INS_HUMAN)
(max 400 entries)x
Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>
Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)
- BLAST>sp|P01308|INS_HUMAN Insulin OS=Homo sapiens OX=9606 GN=INS PE=1 SV=1 MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAED LQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN
- Align
Protein
Insulin
Gene
INS
Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:
Annotation score:5 out of 5
<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>Select a section on the left to see content.
<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni
Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni
- hormone activity Source: BHF-UCL <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- identical protein binding Source: IntAct <p>Inferred from Physical Interaction</p> <p>Covers physical interactions between the gene product of interest and another molecule (or ion, or complex).</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ipi">GO evidence code guide</a></p> Inferred from physical interactioni
- insulin-like growth factor receptor binding Source: BHF-UCL <p>Inferred from Physical Interaction</p> <p>Covers physical interactions between the gene product of interest and another molecule (or ion, or complex).</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ipi">GO evidence code guide</a></p> Inferred from physical interactioni
- insulin receptor binding Source: UniProtKB <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- protease binding Source: UniProtKB <p>Inferred from Physical Interaction</p> <p>Covers physical interactions between the gene product of interest and another molecule (or ion, or complex).</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ipi">GO evidence code guide</a></p> Inferred from physical interactioni
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi
- activation of protein kinase B activity Source: BHF-UCL <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- acute-phase response Source: BHF-UCL <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- alpha-beta T cell activation Source: UniProtKB <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- cell-cell signaling Source: UniProtKB <p>Inferred by Curator</p> <p>Used for cases where an annotation is not supported by any evidence but can be reasonably inferred by a curator from other GO annotations for which evidence <br />is available.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ic">GO evidence code guide</a></p> Inferred by curatori
- cellular protein metabolic process Source: Reactome
- cognition Source: ARUK-UCL <p>Traceable Author Statement</p> <p>Used for information from review articles where the original experiments are traceable through that article and also for information from text books or dictionaries.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#tas">GO evidence code guide</a></p> Traceable author statementi
- ER to Golgi vesicle-mediated transport Source: Reactome
- fatty acid homeostasis Source: BHF-UCL <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- glucose homeostasis Source: BHF-UCL <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- glucose metabolic process Source: UniProtKB-KW
- G-protein coupled receptor signaling pathway Source: BHF-UCL <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- insulin receptor signaling pathway Source: BHF-UCL <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- MAPK cascade Source: BHF-UCL <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- negative regulation of acute inflammatory response Source: BHF-UCL <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- negative regulation of blood vessel diameter Source: UniProtKB <p>Non-traceable Author Statement</p> <p>Used for statements in the abstract, introduction or discussion of a paper that cannot be traced back to another publication.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#nas">GO evidence code guide</a></p> Non-traceable author statementi
- negative regulation of fatty acid metabolic process Source: BHF-UCL <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- negative regulation of feeding behavior Source: DFLAT <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- negative regulation of gluconeogenesis Source: BHF-UCL <p>Non-traceable Author Statement</p> <p>Used for statements in the abstract, introduction or discussion of a paper that cannot be traced back to another publication.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#nas">GO evidence code guide</a></p> Non-traceable author statementi
- negative regulation of glycogen catabolic process Source: BHF-UCL <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- negative regulation of lipid catabolic process Source: AgBase <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- negative regulation of NAD(P)H oxidase activity Source: BHF-UCL <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway Source: BHF-UCL <p>Non-traceable Author Statement</p> <p>Used for statements in the abstract, introduction or discussion of a paper that cannot be traced back to another publication.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#nas">GO evidence code guide</a></p> Non-traceable author statementi
- negative regulation of protein catabolic process Source: UniProtKB <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- negative regulation of protein oligomerization Source: UniProtKB <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- negative regulation of protein secretion Source: BHF-UCL <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- negative regulation of proteolysis Source: BHF-UCL <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- negative regulation of reactive oxygen species biosynthetic process Source: ARUK-UCL <p>Inferred from Genetic Interaction</p> <p>Used to describe “traditional” genetic interactions such as suppressors and synthetic lethals as well as other techniques such as functional complementation, rescue experiments, or inferences about a gene drawn from the phenotype of a mutation in a different gene.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#igi">GO evidence code guide</a></p> Inferred from genetic interactioni
- negative regulation of respiratory burst involved in inflammatory response Source: BHF-UCL <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- neuron projection maintenance Source: ARUK-UCL <p>Inferred from Genetic Interaction</p> <p>Used to describe “traditional” genetic interactions such as suppressors and synthetic lethals as well as other techniques such as functional complementation, rescue experiments, or inferences about a gene drawn from the phenotype of a mutation in a different gene.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#igi">GO evidence code guide</a></p> Inferred from genetic interactioni
- positive regulation of blood vessel diameter Source: UniProtKB <p>Non-traceable Author Statement</p> <p>Used for statements in the abstract, introduction or discussion of a paper that cannot be traced back to another publication.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#nas">GO evidence code guide</a></p> Non-traceable author statementi
- positive regulation of brown fat cell differentiation Source: BHF-UCL <p>Traceable Author Statement</p> <p>Used for information from review articles where the original experiments are traceable through that article and also for information from text books or dictionaries.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#tas">GO evidence code guide</a></p> Traceable author statementi
- positive regulation of cell differentiation Source: BHF-UCL <p>Non-traceable Author Statement</p> <p>Used for statements in the abstract, introduction or discussion of a paper that cannot be traced back to another publication.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#nas">GO evidence code guide</a></p> Non-traceable author statementi
- positive regulation of cell growth Source: BHF-UCL <p>Non-traceable Author Statement</p> <p>Used for statements in the abstract, introduction or discussion of a paper that cannot be traced back to another publication.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#nas">GO evidence code guide</a></p> Non-traceable author statementi
- positive regulation of cell migration Source: BHF-UCL <p>Inferred from Sequence or Structural Similarity <br />Used for any analysis based on sequence alignment, structure comparison, or evaluation of sequence features such as composition.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#iss">GO evidence code guide</a></p> Inferred from sequence or structural similarityi
- positive regulation of cell proliferation Source: BHF-UCL <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- positive regulation of cellular protein metabolic process Source: BHF-UCL <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- positive regulation of cytokine secretion Source: UniProtKB <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- positive regulation of dendritic spine maintenance Source: ARUK-UCL <p>Inferred from Genetic Interaction</p> <p>Used to describe “traditional” genetic interactions such as suppressors and synthetic lethals as well as other techniques such as functional complementation, rescue experiments, or inferences about a gene drawn from the phenotype of a mutation in a different gene.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#igi">GO evidence code guide</a></p> Inferred from genetic interactioni
- positive regulation of gene expression Source: BHF-UCL <p>Inferred from Genetic Interaction</p> <p>Used to describe “traditional” genetic interactions such as suppressors and synthetic lethals as well as other techniques such as functional complementation, rescue experiments, or inferences about a gene drawn from the phenotype of a mutation in a different gene.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#igi">GO evidence code guide</a></p> Inferred from genetic interactioni
- positive regulation of glucose import Source: UniProtKB <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- positive regulation of glucose import in response to insulin stimulus Source: UniProtKB <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- positive regulation of glycogen biosynthetic process Source: BHF-UCL <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- positive regulation of glycolytic process Source: BHF-UCL <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- positive regulation of insulin receptor signaling pathway Source: BHF-UCL <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- positive regulation of lipid biosynthetic process Source: BHF-UCL <p>Non-traceable Author Statement</p> <p>Used for statements in the abstract, introduction or discussion of a paper that cannot be traced back to another publication.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#nas">GO evidence code guide</a></p> Non-traceable author statementi
- positive regulation of long-term synaptic potentiation Source: ARUK-UCL <p>Traceable Author Statement</p> <p>Used for information from review articles where the original experiments are traceable through that article and also for information from text books or dictionaries.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#tas">GO evidence code guide</a></p> Traceable author statementi
- positive regulation of MAPK cascade Source: BHF-UCL <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- positive regulation of mitotic nuclear division Source: UniProtKB <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- positive regulation of NF-kappaB transcription factor activity Source: BHF-UCL <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- positive regulation of nitric oxide mediated signal transduction Source: UniProtKB <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- positive regulation of nitric-oxide synthase activity Source: UniProtKB <p>Non-traceable Author Statement</p> <p>Used for statements in the abstract, introduction or discussion of a paper that cannot be traced back to another publication.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#nas">GO evidence code guide</a></p> Non-traceable author statementi
- positive regulation of peptide hormone secretion Source: BHF-UCL <p>Traceable Author Statement</p> <p>Used for information from review articles where the original experiments are traceable through that article and also for information from text books or dictionaries.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#tas">GO evidence code guide</a></p> Traceable author statementi
- positive regulation of peptidyl-tyrosine phosphorylation Source: BHF-UCL <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- positive regulation of phosphatidylinositol 3-kinase signaling Source: BHF-UCL <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- positive regulation of protein autophosphorylation Source: BHF-UCL <p>Inferred from Sequence or Structural Similarity <br />Used for any analysis based on sequence alignment, structure comparison, or evaluation of sequence features such as composition.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#iss">GO evidence code guide</a></p> Inferred from sequence or structural similarityi
- positive regulation of protein kinase B signaling Source: BHF-UCL <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- positive regulation of protein localization to nucleus Source: BHF-UCL <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- positive regulation of respiratory burst Source: BHF-UCL <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- regulation of cellular amino acid metabolic process Source: BHF-UCL <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- regulation of protein localization Source: BHF-UCL <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- regulation of protein localization to plasma membrane Source: ARUK-UCL <p>Inferred from Genetic Interaction</p> <p>Used to describe “traditional” genetic interactions such as suppressors and synthetic lethals as well as other techniques such as functional complementation, rescue experiments, or inferences about a gene drawn from the phenotype of a mutation in a different gene.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#igi">GO evidence code guide</a></p> Inferred from genetic interactioni
- regulation of protein secretion Source: UniProtKB <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- regulation of synaptic plasticity Source: ARUK-UCL <p>Traceable Author Statement</p> <p>Used for information from review articles where the original experiments are traceable through that article and also for information from text books or dictionaries.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#tas">GO evidence code guide</a></p> Traceable author statementi
- regulation of transcription, DNA-templated Source: BHF-UCL <p>Non-traceable Author Statement</p> <p>Used for statements in the abstract, introduction or discussion of a paper that cannot be traced back to another publication.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#nas">GO evidence code guide</a></p> Non-traceable author statementi
- regulation of transmembrane transporter activity Source: BHF-UCL <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- wound healing Source: BHF-UCL <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi
| Molecular function | Hormone |
| Biological process | Carbohydrate metabolism, Glucose metabolism |
Enzyme and pathway databases
BioCyc Collection of Pathway/Genome Databases More...BioCyci | MetaCyc:MONOMER-16190 |
Reactome - a knowledgebase of biological pathways and processes More...Reactomei | R-HSA-210745 Regulation of gene expression in beta cells R-HSA-264876 Insulin processing R-HSA-422085 Synthesis, secretion, and deacylation of Ghrelin R-HSA-422356 Regulation of insulin secretion R-HSA-6807878 COPI-mediated anterograde transport R-HSA-6811558 PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling R-HSA-74713 IRS activation R-HSA-74749 Signal attenuation R-HSA-74751 Insulin receptor signalling cascade R-HSA-74752 Signaling by Insulin receptor R-HSA-77387 Insulin receptor recycling R-HSA-977225 Amyloid fiber formation |
SignaLink: a signaling pathway resource with multi-layered regulatory networks More...SignaLinki | P01308 |
SIGNOR Signaling Network Open Resource More...SIGNORi | P01308 |
<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi | |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi | Name:INS |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>Organismi | Homo sapiens (Human) |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri | 9606 [NCBI] |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineagei | cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi |
|
Organism-specific databases
Eukaryotic Pathogen Database Resources More...EuPathDBi | HostDB:ENSG00000254647.6 |
Human Gene Nomenclature Database More...HGNCi | HGNC:6081 INS |
Online Mendelian Inheritance in Man (OMIM) More...MIMi | 176730 gene |
neXtProt; the human protein knowledge platform More...neXtProti | NX_P01308 |
<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi
Extracellular region or secreted
Endoplasmic reticulum
- endoplasmic reticulum lumen Source: Reactome
Endosome
- endosome lumen Source: Reactome
Extracellular region or secreted
- extracellular region Source: Reactome
- extracellular space Source: BHF-UCL <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
Golgi apparatus
- Golgi lumen Source: Reactome
- Golgi membrane Source: Reactome
Other locations
- endoplasmic reticulum-Golgi intermediate compartment membrane Source: Reactome
- secretory granule lumen Source: Reactome
- transport vesicle Source: Reactome
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti
Secreted<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi
<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei
Hyperproinsulinemia (HPRI)4 Publications
<p>Manually curated information for which there is published experimental evidence.</p>
<p><a href="/manual/evidences#ECO:0000269">More...</a></p>
Manual assertion based on experiment ini
- Ref.21"A mutation in the B chain coding region is associated with impaired proinsulin conversion in a family with hyperproinsulinemia."
Chan S.J., Seino S., Gruppuso P.A., Schwartz R., Steiner D.F.
Proc. Natl. Acad. Sci. U.S.A. 84:2194-2197(1987) [PubMed] [Europe PMC] [Abstract]Cited for: VARIANT HPRI ASP-34. - Ref.23"Two unrelated patients with familial hyperproinsulinemia due to a mutation substituting histidine for arginine at position 65 in the proinsulin molecule: identification of the mutation by direct sequencing of genomic deoxyribonucleic acid amplified by polymerase chain reaction."
Barbetti F., Raben N., Kadowaki T., Cama A., Accili D., Gabbay K.H., Merenich J.A., Taylor S.I., Roth J.
J. Clin. Endocrinol. Metab. 71:164-169(1990) [PubMed] [Europe PMC] [Abstract]Cited for: VARIANT HPRI HIS-89. - Ref.24"Posttranslational cleavage of proinsulin is blocked by a point mutation in familial hyperproinsulinemia."
Shibasaki Y., Kawakami T., Kanazawa Y., Akanuma Y., Takaku F.
J. Clin. Invest. 76:378-380(1985) [PubMed] [Europe PMC] [Abstract]Cited for: VARIANT HPRI HIS-89. - Ref.25"A novel point mutation in the human insulin gene giving rise to hyperproinsulinemia (proinsulin Kyoto)."
Yano H., Kitano N., Morimoto M., Polonsky K.S., Imura H., Seino Y.
J. Clin. Invest. 89:1902-1907(1992) [PubMed] [Europe PMC] [Abstract]Cited for: VARIANT HPRI LEU-89.
Ref.21
"A mutation in the B chain coding region is associated with impaired proinsulin conversion in a family with hyperproinsulinemia."
Chan S.J., Seino S., Gruppuso P.A., Schwartz R., Steiner D.F.
Proc. Natl. Acad. Sci. U.S.A. 84:2194-2197(1987) [PubMed] [Europe PMC] [Abstract]
Chan S.J., Seino S., Gruppuso P.A., Schwartz R., Steiner D.F.
Proc. Natl. Acad. Sci. U.S.A. 84:2194-2197(1987) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANT HPRI ASP-34.
Ref.23
"Two unrelated patients with familial hyperproinsulinemia due to a mutation substituting histidine for arginine at position 65 in the proinsulin molecule: identification of the mutation by direct sequencing of genomic deoxyribonucleic acid amplified by polymerase chain reaction."
Barbetti F., Raben N., Kadowaki T., Cama A., Accili D., Gabbay K.H., Merenich J.A., Taylor S.I., Roth J.
J. Clin. Endocrinol. Metab. 71:164-169(1990) [PubMed] [Europe PMC] [Abstract]
Barbetti F., Raben N., Kadowaki T., Cama A., Accili D., Gabbay K.H., Merenich J.A., Taylor S.I., Roth J.
J. Clin. Endocrinol. Metab. 71:164-169(1990) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANT HPRI HIS-89.
Ref.24
"Posttranslational cleavage of proinsulin is blocked by a point mutation in familial hyperproinsulinemia."
Shibasaki Y., Kawakami T., Kanazawa Y., Akanuma Y., Takaku F.
J. Clin. Invest. 76:378-380(1985) [PubMed] [Europe PMC] [Abstract]
Shibasaki Y., Kawakami T., Kanazawa Y., Akanuma Y., Takaku F.
J. Clin. Invest. 76:378-380(1985) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANT HPRI HIS-89.
Ref.25
"A novel point mutation in the human insulin gene giving rise to hyperproinsulinemia (proinsulin Kyoto)."
Yano H., Kitano N., Morimoto M., Polonsky K.S., Imura H., Seino Y.
J. Clin. Invest. 89:1902-1907(1992) [PubMed] [Europe PMC] [Abstract]
Yano H., Kitano N., Morimoto M., Polonsky K.S., Imura H., Seino Y.
J. Clin. Invest. 89:1902-1907(1992) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANT HPRI LEU-89.
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn autosomal dominant condition characterized by elevated levels of serum proinsulin-like material.
See also OMIM:616214| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_003971 | 34 | H → D in HPRI; Providence. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_003974 | 89 | R → H in HPRI; impairs post-translational cleavage. 2 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_003975 | 89 | R → L in HPRI; Kyoto. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 |
Diabetes mellitus, insulin-dependent, 2 (IDDM2)1 Publication
<p>Manually curated information for which there is published experimental evidence.</p>
<p><a href="/manual/evidences#ECO:0000269">More...</a></p>
Manual assertion based on experiment ini
- Ref.34"Mutations in the insulin gene can cause MODY and autoantibody-negative type 1 diabetes."
Molven A., Ringdal M., Nordbo A.M., Raeder H., Stoy J., Lipkind G.M., Steiner D.F., Philipson L.H., Bergmann I., Aarskog D., Undlien D.E., Joner G., Sovik O., Bell G.I., Njolstad P.R.
Diabetes 57:1131-1135(2008) [PubMed] [Europe PMC] [Abstract]Cited for: VARIANT MODY10 GLN-46, VARIANT IDDM2 CYS-55.
Ref.34
"Mutations in the insulin gene can cause MODY and autoantibody-negative type 1 diabetes."
Molven A., Ringdal M., Nordbo A.M., Raeder H., Stoy J., Lipkind G.M., Steiner D.F., Philipson L.H., Bergmann I., Aarskog D., Undlien D.E., Joner G., Sovik O., Bell G.I., Njolstad P.R.
Diabetes 57:1131-1135(2008) [PubMed] [Europe PMC] [Abstract]
Molven A., Ringdal M., Nordbo A.M., Raeder H., Stoy J., Lipkind G.M., Steiner D.F., Philipson L.H., Bergmann I., Aarskog D., Undlien D.E., Joner G., Sovik O., Bell G.I., Njolstad P.R.
Diabetes 57:1131-1135(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANT MODY10 GLN-46, VARIANT IDDM2 CYS-55.
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA multifactorial disorder of glucose homeostasis that is characterized by susceptibility to ketoacidosis in the absence of insulin therapy. Clinical features are polydipsia, polyphagia and polyuria which result from hyperglycemia-induced osmotic diuresis and secondary thirst. These derangements result in long-term complications that affect the eyes, kidneys, nerves, and blood vessels.
See also OMIM:125852| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_063732 | 55 | R → C in IDDM2. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 |
Diabetes mellitus, permanent neonatal (PNDM)2 Publications
<p>Manually curated information for which there is published experimental evidence.</p>
<p><a href="/manual/evidences#ECO:0000269">More...</a></p>
Manual assertion based on experiment ini
- Ref.32"Insulin gene mutations as a cause of permanent neonatal diabetes."
Stoy J., Edghill E.L., Flanagan S.E., Ye H., Paz V.P., Pluzhnikov A., Below J.E., Hayes M.G., Cox N.J., Lipkind G.M., Lipton R.B., Greeley S.A., Patch A.M., Ellard S., Steiner D.F., Hattersley A.T., Philipson L.H., Bell G.I.
Proc. Natl. Acad. Sci. U.S.A. 104:15040-15044(2007) [PubMed] [Europe PMC] [Abstract]Cited for: VARIANTS PNDM ASP-24; ARG-32; SER-32; GLY-43; VAL-47; CYS-48; CYS-89; CYS-90; TYR-96 AND CYS-108. - Ref.33"Insulin mutation screening in 1,044 patients with diabetes: mutations in the INS gene are a common cause of neonatal diabetes but a rare cause of diabetes diagnosed in childhood or adulthood."
Edghill E.L., Flanagan S.E., Patch A.M., Boustred C., Parrish A., Shields B., Shepherd M.H., Hussain K., Kapoor R.R., Malecki M., MacDonald M.J., Stoy J., Steiner D.F., Philipson L.H., Bell G.I., Hattersley A.T., Ellard S.
Diabetes 57:1034-1042(2008) [PubMed] [Europe PMC] [Abstract]Cited for: VARIANTS PNDM ASP-24; ASP-29; ARG-32; SER-32; PRO-35; GLY-43; VAL-47; CYS-48; ARG-84; CYS-89; CYS-90; SER-96; TYR-96; CYS-101; CYS-103 AND CYS-108, VARIANT MODY10 CYS-6, VARIANT MET-68.
Ref.32
"Insulin gene mutations as a cause of permanent neonatal diabetes."
Stoy J., Edghill E.L., Flanagan S.E., Ye H., Paz V.P., Pluzhnikov A., Below J.E., Hayes M.G., Cox N.J., Lipkind G.M., Lipton R.B., Greeley S.A., Patch A.M., Ellard S., Steiner D.F., Hattersley A.T., Philipson L.H., Bell G.I.
Proc. Natl. Acad. Sci. U.S.A. 104:15040-15044(2007) [PubMed] [Europe PMC] [Abstract]
Stoy J., Edghill E.L., Flanagan S.E., Ye H., Paz V.P., Pluzhnikov A., Below J.E., Hayes M.G., Cox N.J., Lipkind G.M., Lipton R.B., Greeley S.A., Patch A.M., Ellard S., Steiner D.F., Hattersley A.T., Philipson L.H., Bell G.I.
Proc. Natl. Acad. Sci. U.S.A. 104:15040-15044(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANTS PNDM ASP-24; ARG-32; SER-32; GLY-43; VAL-47; CYS-48; CYS-89; CYS-90; TYR-96 AND CYS-108.
Ref.33
"Insulin mutation screening in 1,044 patients with diabetes: mutations in the INS gene are a common cause of neonatal diabetes but a rare cause of diabetes diagnosed in childhood or adulthood."
Edghill E.L., Flanagan S.E., Patch A.M., Boustred C., Parrish A., Shields B., Shepherd M.H., Hussain K., Kapoor R.R., Malecki M., MacDonald M.J., Stoy J., Steiner D.F., Philipson L.H., Bell G.I., Hattersley A.T., Ellard S.
Diabetes 57:1034-1042(2008) [PubMed] [Europe PMC] [Abstract]
Edghill E.L., Flanagan S.E., Patch A.M., Boustred C., Parrish A., Shields B., Shepherd M.H., Hussain K., Kapoor R.R., Malecki M., MacDonald M.J., Stoy J., Steiner D.F., Philipson L.H., Bell G.I., Hattersley A.T., Ellard S.
Diabetes 57:1034-1042(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANTS PNDM ASP-24; ASP-29; ARG-32; SER-32; PRO-35; GLY-43; VAL-47; CYS-48; ARG-84; CYS-89; CYS-90; SER-96; TYR-96; CYS-101; CYS-103 AND CYS-108, VARIANT MODY10 CYS-6, VARIANT MET-68.
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA rare form of diabetes distinct from childhood-onset autoimmune diabetes mellitus type 1. It is characterized by insulin-requiring hyperglycemia that is diagnosed within the first months of life. Permanent neonatal diabetes requires lifelong therapy.
See also OMIM:606176| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_063723 | 24 | A → D in PNDM. 2 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_063724 | 29 | H → D in PNDM. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_063725 | 32 | G → R in PNDM. 2 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_063726 | 32 | G → S in PNDM. 2 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_063727 | 35 | L → P in PNDM. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_063728 | 43 | C → G in PNDM. 2 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_063730 | 47 | G → V in PNDM. 2 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_063731 | 48 | F → C in PNDM. 2 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_063734 | 84 | G → R in PNDM; uncertain pathological significance. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_063735 | 89 | R → C in PNDM. 2 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_063736 | 90 | G → C in PNDM. 2 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_063737 | 96 | C → S in PNDM. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_063738 | 96 | C → Y in PNDM. 2 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_063739 | 101 | S → C in PNDM. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_063740 | 103 | Y → C in PNDM. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_063741 | 108 | Y → C in PNDM. 2 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 |
Maturity-onset diabetes of the young 10 (MODY10)4 Publications
<p>Manually curated information for which there is published experimental evidence.</p>
<p><a href="/manual/evidences#ECO:0000269">More...</a></p>
Manual assertion based on experiment ini
- Ref.33"Insulin mutation screening in 1,044 patients with diabetes: mutations in the INS gene are a common cause of neonatal diabetes but a rare cause of diabetes diagnosed in childhood or adulthood."
Edghill E.L., Flanagan S.E., Patch A.M., Boustred C., Parrish A., Shields B., Shepherd M.H., Hussain K., Kapoor R.R., Malecki M., MacDonald M.J., Stoy J., Steiner D.F., Philipson L.H., Bell G.I., Hattersley A.T., Ellard S.
Diabetes 57:1034-1042(2008) [PubMed] [Europe PMC] [Abstract]Cited for: VARIANTS PNDM ASP-24; ASP-29; ARG-32; SER-32; PRO-35; GLY-43; VAL-47; CYS-48; ARG-84; CYS-89; CYS-90; SER-96; TYR-96; CYS-101; CYS-103 AND CYS-108, VARIANT MODY10 CYS-6, VARIANT MET-68. - Ref.34"Mutations in the insulin gene can cause MODY and autoantibody-negative type 1 diabetes."
Molven A., Ringdal M., Nordbo A.M., Raeder H., Stoy J., Lipkind G.M., Steiner D.F., Philipson L.H., Bergmann I., Aarskog D., Undlien D.E., Joner G., Sovik O., Bell G.I., Njolstad P.R.
Diabetes 57:1131-1135(2008) [PubMed] [Europe PMC] [Abstract]Cited for: VARIANT MODY10 GLN-46, VARIANT IDDM2 CYS-55. - Ref.35"Further evidence that mutations in INS can be a rare cause of Maturity-Onset Diabetes of the Young (MODY)."
Boesgaard T.W., Pruhova S., Andersson E.A., Cinek O., Obermannova B., Lauenborg J., Damm P., Bergholdt R., Pociot F., Pisinger C., Barbetti F., Lebl J., Pedersen O., Hansen T.
BMC Med. Genet. 11:42-42(2010) [PubMed] [Europe PMC] [Abstract]Cited for: VARIANTS MODY10 HIS-6 AND GLN-46. - Ref.36"Structural and functional study of the GlnB22-insulin mutant responsible for maturity-onset diabetes of the young."
Krizkova K., Veverka V., Maletinska L., Hexnerova R., Brzozowski A.M., Jiracek J., Zakova L.
PLoS ONE 9:E112883-E112883(2014) [PubMed] [Europe PMC] [Abstract]
Ref.33
"Insulin mutation screening in 1,044 patients with diabetes: mutations in the INS gene are a common cause of neonatal diabetes but a rare cause of diabetes diagnosed in childhood or adulthood."
Edghill E.L., Flanagan S.E., Patch A.M., Boustred C., Parrish A., Shields B., Shepherd M.H., Hussain K., Kapoor R.R., Malecki M., MacDonald M.J., Stoy J., Steiner D.F., Philipson L.H., Bell G.I., Hattersley A.T., Ellard S.
Diabetes 57:1034-1042(2008) [PubMed] [Europe PMC] [Abstract]
Edghill E.L., Flanagan S.E., Patch A.M., Boustred C., Parrish A., Shields B., Shepherd M.H., Hussain K., Kapoor R.R., Malecki M., MacDonald M.J., Stoy J., Steiner D.F., Philipson L.H., Bell G.I., Hattersley A.T., Ellard S.
Diabetes 57:1034-1042(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANTS PNDM ASP-24; ASP-29; ARG-32; SER-32; PRO-35; GLY-43; VAL-47; CYS-48; ARG-84; CYS-89; CYS-90; SER-96; TYR-96; CYS-101; CYS-103 AND CYS-108, VARIANT MODY10 CYS-6, VARIANT MET-68.
Ref.34
"Mutations in the insulin gene can cause MODY and autoantibody-negative type 1 diabetes."
Molven A., Ringdal M., Nordbo A.M., Raeder H., Stoy J., Lipkind G.M., Steiner D.F., Philipson L.H., Bergmann I., Aarskog D., Undlien D.E., Joner G., Sovik O., Bell G.I., Njolstad P.R.
Diabetes 57:1131-1135(2008) [PubMed] [Europe PMC] [Abstract]
Molven A., Ringdal M., Nordbo A.M., Raeder H., Stoy J., Lipkind G.M., Steiner D.F., Philipson L.H., Bergmann I., Aarskog D., Undlien D.E., Joner G., Sovik O., Bell G.I., Njolstad P.R.
Diabetes 57:1131-1135(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANT MODY10 GLN-46, VARIANT IDDM2 CYS-55.
Ref.35
"Further evidence that mutations in INS can be a rare cause of Maturity-Onset Diabetes of the Young (MODY)."
Boesgaard T.W., Pruhova S., Andersson E.A., Cinek O., Obermannova B., Lauenborg J., Damm P., Bergholdt R., Pociot F., Pisinger C., Barbetti F., Lebl J., Pedersen O., Hansen T.
BMC Med. Genet. 11:42-42(2010) [PubMed] [Europe PMC] [Abstract]
Boesgaard T.W., Pruhova S., Andersson E.A., Cinek O., Obermannova B., Lauenborg J., Damm P., Bergholdt R., Pociot F., Pisinger C., Barbetti F., Lebl J., Pedersen O., Hansen T.
BMC Med. Genet. 11:42-42(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANTS MODY10 HIS-6 AND GLN-46.
Ref.36
"Structural and functional study of the GlnB22-insulin mutant responsible for maturity-onset diabetes of the young."
Krizkova K., Veverka V., Maletinska L., Hexnerova R., Brzozowski A.M., Jiracek J., Zakova L.
PLoS ONE 9:E112883-E112883(2014) [PubMed] [Europe PMC] [Abstract]
Krizkova K., Veverka V., Maletinska L., Hexnerova R., Brzozowski A.M., Jiracek J., Zakova L.
PLoS ONE 9:E112883-E112883(2014) [PubMed] [Europe PMC] [Abstract]
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of diabetes that is characterized by an autosomal dominant mode of inheritance, onset in childhood or early adulthood (usually before 25 years of age), a primary defect in insulin secretion and frequent insulin-independence at the beginning of the disease.
See also OMIM:613370| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_063721 | 6 | R → C in MODY10. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_063722 | 6 | R → H in MODY10. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_063729 | 46 | R → Q in MODY10; reduces binding affinity to INSR; reduces biological activity; reduces folding properties. 3 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 |
<p>This subsection of the ‘Pathology and Biotech’ section describes the use of a protein as a pharmaceutical drug. It indicates the name of the drug, the name of the firm that commercializes it and explains in a few words in which context the drug is used. In some cases, drugs that are under development are also described.<p><a href='/help/pharmaceutical_use' target='_top'>More...</a></p>Pharmaceutical usei
Available under the names Humulin or Humalog (Eli Lilly) and Novolin (Novo Nordisk). Used in the treatment of diabetes. Humalog is an insulin analog with 52-Lys-Pro-53 instead of 52-Pro-Lys-53.
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Diseasei
Diabetes mellitus, Disease mutationOrganism-specific databases
DisGeNET More...DisGeNETi | 3630 |
GeneReviews a resource of expert-authored, peer-reviewed disease descriptions. More...GeneReviewsi | INS |
MalaCards human disease database More...MalaCardsi | INS |
Online Mendelian Inheritance in Man (OMIM) More...MIMi | 125852 phenotype 606176 phenotype 613370 phenotype 616214 phenotype |
Open Targets More...OpenTargetsi | ENSG00000254647 |
Orphanet; a database dedicated to information on rare diseases and orphan drugs More...Orphaneti | 552 MODY 99885 Permanent neonatal diabetes mellitus |
The Pharmacogenetics and Pharmacogenomics Knowledge Base More...PharmGKBi | PA201 |
Protein family/group databases
Allergome; a platform for allergen knowledge More...Allergomei | 2121 Hom s Insulin |
Chemistry databases
ChEMBL database of bioactive drug-like small molecules More...ChEMBLi | CHEMBL5881 |
Drug and drug target database More...DrugBanki | DB01776 M-Cresol DB08231 MYRISTIC ACID |
Polymorphism and mutation databases
BioMuta curated single-nucleotide variation and disease association database More...BioMutai | INS |
Domain mapping of disease mutations (DMDM) More...DMDMi | 124617 |
<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi
Molecule processing
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei | 1 – 24 | 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 24 | |
| <p>This subsection of the ‘PTM / Processing’ section describes the position and length of an active peptide in the mature protein.<p><a href='/help/peptide' target='_top'>More...</a></p>PeptideiPRO_0000015819 | 25 – 54 | Insulin B chainAdd BLAST | 30 | |
| <p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes a propeptide, which is a part of a protein that is cleaved during maturation or activation. Once cleaved, a propeptide generally has no independent biological function.<p><a href='/help/propep' target='_top'>More...</a></p>PropeptideiPRO_0000015820 | 57 – 87 | C peptideAdd BLAST | 31 | |
| <p>This subsection of the ‘PTM / Processing’ section describes the position and length of an active peptide in the mature protein.<p><a href='/help/peptide' target='_top'>More...</a></p>PeptideiPRO_0000015821 | 90 – 110 | Insulin A chainAdd BLAST | 21 |
Amino acid modifications
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi | 31 ↔ 96 | Interchain (between B and A chains)Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei 3 Publications<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| ||
| <p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi | 43 ↔ 109 | Interchain (between B and A chains)Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei 3 Publications<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| ||
| <p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi | 95 ↔ 100 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei 5 Publications<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
|
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi
Cleavage on pair of basic residues, Disulfide bondProteomic databases
Encyclopedia of Proteome Dynamics More...EPDi | P01308 |
PaxDb, a database of protein abundance averages across all three domains of life More...PaxDbi | P01308 |
PeptideAtlas More...PeptideAtlasi | P01308 |
PRoteomics IDEntifications database More...PRIDEi | P01308 |
ProteomicsDB human proteome resource More...ProteomicsDBi | 51374 |
PTM databases
CarbonylDB database of protein carbonylation sites More...CarbonylDBi | P01308 |
iPTMnet integrated resource for PTMs in systems biology context More...iPTMneti | P01308 |
Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat. More...PhosphoSitePlusi | P01308 |
Miscellaneous databases
CutDB - Proteolytic event database More...PMAP-CutDBi | P01308 |
<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni
Gene expression databases
Bgee dataBase for Gene Expression Evolution More...Bgeei | ENSG00000254647 |
ExpressionAtlas, Differential and Baseline Expression More...ExpressionAtlasi | P01308 baseline and differential |
Genevisible search portal to normalized and curated expression data from Genevestigator More...Genevisiblei | P01308 HS |
Organism-specific databases
Human Protein Atlas More...HPAi | CAB000048 CAB012098 CAB053843 HPA004932 |
<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni
<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei
Heterodimer of a B chain and an A chain linked by two disulfide bonds (PubMed:25423173).1 Publication
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.36"Structural and functional study of the GlnB22-insulin mutant responsible for maturity-onset diabetes of the young."
Krizkova K., Veverka V., Maletinska L., Hexnerova R., Brzozowski A.M., Jiracek J., Zakova L.
PLoS ONE 9:E112883-E112883(2014) [PubMed] [Europe PMC] [Abstract]
<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi
| With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| itself | 20 | EBI-7090529,EBI-7090529 | ||
| IDE | P14735-1 | 3 | EBI-7090529,EBI-15607031 | |
| INSR | P06213-2 | 3 | EBI-7090529,EBI-9984921 |
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni
- hormone activity Source: BHF-UCL <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- identical protein binding Source: IntAct <p>Inferred from Physical Interaction</p> <p>Covers physical interactions between the gene product of interest and another molecule (or ion, or complex).</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ipi">GO evidence code guide</a></p> Inferred from physical interactioni
- insulin-like growth factor receptor binding Source: BHF-UCL <p>Inferred from Physical Interaction</p> <p>Covers physical interactions between the gene product of interest and another molecule (or ion, or complex).</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ipi">GO evidence code guide</a></p> Inferred from physical interactioni
- insulin receptor binding Source: UniProtKB <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- protease binding Source: UniProtKB <p>Inferred from Physical Interaction</p> <p>Covers physical interactions between the gene product of interest and another molecule (or ion, or complex).</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ipi">GO evidence code guide</a></p> Inferred from physical interactioni
Protein-protein interaction databases
The Biological General Repository for Interaction Datasets (BioGrid) More...BioGridi | 109842, 13 interactors |
Database of interacting proteins More...DIPi | DIP-6024N |
Protein interaction database and analysis system More...IntActi | P01308, 14 interactors |
Molecular INTeraction database More...MINTi | P01308 |
STRING: functional protein association networks More...STRINGi | 9606.ENSP00000250971 |
<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei
Secondary structure
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more detailsHide details| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 26 – 29 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 4 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined helical regions within the protein sequence.<p><a href='/help/helix' target='_top'>More...</a></p>Helixi | 33 – 43 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 11 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined helical regions within the protein sequence.<p><a href='/help/helix' target='_top'>More...</a></p>Helixi | 44 – 46 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 48 – 50 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 56 – 58 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined hydrogen-bonded turns within the protein sequence. These elements correspond to the DSSP secondary structure code ‘T’.<p><a href='/help/turn' target='_top'>More...</a></p>Turni | 59 – 66 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 8 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 74 – 76 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined helical regions within the protein sequence.<p><a href='/help/helix' target='_top'>More...</a></p>Helixi | 79 – 81 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined hydrogen-bonded turns within the protein sequence. These elements correspond to the DSSP secondary structure code ‘T’.<p><a href='/help/turn' target='_top'>More...</a></p>Turni | 84 – 86 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined helical regions within the protein sequence.<p><a href='/help/helix' target='_top'>More...</a></p>Helixi | 91 – 97 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 7 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 98 – 101 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 4 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined helical regions within the protein sequence.<p><a href='/help/helix' target='_top'>More...</a></p>Helixi | 102 – 106 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 5 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined hydrogen-bonded turns within the protein sequence. These elements correspond to the DSSP secondary structure code ‘T’.<p><a href='/help/turn' target='_top'>More...</a></p>Turni | 107 – 109 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 3 |
3D structure databases
Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase More...ProteinModelPortali | P01308 |
SWISS-MODEL Repository - a database of annotated 3D protein structure models More...SMRi | P01308 |
Database of comparative protein structure models More...ModBasei | Search... |
MobiDB: a database of protein disorder and mobility annotations More...MobiDBi | Search... |
Miscellaneous databases
Relative evolutionary importance of amino acids within a protein sequence More...EvolutionaryTracei | P01308 |
<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi
<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi
Belongs to the insulin family.Curated
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Domaini
SignalPhylogenomic databases
evolutionary genealogy of genes: Non-supervised Orthologous Groups More...eggNOGi | ENOG410J0XC Eukaryota ENOG4111VJB LUCA |
Ensembl GeneTree More...GeneTreei | ENSGT00390000015440 |
The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms More...HOGENOMi | HOG000261669 |
The HOVERGEN Database of Homologous Vertebrate Genes More...HOVERGENi | HBG006137 |
InParanoid: Eukaryotic Ortholog Groups More...InParanoidi | P01308 |
KEGG Orthology (KO) More...KOi | K04526 |
Identification of Orthologs from Complete Genome Data More...OMAi | PQHLCGS |
Database of Orthologous Groups More...OrthoDBi | EOG091G0H56 |
Database for complete collections of gene phylogenies More...PhylomeDBi | P01308 |
TreeFam database of animal gene trees More...TreeFami | TF332820 |
Family and domain databases
Integrated resource of protein families, domains and functional sites More...InterProi | View protein in InterPro IPR004825 Insulin IPR016179 Insulin-like IPR036438 Insulin-like_sf IPR022353 Insulin_CS IPR022352 Insulin_family |
Pfam protein domain database More...Pfami | View protein in Pfam PF00049 Insulin, 1 hit |
Protein Motif fingerprint database; a protein domain database More...PRINTSi | PR00277 INSULIN PR00276 INSULINFAMLY |
Simple Modular Architecture Research Tool; a protein domain database More...SMARTi | View protein in SMART SM00078 IlGF, 1 hit |
Superfamily database of structural and functional annotation More...SUPFAMi | SSF56994 SSF56994, 1 hit |
PROSITE; a protein domain and family database More...PROSITEi | View protein in PROSITE PS00262 INSULIN, 1 hit |
<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i
<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.
<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.
This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basketAdded to basket
Isoform 1 (identifier: P01308-1) [UniParc]FASTAAdd to basketAdded to basketShow »
This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
10 20 30 40 50
MALWMRLLPL LALLALWGPD PAAAFVNQHL CGSHLVEALY LVCGERGFFY
60 70 80 90 100
TPKTRREAED LQVGQVELGG GPGAGSLQPL ALEGSLQKRG IVEQCCTSIC
110
SLYQLENYCN
Length:110
Mass (Da):11,981
Last modified:July 21, 1986 - v1
<p>The checksum is a form of redundancy check that is calculated
from the sequence. It is useful for tracking sequence updates.</p>
<p>It should be noted that while, in theory, two different sequences could
have the same checksum value, the likelihood that this would happen
is extremely low.</p>
<p>However UniProtKB may contain entries with identical sequences in case
of multiple genes (paralogs).</p>
<p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64)
using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1.
The algorithm is described in the ISO 3309 standard.
</p>
<p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br />
<strong>Cyclic redundancy and other checksums</strong><br />
<a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p>
Checksum:iC2C3B23B85E520E5
Isoform 2 (identifier: F8WCM5-1) [UniParc]FASTAAdd to basketAdded to basket
Also known as: INS-IGF2
The sequence of this isoform can be found in the external entry F8WCM5.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Note: Based on a readthrough transcript which may produce an INS-IGF2 fusion protein.
<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni
The sequence AAA59179 differs from that shown. Reason: Erroneous gene model prediction.Curated
Natural variant
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_063721 | 6 | R → C in MODY10. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_063722 | 6 | R → H in MODY10. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_063723 | 24 | A → D in PNDM. 2 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_063724 | 29 | H → D in PNDM. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_063725 | 32 | G → R in PNDM. 2 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_063726 | 32 | G → S in PNDM. 2 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_003971 | 34 | H → D in HPRI; Providence. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_063727 | 35 | L → P in PNDM. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_063728 | 43 | C → G in PNDM. 2 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_063729 | 46 | R → Q in MODY10; reduces binding affinity to INSR; reduces biological activity; reduces folding properties. 3 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_063730 | 47 | G → V in PNDM. 2 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_063731 | 48 | F → C in PNDM. 2 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_003972 | 48 | F → S Associated with diabetes mellitus type-II; Los-Angeles. 3 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_003973 | 49 | F → L in Chicago. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_063732 | 55 | R → C in IDDM2. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_063733 | 68 | L → M1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_063734 | 84 | G → R in PNDM; uncertain pathological significance. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_063735 | 89 | R → C in PNDM. 2 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_003974 | 89 | R → H in HPRI; impairs post-translational cleavage. 2 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_003975 | 89 | R → L in HPRI; Kyoto. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_063736 | 90 | G → C in PNDM. 2 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_003976 | 92 | V → L in Wakayama. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_063737 | 96 | C → S in PNDM. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_063738 | 96 | C → Y in PNDM. 2 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_063739 | 101 | S → C in PNDM. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_063740 | 103 | Y → C in PNDM. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_063741 | 108 | Y → C in PNDM. 2 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 |
Sequence databases
| Select the link destinations: EMBL nucleotide sequence database More...EMBLiGenBank nucleotide sequence database More...GenBankiDNA Data Bank of Japan; a nucleotide sequence database More...DDBJiLinks Updated | V00565 Genomic DNA Translation: CAA23828.1 M10039 Genomic DNA Translation: AAA59173.1 J00265 Genomic DNA Translation: AAA59172.1 X70508 mRNA Translation: CAA49913.1 L15440 Genomic DNA Translation: AAA59179.1 Sequence problems. AY899304 mRNA Translation: AAW83741.1 AY138590 Genomic DNA Translation: AAN39451.1 BT006808 mRNA Translation: AAP35454.1 CH471158 Genomic DNA Translation: EAX02488.1 BC005255 mRNA Translation: AAH05255.1 AJ009655 Genomic DNA Translation: CAA08766.1 |
The Consensus CDS (CCDS) project More...CCDSi | CCDS7729.1 [P01308-1] |
Protein sequence database of the Protein Information Resource More...PIRi | A93222 IPHU |
NCBI Reference Sequences More...RefSeqi | NP_000198.1, NM_000207.2 [P01308-1] NP_001172026.1, NM_001185097.1 [P01308-1] NP_001172027.1, NM_001185098.1 [P01308-1] NP_001278826.1, NM_001291897.1 [P01308-1] |
UniGene gene-oriented nucleotide sequence clusters More...UniGenei | Hs.272259 |
Genome annotation databases
Ensembl eukaryotic genome annotation project More...Ensembli | ENST00000250971; ENSP00000250971; ENSG00000254647 [P01308-1] ENST00000381330; ENSP00000370731; ENSG00000254647 [P01308-1] ENST00000397262; ENSP00000380432; ENSG00000254647 [P01308-1] |
Database of genes from NCBI RefSeq genomes More...GeneIDi | 3630 |
KEGG: Kyoto Encyclopedia of Genes and Genomes More...KEGGi | hsa:3630 |
UCSC genome browser More...UCSCi | uc001lvn.3 human [P01308-1] |
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Coding sequence diversityi
Alternative splicing, Polymorphism<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi
| Protein | Similar proteins | Species | Score | Length | |
|---|---|---|---|---|---|
| P01308 | Insulin | 110 | |||
| Insulin | 110 | ||||
| Insulin (Fragment) | 94 |
<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi
<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi
| Insulin at Eli Lilly Clinical information on Eli Lilly insulin products |
| Protein Spotlight Protein of the 20th century - Issue 9 of April 2001 |
| Wikipedia Insulin entry |
Sequence databases
| Select the link destinations: EMBL nucleotide sequence database More...EMBLiGenBank nucleotide sequence database More...GenBankiDNA Data Bank of Japan; a nucleotide sequence database More...DDBJiLinks Updated | V00565 Genomic DNA Translation: CAA23828.1 M10039 Genomic DNA Translation: AAA59173.1 J00265 Genomic DNA Translation: AAA59172.1 X70508 mRNA Translation: CAA49913.1 L15440 Genomic DNA Translation: AAA59179.1 Sequence problems. AY899304 mRNA Translation: AAW83741.1 AY138590 Genomic DNA Translation: AAN39451.1 BT006808 mRNA Translation: AAP35454.1 CH471158 Genomic DNA Translation: EAX02488.1 BC005255 mRNA Translation: AAH05255.1 AJ009655 Genomic DNA Translation: CAA08766.1 |
The Consensus CDS (CCDS) project More...CCDSi | CCDS7729.1 [P01308-1] |
Protein sequence database of the Protein Information Resource More...PIRi | A93222 IPHU |
NCBI Reference Sequences More...RefSeqi | NP_000198.1, NM_000207.2 [P01308-1] NP_001172026.1, NM_001185097.1 [P01308-1] NP_001172027.1, NM_001185098.1 [P01308-1] NP_001278826.1, NM_001291897.1 [P01308-1] |
UniGene gene-oriented nucleotide sequence clusters More...UniGenei | Hs.272259 |
3D structure databases
| Select the link destinations: Protein Data Bank Europe More...PDBeiProtein Data Bank RCSB More...RCSB PDBiProtein Data Bank Japan More...PDBjiLinks Updated | PDB entry | Method | Resolution (Å) | Chain | Positions | PDBsum |
| 1A7F | NMR | - | A | 90-110 | [»] | |
| B | 25-53 | [»] | ||||
| 1AI0 | NMR | - | A/C/E/G/I/K | 90-110 | [»] | |
| B/D/F/H/J/L | 25-54 | [»] | ||||
| 1AIY | NMR | - | A/C/E/G/I/K | 90-110 | [»] | |
| B/D/F/H/J/L | 25-54 | [»] | ||||
| 1B9E | X-ray | 2.50 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 1BEN | X-ray | 1.40 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 1EFE | NMR | - | A | 25-54 | [»] | |
| A | 90-110 | [»] | ||||
| 1EV3 | X-ray | 1.78 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 1EV6 | X-ray | 1.90 | A/C/E/G/I/K | 90-110 | [»] | |
| B/D/F/H/J/L | 25-54 | [»] | ||||
| 1EVR | X-ray | 1.90 | A/C/E/G/I/K | 90-110 | [»] | |
| B/D/F/H/J/L | 25-54 | [»] | ||||
| 1FU2 | X-ray | 3.24 | A/C/E/G | 90-110 | [»] | |
| B/D/F/H | 25-54 | [»] | ||||
| 1FUB | X-ray | 3.09 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 1G7A | X-ray | 1.20 | A/C/E/G | 90-110 | [»] | |
| B/D/F/H | 25-54 | [»] | ||||
| 1G7B | X-ray | 1.30 | A/C/E/G | 90-110 | [»] | |
| B/D/F/H | 25-54 | [»] | ||||
| 1GUJ | X-ray | 1.62 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 1HIQ | NMR | - | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 1HIS | NMR | - | A | 90-110 | [»] | |
| B | 25-49 | [»] | ||||
| 1HIT | NMR | - | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 1HLS | NMR | - | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 1HTV | X-ray | 1.90 | A/C/E/G/I/K | 90-110 | [»] | |
| B/D/F/H/J/L | 25-51 | [»] | ||||
| 1HUI | NMR | - | A | 90-110 | [»] | |
| B | 26-53 | [»] | ||||
| 1IOG | NMR | - | A | 90-110 | [»] | |
| B | 25-53 | [»] | ||||
| 1IOH | NMR | - | A | 90-110 | [»] | |
| B | 25-53 | [»] | ||||
| 1J73 | X-ray | 2.00 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 1JCA | X-ray | 2.50 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 1JCO | NMR | - | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 1JK8 | X-ray | 2.40 | C | 35-47 | [»] | |
| 1K3M | NMR | - | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 1KMF | NMR | - | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 1LKQ | NMR | - | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 1LPH | X-ray | 2.30 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 1MHI | NMR | - | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 1MHJ | NMR | - | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 1MSO | X-ray | 1.00 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 1OS3 | X-ray | 1.95 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 1OS4 | X-ray | 2.25 | A/C/E/G/I/K | 90-110 | [»] | |
| B/D/F/H/J/L | 25-54 | [»] | ||||
| 1Q4V | X-ray | 2.00 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 1QIY | X-ray | 2.30 | A/C/E/G/I/K | 90-110 | [»] | |
| B/D/F/H/J/L | 25-54 | [»] | ||||
| 1QIZ | X-ray | 2.00 | A/C/E/G/I/K | 90-110 | [»] | |
| B/D/F/H/J/L | 25-54 | [»] | ||||
| 1QJ0 | X-ray | 2.40 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 1RWE | X-ray | 1.80 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 1SF1 | NMR | - | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 1SJT | NMR | - | A | 90-110 | [»] | |
| B | 25-51 | [»] | ||||
| 1SJU | NMR | - | A | 25-110 | [»] | |
| 1T0C | NMR | - | A | 57-87 | [»] | |
| 1T1K | NMR | - | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 1T1P | NMR | - | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 1T1Q | NMR | - | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 1TRZ | X-ray | 1.60 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 1TYL | X-ray | 1.90 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 1TYM | X-ray | 1.90 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 1UZ9 | X-ray | 1.60 | A | 90-110 | [»] | |
| B | 25-53 | [»] | ||||
| 1VKT | NMR | - | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 1W8P | X-ray | 2.08 | A/C/E/G/I/K | 90-110 | [»] | |
| B/D/F/H/J/L | 25-54 | [»] | ||||
| 1XDA | X-ray | 1.80 | A/C/E/G | 90-110 | [»] | |
| B/D/F/H | 25-53 | [»] | ||||
| 1XGL | NMR | - | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 1XW7 | X-ray | 2.30 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 1ZEG | X-ray | 1.60 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 1ZEH | X-ray | 1.50 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 1ZNJ | X-ray | 2.00 | A/C/E/G/I/K | 90-110 | [»] | |
| B/D/F/H/J/L | 25-54 | [»] | ||||
| 2AIY | NMR | - | A/C/E/G/I/K | 90-110 | [»] | |
| B/D/F/H/J/L | 25-54 | [»] | ||||
| 2C8Q | X-ray | 1.95 | A | 90-110 | [»] | |
| B | 25-53 | [»] | ||||
| 2C8R | X-ray | 1.50 | A | 90-110 | [»] | |
| B | 25-53 | [»] | ||||
| 2CEU | X-ray | 1.80 | A/C | 90-110 | [»] | |
| B/D | 25-49 | [»] | ||||
| 2G54 | X-ray | 2.25 | C/D | 25-54 | [»] | |
| 2G56 | X-ray | 2.20 | C/D | 25-54 | [»] | |
| 2H67 | NMR | - | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 2HH4 | NMR | - | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 2HHO | NMR | - | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 2HIU | NMR | - | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 2JMN | NMR | - | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 2JUM | NMR | - | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 2JUU | NMR | - | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 2JUV | NMR | - | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 2JV1 | NMR | - | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 2JZQ | NMR | - | A | 25-54 | [»] | |
| A | 90-110 | [»] | ||||
| 2K91 | NMR | - | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 2K9R | NMR | - | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 2KJJ | NMR | - | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 2KJU | NMR | - | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 2KQP | NMR | - | A | 25-110 | [»] | |
| 2KQQ | NMR | - | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 2KXK | NMR | - | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 2L1Y | NMR | - | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 2L1Z | NMR | - | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 2LGB | NMR | - | A | 90-110 | [»] | |
| B | 25-55 | [»] | ||||
| 2LWZ | NMR | - | A | 25-54 | [»] | |
| A | 89-110 | [»] | ||||
| 2M1D | NMR | - | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 2M1E | NMR | - | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 2M2M | NMR | - | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 2M2N | NMR | - | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 2M2O | NMR | - | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 2M2P | NMR | - | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 2MLI | NMR | - | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 2MPG | NMR | - | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 2MPI | NMR | - | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 2MVC | NMR | - | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 2MVD | NMR | - | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 2N2V | NMR | - | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 2N2W | NMR | - | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 2N2X | NMR | - | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 2OLY | X-ray | 1.70 | A/C/E/G/I/K | 90-110 | [»] | |
| B/D/F/H/J/L | 25-54 | [»] | ||||
| 2OLZ | X-ray | 1.70 | A/C/E/G/I/K | 90-110 | [»] | |
| B/D/F/H/J/L | 25-54 | [»] | ||||
| 2OM0 | X-ray | 2.05 | 1/3/A/C/E/G/I/K/Q/S/U/X/a/c/e/g/i/k | 90-110 | [»] | |
| 2/4/B/D/F/H/J/L/R/T/V/Y/b/d/f/h/j/l | 25-54 | [»] | ||||
| 2OM1 | X-ray | 1.97 | 1/3/A/C/E/G/I/K/Q/S/U/X/a/c/e/g/i/k | 90-110 | [»] | |
| 2/4/B/D/F/H/J/L/R/T/V/Y/b/d/f/h/j/l | 25-54 | [»] | ||||
| 2OMG | X-ray | 1.52 | A/C/E | 90-110 | [»] | |
| B/D/F | 25-54 | [»] | ||||
| 2OMH | X-ray | 1.36 | A/C/E | 90-110 | [»] | |
| B/D/F | 25-54 | [»] | ||||
| 2OMI | X-ray | 2.24 | A/C/E/G/I/K | 90-110 | [»] | |
| B/D/F/H/J/L | 25-54 | [»] | ||||
| 2OMQ | X-ray | 2.00 | A/B/C/D | 36-41 | [»] | |
| 2QIU | X-ray | 2.00 | A/C | 89-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 2R34 | X-ray | 2.25 | A/C | 89-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 2R35 | X-ray | 2.08 | A/C | 89-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 2R36 | X-ray | 2.00 | A/C | 89-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 2RN5 | NMR | - | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 2VJZ | X-ray | 1.80 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 2VK0 | X-ray | 2.20 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 2W44 | X-ray | 2.00 | A/C/E | 94-110 | [»] | |
| B/D/F | 25-53 | [»] | ||||
| 2WBY | X-ray | 2.60 | C/E | 90-109 | [»] | |
| D/F | 25-43 | [»] | ||||
| 2WC0 | X-ray | 2.80 | C/E | 90-110 | [»] | |
| D/F | 25-54 | [»] | ||||
| 2WRU | X-ray | 1.57 | A | 90-110 | [»] | |
| B | 25-50 | [»] | ||||
| 2WRV | X-ray | 2.15 | A | 90-110 | [»] | |
| B | 25-50 | [»] | ||||
| 2WRW | X-ray | 2.41 | A | 90-110 | [»] | |
| B | 25-50 | [»] | ||||
| 2WRX | X-ray | 1.50 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 2WS0 | X-ray | 2.10 | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 2WS1 | X-ray | 1.60 | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 2WS4 | X-ray | 1.90 | A | 90-110 | [»] | |
| B | 25-50 | [»] | ||||
| 2WS6 | X-ray | 1.50 | A/C/E/G/I/K | 90-110 | [»] | |
| B/D/F/H/J/L | 25-54 | [»] | ||||
| 2WS7 | X-ray | 2.59 | A/C/E/G/I/K | 90-110 | [»] | |
| B/D/F/H/J/L | 25-50 | [»] | ||||
| 3AIY | NMR | - | A/C/E/G/I/K | 90-110 | [»] | |
| B/D/F/H/J/L | 25-54 | [»] | ||||
| 3BXQ | X-ray | 1.30 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 3E7Y | X-ray | 1.60 | A/C | 90-110 | [»] | |
| B/D | 25-53 | [»] | ||||
| 3E7Z | X-ray | 1.70 | A/C | 90-110 | [»] | |
| B/D | 25-53 | [»] | ||||
| 3EXX | X-ray | 1.35 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 3FQ9 | X-ray | 1.35 | A/C | 91-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 3HYD | X-ray | 1.00 | A | 35-41 | [»] | |
| 3I3Z | X-ray | 1.60 | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 3I40 | X-ray | 1.85 | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 3ILG | X-ray | 1.90 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 3INC | X-ray | 1.85 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 3IR0 | X-ray | 2.20 | A/C/E/G/I/K/M/O/R/T/V/X | 90-110 | [»] | |
| B/D/F/H/J/L/N/P/S/U/W/Y | 25-54 | [»] | ||||
| 3JSD | X-ray | 2.50 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 3KQ6 | X-ray | 1.90 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 3P2X | X-ray | 2.00 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 3P33 | X-ray | 2.30 | A/C/E/G | 90-110 | [»] | |
| B/D/F/H | 25-54 | [»] | ||||
| 3Q6E | X-ray | 2.05 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 3ROV | X-ray | 2.30 | A/C/E/G/I/K | 90-110 | [»] | |
| B/D/F/H/J/L | 25-54 | [»] | ||||
| 3TT8 | X-ray | 1.12 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 3U4N | X-ray | 1.98 | A | 90-110 | [»] | |
| B | 25-53 | [»] | ||||
| 3UTQ | X-ray | 1.67 | C | 15-24 | [»] | |
| 3UTS | X-ray | 2.71 | C/H | 15-24 | [»] | |
| 3UTT | X-ray | 2.60 | C/H | 15-24 | [»] | |
| 3V19 | X-ray | 2.00 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 3V1G | X-ray | 2.20 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 3W11 | X-ray | 3.90 | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 3W12 | X-ray | 4.30 | A | 90-110 | [»] | |
| B | 25-50 | [»] | ||||
| 3W13 | X-ray | 4.30 | A | 90-110 | [»] | |
| B | 25-50 | [»] | ||||
| 3W7Y | X-ray | 0.92 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 3W7Z | X-ray | 1.15 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 3W80 | X-ray | 1.40 | A/C/E/G | 90-110 | [»] | |
| B/D/F/H | 25-54 | [»] | ||||
| 3ZI3 | X-ray | 1.70 | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 3ZQR | X-ray | 1.90 | A/C/E/G/I/K | 90-110 | [»] | |
| B/D/F/H/J/L | 25-54 | [»] | ||||
| 3ZS2 | X-ray | 1.97 | A/C/E/G/I/K | 90-110 | [»] | |
| B/D/F/H/J/L | 25-54 | [»] | ||||
| 3ZU1 | X-ray | 1.60 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 4AIY | NMR | - | A/C/E/G/I/K | 90-110 | [»] | |
| B/D/F/H/J/L | 25-54 | [»] | ||||
| 4AJX | X-ray | 1.20 | A/C/E/G/I/K | 90-110 | [»] | |
| B/D/F/H/J/L | 25-53 | [»] | ||||
| 4AJZ | X-ray | 1.80 | A/C | 90-110 | [»] | |
| B/D | 25-53 | [»] | ||||
| 4AK0 | X-ray | 2.28 | A | 90-110 | [»] | |
| B | 25-53 | [»] | ||||
| 4AKJ | X-ray | 2.01 | A/C | 90-110 | [»] | |
| B/D | 25-53 | [»] | ||||
| 4CXL | X-ray | 1.50 | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 4CXN | X-ray | 1.70 | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 4CY7 | X-ray | 1.40 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 4EFX | X-ray | 1.98 | A/C | 90-110 | [»] | |
| B/D | 25-52 | [»] | ||||
| 4EWW | X-ray | 2.30 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 4EWX | X-ray | 2.20 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 4EWZ | X-ray | 1.79 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 4EX0 | X-ray | 1.86 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 4EX1 | X-ray | 1.66 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 4EXX | X-ray | 1.55 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 4EY1 | X-ray | 1.47 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 4EY9 | X-ray | 1.47 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 4EYD | X-ray | 1.47 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 4EYN | X-ray | 1.53 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 4EYP | X-ray | 1.59 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 4F0N | X-ray | 1.68 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 4F0O | X-ray | 1.67 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 4F1A | X-ray | 1.80 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 4F1B | X-ray | 1.59 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 4F1C | X-ray | 1.70 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 4F1D | X-ray | 1.64 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 4F1F | X-ray | 1.68 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 4F1G | X-ray | 1.64 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 4F4T | X-ray | 1.64 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 4F4V | X-ray | 1.64 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 4F51 | X-ray | 1.64 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 4F8F | X-ray | 1.68 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 4FG3 | X-ray | 2.00 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 4FKA | X-ray | 1.08 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 4GBC | X-ray | 1.78 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 4GBI | X-ray | 2.50 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 4GBK | X-ray | 2.40 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 4GBL | X-ray | 2.50 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 4GBN | X-ray | 1.87 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 4IUZ | X-ray | 1.60 | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 4IYD | X-ray | 1.66 | A | 90-109 | [»] | |
| B | 25-53 | [»] | ||||
| 4IYF | X-ray | 1.80 | A | 90-109 | [»] | |
| B | 25-53 | [»] | ||||
| 4NIB | X-ray | 1.40 | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 4OGA | X-ray | 3.50 | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 4P65 | X-ray | 1.50 | A/C/E/G/I/K | 90-110 | [»] | |
| B/D/F/H/J/L | 25-54 | [»] | ||||
| 4RXW | X-ray | 1.73 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 4UNE | X-ray | 1.59 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 4UNG | X-ray | 1.81 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 4UNH | X-ray | 2.75 | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 4WDI | X-ray | 2.31 | C/F | 39-47 | [»] | |
| 4XC4 | X-ray | 1.50 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 4Y19 | X-ray | 2.50 | C | 75-90 | [»] | |
| 4Y1A | X-ray | 4.00 | C | 75-90 | [»] | |
| 4Z76 | X-ray | 1.88 | C/F | 39-46 | [»] | |
| 4Z77 | X-ray | 1.85 | C/F | 39-47 | [»] | |
| 4Z78 | X-ray | 2.30 | C/F/I | 39-48 | [»] | |
| 5AIY | NMR | - | A/C/E/G/I/K | 90-110 | [»] | |
| B/D/F/H/J/L | 25-54 | [»] | ||||
| 5BOQ | X-ray | 1.70 | A/C/E/G | 90-110 | [»] | |
| B/D/F/H | 25-54 | [»] | ||||
| 5BPO | X-ray | 1.90 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 5BQQ | X-ray | 1.54 | A/C/E/G/I/K | 90-110 | [»] | |
| B/D/F/H/J/L | 25-50 | [»] | ||||
| 5BTS | X-ray | 1.77 | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 5C0D | X-ray | 1.68 | C | 15-24 | [»] | |
| 5CJO | X-ray | 3.29 | a | 90-109 | [»] | |
| 5CNY | X-ray | 1.70 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 5CO2 | X-ray | 1.70 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 5CO6 | X-ray | 1.80 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 5CO9 | X-ray | 1.92 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 5E7W | X-ray | 0.95 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 5EMS | X-ray | 2.30 | A/C/E/G/I/K | 90-110 | [»] | |
| B/D/F/H/J/L | 25-52 | [»] | ||||
| 5EN9 | X-ray | 1.50 | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 5ENA | X-ray | 1.35 | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 5HPR | X-ray | 1.33 | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 5HPU | X-ray | 2.20 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 5HQI | X-ray | 0.97 | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 5HRQ | X-ray | 1.28 | A/C/E/G/I/K | 90-110 | [»] | |
| B/D/F/H/J/L | 25-54 | [»] | ||||
| 5HYJ | X-ray | 3.06 | C/H | 15-24 | [»] | |
| 5MAM | X-ray | 2.20 | 0/2/4/A/C/E/G/I/K/M/O/Q/S/U/W/Y | 90-110 | [»] | |
| 1/3/5/B/D/F/H/J/L/N/P/R/T/V/X/Z | 25-54 | [»] | ||||
| 5MHD | NMR | - | A | 90-110 | [»] | |
| B | 25-55 | [»] | ||||
| 5MT3 | X-ray | 2.02 | A/C/E/G/I/K/M/O/Q/S/U/W/Y/a/c/e | 90-110 | [»] | |
| B/D/F/H/J/L/N/P/R/T/V/X/Z/b/d/f | 25-54 | [»] | ||||
| 5MT9 | X-ray | 1.88 | A/C/E/G/I/K/M/O/Q/S/U/W/Y/a/c/e | 90-110 | [»] | |
| B/D/F/H/J/L/N/P/R/T/V/X/Z/b/d/f | 25-54 | [»] | ||||
| 5MWQ | NMR | - | A | 90-110 | [»] | |
| B | 25-56 | [»] | ||||
| 5T7R | X-ray | 1.55 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 5UDP | X-ray | 1.35 | A/C/E/G/I/K | 90-110 | [»] | |
| B/D/F/H/J/L | 25-54 | [»] | ||||
| 5UOZ | X-ray | 1.17 | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 5UQA | X-ray | 1.31 | A/C/E/G/I/K | 90-110 | [»] | |
| B/D/F/H/J/L | 25-54 | [»] | ||||
| 5URT | X-ray | 1.18 | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 5URU | X-ray | 2.41 | A/C/E/G | 90-110 | [»] | |
| B/D/F/H | 25-54 | [»] | ||||
| 5USP | X-ray | 1.17 | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 5USS | X-ray | 2.06 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 5USV | X-ray | 1.30 | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 5UU2 | X-ray | 1.22 | A | 90-110 | [»] | |
| B | 25-54 | [»] | ||||
| 5UU3 | X-ray | 2.25 | A/C/E/G/I/K/M/O/Q/S/U/W | 90-110 | [»] | |
| B/D/F/H/J/L/N/P/R/T/V/X | 25-54 | [»] | ||||
| 5UU4 | X-ray | 1.97 | A/C | 90-110 | [»] | |
| B/D | 25-54 | [»] | ||||
| 5VIZ | X-ray | 1.70 | A | 90-109 | [»] | |
| B | 25-53 | [»] | ||||
| 5WBT | NMR | - | A | 25-54 | [»] | |
| A | 90-110 | [»] | ||||
| 5WDM | X-ray | 2.80 | A/B/C/D/E/F | 25-110 | [»] | |
| 5WOB | X-ray | 3.95 | a/b/c/d/e/f/g/h | 90-109 | [»] | |
| 6B3Q | electron microscopy | 3.70 | a/b | 1-110 | [»] | |
| 6B70 | electron microscopy | 3.70 | a/c | 1-110 | [»] | |
| 6BFC | electron microscopy | 3.70 | a/b | 1-110 | [»] | |
| 6CE7 | electron microscopy | 7.40 | N | 90-110 | [»] | |
| 6CE9 | electron microscopy | 4.30 | K/N | 90-110 | [»] | |
| 6CEB | electron microscopy | 4.70 | K/N | 90-110 | [»] | |
Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase More...ProteinModelPortali | P01308 | |||||
SWISS-MODEL Repository - a database of annotated 3D protein structure models More...SMRi | P01308 | |||||
Database of comparative protein structure models More...ModBasei | Search... | |||||
MobiDB: a database of protein disorder and mobility annotations More...MobiDBi | Search... | |||||
Protein-protein interaction databases
The Biological General Repository for Interaction Datasets (BioGrid) More...BioGridi | 109842, 13 interactors |
Database of interacting proteins More...DIPi | DIP-6024N |
Protein interaction database and analysis system More...IntActi | P01308, 14 interactors |
Molecular INTeraction database More...MINTi | P01308 |
STRING: functional protein association networks More...STRINGi | 9606.ENSP00000250971 |
Chemistry databases
ChEMBL database of bioactive drug-like small molecules More...ChEMBLi | CHEMBL5881 |
Drug and drug target database More...DrugBanki | DB01776 M-Cresol DB08231 MYRISTIC ACID |
Protein family/group databases
Allergome; a platform for allergen knowledge More...Allergomei | 2121 Hom s Insulin |
PTM databases
CarbonylDB database of protein carbonylation sites More...CarbonylDBi | P01308 |
iPTMnet integrated resource for PTMs in systems biology context More...iPTMneti | P01308 |
Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat. More...PhosphoSitePlusi | P01308 |
Polymorphism and mutation databases
BioMuta curated single-nucleotide variation and disease association database More...BioMutai | INS |
Domain mapping of disease mutations (DMDM) More...DMDMi | 124617 |
Proteomic databases
Encyclopedia of Proteome Dynamics More...EPDi | P01308 |
PaxDb, a database of protein abundance averages across all three domains of life More...PaxDbi | P01308 |
PeptideAtlas More...PeptideAtlasi | P01308 |
PRoteomics IDEntifications database More...PRIDEi | P01308 |
ProteomicsDB human proteome resource More...ProteomicsDBi | 51374 |
Protocols and materials databases
The DNASU plasmid repository More...DNASUi | 3630 |
| Structural Biology Knowledgebase | Search... |
Genome annotation databases
Ensembl eukaryotic genome annotation project More...Ensembli | ENST00000250971; ENSP00000250971; ENSG00000254647 [P01308-1] ENST00000381330; ENSP00000370731; ENSG00000254647 [P01308-1] ENST00000397262; ENSP00000380432; ENSG00000254647 [P01308-1] |
Database of genes from NCBI RefSeq genomes More...GeneIDi | 3630 |
KEGG: Kyoto Encyclopedia of Genes and Genomes More...KEGGi | hsa:3630 |
UCSC genome browser More...UCSCi | uc001lvn.3 human [P01308-1] |
Organism-specific databases
Comparative Toxicogenomics Database More...CTDi | 3630 |
DisGeNET More...DisGeNETi | 3630 |
Eukaryotic Pathogen Database Resources More...EuPathDBi | HostDB:ENSG00000254647.6 |
GeneCards: human genes, protein and diseases More...GeneCardsi | INS |
GeneReviews a resource of expert-authored, peer-reviewed disease descriptions. More...GeneReviewsi | INS |
Human Gene Nomenclature Database More...HGNCi | HGNC:6081 INS |
Human Protein Atlas More...HPAi | CAB000048 CAB012098 CAB053843 HPA004932 |
MalaCards human disease database More...MalaCardsi | INS |
Online Mendelian Inheritance in Man (OMIM) More...MIMi | 125852 phenotype 176730 gene 606176 phenotype 613370 phenotype 616214 phenotype |
neXtProt; the human protein knowledge platform More...neXtProti | NX_P01308 |
Open Targets More...OpenTargetsi | ENSG00000254647 |
Orphanet; a database dedicated to information on rare diseases and orphan drugs More...Orphaneti | 552 MODY 99885 Permanent neonatal diabetes mellitus |
The Pharmacogenetics and Pharmacogenomics Knowledge Base More...PharmGKBi | PA201 |
GenAtlas: human gene database More...GenAtlasi | Search... |
Phylogenomic databases
evolutionary genealogy of genes: Non-supervised Orthologous Groups More...eggNOGi | ENOG410J0XC Eukaryota ENOG4111VJB LUCA |
Ensembl GeneTree More...GeneTreei | ENSGT00390000015440 |
The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms More...HOGENOMi | HOG000261669 |
The HOVERGEN Database of Homologous Vertebrate Genes More...HOVERGENi | HBG006137 |
InParanoid: Eukaryotic Ortholog Groups More...InParanoidi | P01308 |
KEGG Orthology (KO) More...KOi | K04526 |
Identification of Orthologs from Complete Genome Data More...OMAi | PQHLCGS |
Database of Orthologous Groups More...OrthoDBi | EOG091G0H56 |
Database for complete collections of gene phylogenies More...PhylomeDBi | P01308 |
TreeFam database of animal gene trees More...TreeFami | TF332820 |
Enzyme and pathway databases
BioCyc Collection of Pathway/Genome Databases More...BioCyci | MetaCyc:MONOMER-16190 |
Reactome - a knowledgebase of biological pathways and processes More...Reactomei | R-HSA-210745 Regulation of gene expression in beta cells R-HSA-264876 Insulin processing R-HSA-422085 Synthesis, secretion, and deacylation of Ghrelin R-HSA-422356 Regulation of insulin secretion R-HSA-6807878 COPI-mediated anterograde transport R-HSA-6811558 PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling R-HSA-74713 IRS activation R-HSA-74749 Signal attenuation R-HSA-74751 Insulin receptor signalling cascade R-HSA-74752 Signaling by Insulin receptor R-HSA-77387 Insulin receptor recycling R-HSA-977225 Amyloid fiber formation |
SignaLink: a signaling pathway resource with multi-layered regulatory networks More...SignaLinki | P01308 |
SIGNOR Signaling Network Open Resource More...SIGNORi | P01308 |
Miscellaneous databases
ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data More...ChiTaRSi | INS human |
Relative evolutionary importance of amino acids within a protein sequence More...EvolutionaryTracei | P01308 |
The Gene Wiki collection of pages on human genes and proteins More...GeneWikii | Insulin |
Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens More...GenomeRNAii | 3630 |
CutDB - Proteolytic event database More...PMAP-CutDBi | P01308 |
Protein Ontology More...PROi | PR:P01308 |
The Stanford Online Universal Resource for Clones and ESTs More...SOURCEi | Search... |
Gene expression databases
Bgee dataBase for Gene Expression Evolution More...Bgeei | ENSG00000254647 |
ExpressionAtlas, Differential and Baseline Expression More...ExpressionAtlasi | P01308 baseline and differential |
Genevisible search portal to normalized and curated expression data from Genevestigator More...Genevisiblei | P01308 HS |
Family and domain databases
Integrated resource of protein families, domains and functional sites More...InterProi | View protein in InterPro IPR004825 Insulin IPR016179 Insulin-like IPR036438 Insulin-like_sf IPR022353 Insulin_CS IPR022352 Insulin_family |
Pfam protein domain database More...Pfami | View protein in Pfam PF00049 Insulin, 1 hit |
Protein Motif fingerprint database; a protein domain database More...PRINTSi | PR00277 INSULIN PR00276 INSULINFAMLY |
Simple Modular Architecture Research Tool; a protein domain database More...SMARTi | View protein in SMART SM00078 IlGF, 1 hit |
Superfamily database of structural and functional annotation More...SUPFAMi | SSF56994 SSF56994, 1 hit |
PROSITE; a protein domain and family database More...PROSITEi | View protein in PROSITE PS00262 INSULIN, 1 hit |
ProtoNet; Automatic hierarchical classification of proteins More...ProtoNeti | Search... |
<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi
| <p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry namei | INS_HUMAN | |
| <p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>Accessioni | P01308Primary (citable) accession number: P01308 Secondary accession number(s): Q5EEX2 | |
| <p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyi | Integrated into UniProtKB/Swiss-Prot: | July 21, 1986 |
| Last sequence update: | July 21, 1986 | |
| Last modified: | July 18, 2018 | |
| This is version 239 of the entry and version 1 of the sequence. See complete history. | ||
| <p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusi | Reviewed (UniProtKB/Swiss-Prot) | |
| Annotation program | Chordata Protein Annotation Program | |
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | |
<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Technical termi
3D-structure, Complete proteome, Direct protein sequencing, Pharmaceutical, Reference proteomeDocuments
- Human chromosome 11
Human chromosome 11: entries, gene names and cross-references to MIM - Human entries with polymorphisms or disease mutations
List of human entries with polymorphisms or disease mutations - Human polymorphisms and disease mutations
Index of human polymorphisms and disease mutations - MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot - PDB cross-references
Index of Protein Data Bank (PDB) cross-references - Protein Spotlight
Protein Spotlight articles and cited UniProtKB/Swiss-Prot entries - SIMILARITY comments
Index of protein domains and families
