Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Thyroglobulin

Gene

TG

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Precursor of the iodinated thyroid hormones thyroxine (T4) and triiodothyronine (T3).

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

  • hormone biosynthetic process Source: UniProtKB-KW
  • iodide transport Source: Ensembl
  • regulation of myelination Source: Ensembl
  • signal transduction Source: ProtInc
  • thyroid gland development Source: UniProtKB
  • thyroid hormone metabolic process Source: Ensembl

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHormone, Thyroid hormone
Biological processThyroid hormones biosynthesis

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...
BioCyci
MetaCyc:ENSG00000042832-MONOMER

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P01266

Protein family/group databases

ESTHER database of the Alpha/Beta-hydrolase fold superfamily of proteins

More...
ESTHERi
human-TG Thyroglobulin

MEROPS protease database

More...
MEROPSi
I31.950

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
ThyroglobulinCurated
Short name:
Tg
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TGImported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 8

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000042832.11

Human Gene Nomenclature Database

More...
HGNCi
HGNC:11764 TG

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
188450 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P01266

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Thyroid dyshormonogenesis 3 (TDH3)6 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA disorder due to thyroid dyshormonogenesis, causing large goiters of elastic and soft consistency in the majority of patients. Although the degree of thyroid dysfunction varies considerably among patients with defective thyroglobulin synthesis, patients usually have a relatively high serum free triiodothyronine (T3) concentration with disproportionately low free tetraiodothyronine (T4) level. The maintenance of relatively high free T3 levels prevents profound tissue hypothyroidism except in brain and pituitary, which are dependent on T4 supply, resulting in neurologic and intellectual defects in some cases.
See also OMIM:274700
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_063034183C → Y in TDH3. 1 Publication1
Natural variantiVAR_0102161264C → R in TDH3; autosomal recessive. 1 PublicationCorresponds to variant dbSNP:rs2076738Ensembl.1
Natural variantiVAR_0630351897C → Y in TDH3. 1 PublicationCorresponds to variant dbSNP:rs121912649EnsemblClinVar.1
Natural variantiVAR_0102191996C → S in TDH3; autosomal recessive. 1 PublicationCorresponds to variant dbSNP:rs2076739EnsemblClinVar.1
Natural variantiVAR_0630362234A → D in TDH3; reduces thyroglobulin synthesis and secretion; promotes thyroglobulin retention within the endoplasmic reticulum. 2 PublicationsCorresponds to variant dbSNP:rs370991693Ensembl.1
Natural variantiVAR_0783382336 – 2768Missing in TDH3; unknown pathological significance. 1 PublicationAdd BLAST433
Natural variantiVAR_0630372336R → Q in TDH3. 1 PublicationCorresponds to variant dbSNP:rs121912650EnsemblClinVar.1
Natural variantiVAR_0630382375G → R in TDH3. 1 PublicationCorresponds to variant dbSNP:rs137854434EnsemblClinVar.1
Autoimmune thyroid disease 3 (AITD3)1 Publication
Disease susceptibility is associated with variations affecting the gene represented in this entry.
Disease descriptionA complex autoimmune disorder comprising two related diseases affecting the thyroid: Graves disease and Hashimoto thyroiditis. In both disorders, thyroid-reactive T-cells are formed and infiltrate the thyroid gland. In Graves disease, the majority of the T-cells undergo a Th2 differentiation and activate B-cells to produce antibodies against the TSH receptor, which stimulate the thyroid and cause clinical hyperthyroidism. In contrast, Hashimoto thyroiditis is characterized by Th1 switching of the thyroid-infiltrating T-cells, which induces apoptosis of thyroid follicular cells and clinical hypothyroidism.
See also OMIM:608175

Keywords - Diseasei

Congenital hypothyroidism, Disease mutation

Organism-specific databases

DisGeNET

More...
DisGeNETi
7038

MalaCards human disease database

More...
MalaCardsi
TG
MIMi274700 phenotype
608175 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000042832

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
95716 Familial thyroid dyshormonogenesis

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA36479

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TG

Domain mapping of disease mutations (DMDM)

More...
DMDMi
126302607

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 19Add BLAST19
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000000863620 – 2768ThyroglobulinAdd BLAST2749

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei24Iodotyrosine; alternate1 Publication1
Modified residuei24Sulfotyrosine; alternateBy similarity1
Modified residuei24Thyroxine; alternate1 Publication1
Modified residuei24Triiodothyronine; alternate1 Publication1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi34 ↔ 52PROSITE-ProRule annotation
Disulfide bondi63 ↔ 70PROSITE-ProRule annotation
Disulfide bondi72 ↔ 92PROSITE-ProRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi76N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi96 ↔ 120PROSITE-ProRule annotation
Disulfide bondi131 ↔ 138PROSITE-ProRule annotation
Disulfide bondi140 ↔ 160PROSITE-ProRule annotation
Modified residuei149Diiodotyrosine; alternate1 Publication1
Modified residuei149Iodotyrosine; alternate1 Publication1
Disulfide bondi164 ↔ 183PROSITE-ProRule annotation
Disulfide bondi194 ↔ 235PROSITE-ProRule annotation
Glycosylationi198N-linked (GlcNAc...) asparagine1 Publication1
Modified residuei258Iodotyrosine1 Publication1
Disulfide bondi301 ↔ 319PROSITE-ProRule annotation
Disulfide bondi330 ↔ 336PROSITE-ProRule annotation
Disulfide bondi338 ↔ 358PROSITE-ProRule annotation
Glycosylationi484N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi529N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi608 ↔ 620PROSITE-ProRule annotation
Disulfide bondi631 ↔ 636PROSITE-ProRule annotation
Disulfide bondi638 ↔ 658PROSITE-ProRule annotation
Disulfide bondi662 ↔ 687PROSITE-ProRule annotation
Disulfide bondi698 ↔ 703PROSITE-ProRule annotation
Modified residuei704Diiodotyrosine; alternate1 Publication1
Modified residuei704Iodotyrosine; alternate1 Publication1
Modified residuei704Thyroxine; alternate1 Publication1
Modified residuei704Triiodothyronine; alternate1 Publication1
Disulfide bondi705 ↔ 726PROSITE-ProRule annotation
Disulfide bondi730 ↔ 763PROSITE-ProRule annotation
Glycosylationi748N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi774 ↔ 898PROSITE-ProRule annotation
Modified residuei785Iodotyrosine1 Publication1
Glycosylationi816N-linked (GlcNAc...) asparagine1 Publication1
Modified residuei866Diiodotyrosine; alternate1 Publication1
Modified residuei866Iodotyrosine; alternate1 Publication1
Modified residuei883Diiodotyrosine1 Publication1
Disulfide bondi900 ↔ 921PROSITE-ProRule annotation
Glycosylationi947N-linked (GlcNAc...) asparagine1 Publication1
Modified residuei992Diiodotyrosine; alternate1 Publication1
Modified residuei992Iodotyrosine; alternate1 Publication1
Disulfide bondi1042 ↔ 1049PROSITE-ProRule annotation
Disulfide bondi1051 ↔ 1073PROSITE-ProRule annotation
Disulfide bondi1077 ↔ 1108PROSITE-ProRule annotation
Disulfide bondi1126 ↔ 1145PROSITE-ProRule annotation
Disulfide bondi1149 ↔ 1169PROSITE-ProRule annotation
Disulfide bondi1181 ↔ 1188PROSITE-ProRule annotation
Disulfide bondi1190 ↔ 1210PROSITE-ProRule annotation
Glycosylationi1220N-linked (GlcNAc...) asparagine1 Publication1
Modified residuei1310Iodotyrosine1 Publication1
Glycosylationi1348N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi1349N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi1365N-linked (GlcNAc...) asparagine1 Publication1
Modified residuei1467Diiodotyrosine; alternate1 Publication1
Modified residuei1467Iodotyrosine; alternate1 Publication1
Disulfide bondi1514 ↔ 1523PROSITE-ProRule annotation
Disulfide bondi1543 ↔ 1565PROSITE-ProRule annotation
Glycosylationi1716N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi1774N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi2013N-linked (GlcNAc...) asparagine1 Publication1
Modified residuei2184Iodotyrosine1 Publication1
Glycosylationi2250N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi2264 ↔ 2281PROSITE-ProRule annotation
Glycosylationi2295N-linked (GlcNAc...) asparagine1 Publication1
Modified residuei2573Diiodotyrosine; alternate1 Publication1
Modified residuei2573Iodotyrosine; alternate1 Publication1
Modified residuei2573Thyroxine; alternate1 Publication1
Modified residuei2573Triiodothyronine; alternate1 Publication1
Glycosylationi2582N-linked (GlcNAc...) asparagine1 Publication1
Modified residuei2587Iodotyrosine1 Publication1
Modified residuei2617Iodotyrosine1 Publication1
Modified residuei2697Diiodotyrosine1 Publication1
Glycosylationi2749O-linked (Xyl...) (chondroitin sulfate) serine1 Publication1
Modified residuei2766Diiodotyrosine; alternate1 Publication1
Modified residuei2766Iodotyrosine; alternate1 Publication1
Modified residuei2766Thyroxine; alternate1 Publication1
Modified residuei2766Triiodothyronine; alternate1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Sulfated tyrosines are desulfated during iodination.2 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei110Not glycosylated1 Publication1
Sitei496Not glycosylated1 Publication1
Sitei1869Not glycosylated1 Publication1
Sitei2122Not glycosylated1 Publication1

Keywords - PTMi

Disulfide bond, Glycoprotein, Iodination, Proteoglycan, Sulfation

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P01266

PeptideAtlas

More...
PeptideAtlasi
P01266

PRoteomics IDEntifications database

More...
PRIDEi
P01266

ProteomicsDB human proteome resource

More...
ProteomicsDBi
51364
51365 [P01266-2]

PTM databases

CarbonylDB database of protein carbonylation sites

More...
CarbonylDBi
P01266

GlyConnect protein glycosylation platform

More...
GlyConnecti
600

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P01266

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P01266

UniCarbKB; an annotated and curated database of glycan structures

More...
UniCarbKBi
P01266

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Thyroid gland specific.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000042832 Expressed in 103 organ(s), highest expression level in thyroid gland

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P01266 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P01266 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB000077
CAB056155
HPA002740

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer.

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
112896, 3 interactors

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
P01266

Protein interaction database and analysis system

More...
IntActi
P01266, 2 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000220616

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P01266

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P01266

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini31 – 92Thyroglobulin type-1 1PROSITE-ProRule annotationAdd BLAST62
Domaini93 – 160Thyroglobulin type-1 2PROSITE-ProRule annotationAdd BLAST68
Domaini161 – 297Thyroglobulin type-1 3PROSITE-ProRule annotationAdd BLAST137
Domaini298 – 358Thyroglobulin type-1 4PROSITE-ProRule annotationAdd BLAST61
Domaini605 – 658Thyroglobulin type-1 5PROSITE-ProRule annotationAdd BLAST54
Domaini659 – 726Thyroglobulin type-1 6PROSITE-ProRule annotationAdd BLAST68
Domaini727 – 921Thyroglobulin type-1 7PROSITE-ProRule annotationAdd BLAST195
Domaini922 – 1073Thyroglobulin type-1 8PROSITE-ProRule annotationAdd BLAST152
Domaini1074 – 1145Thyroglobulin type-1 9PROSITE-ProRule annotationAdd BLAST72
Domaini1146 – 1210Thyroglobulin type-1 10PROSITE-ProRule annotationAdd BLAST65
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati1456 – 1469Type II1 PublicationAdd BLAST14
Repeati1470 – 1486Type II1 PublicationAdd BLAST17
Repeati1487 – 1503Type II1 PublicationAdd BLAST17
Domaini1511 – 1565Thyroglobulin type-1 11PROSITE-ProRule annotationAdd BLAST55
Repeati1603 – 1723Type IIIA1 PublicationAdd BLAST121
Repeati1724 – 1892Type IIIB1 PublicationAdd BLAST169
Repeati1893 – 1995Type IIIA1 PublicationAdd BLAST103
Repeati1996 – 2129Type IIIB1 PublicationAdd BLAST134
Repeati2130 – 2187Type IIIA1 PublicationAdd BLAST58

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Repeat, Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IG6K Eukaryota
COG2272 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000159300

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG017929

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P01266

KEGG Orthology (KO)

More...
KOi
K10809

Identification of Orthologs from Complete Genome Data

More...
OMAi
LRSCWCV

Database of Orthologous Groups

More...
OrthoDBi
EOG091G004S

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P01266

TreeFam database of animal gene trees

More...
TreeFami
TF351833

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00191 TY, 7 hits

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.50.1820, 1 hit
4.10.800.10, 8 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR029058 AB_hydrolase
IPR002018 CarbesteraseB
IPR019819 Carboxylesterase_B_CS
IPR016324 Thyroglobulin
IPR000716 Thyroglobulin_1
IPR036857 Thyroglobulin_1_sf
IPR011641 Tyr-kin_ephrin_A/B_rcpt-like

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00135 COesterase, 1 hit
PF07699 Ephrin_rec_like, 1 hit
PF00086 Thyroglobulin_1, 10 hits

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF001831 Thyroglobulin, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM01411 Ephrin_rec_like, 1 hit
SM00211 TY, 10 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF53474 SSF53474, 1 hit
SSF57610 SSF57610, 11 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00941 CARBOXYLESTERASE_B_2, 1 hit
PS00484 THYROGLOBULIN_1_1, 9 hits
PS51162 THYROGLOBULIN_1_2, 11 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P01266-1) [UniParc]FASTAAdd to basket
Also known as: Major

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MALVLEIFTL LASICWVSAN IFEYQVDAQP LRPCELQRET AFLKQADYVP
60 70 80 90 100
QCAEDGSFQT VQCQNDGRSC WCVGANGSEV LGSRQPGRPV ACLSFCQLQK
110 120 130 140 150
QQILLSGYIN STDTSYLPQC QDSGDYAPVQ CDVQQVQCWC VDAEGMEVYG
160 170 180 190 200
TRQLGRPKRC PRSCEIRNRR LLHGVGDKSP PQCSAEGEFM PVQCKFVNTT
210 220 230 240 250
DMMIFDLVHS YNRFPDAFVT FSSFQRRFPE VSGYCHCADS QGRELAETGL
260 270 280 290 300
ELLLDEIYDT IFAGLDLPST FTETTLYRIL QRRFLAVQSV ISGRFRCPTK
310 320 330 340 350
CEVERFTATS FGHPYVPSCR RNGDYQAVQC QTEGPCWCVD AQGKEMHGTR
360 370 380 390 400
QQGEPPSCAE GQSCASERQQ ALSRLYFGTS GYFSQHDLFS SPEKRWASPR
410 420 430 440 450
VARFATSCPP TIKELFVDSG LLRPMVEGQS QQFSVSENLL KEAIRAIFPS
460 470 480 490 500
RGLARLALQF TTNPKRLQQN LFGGKFLVNV GQFNLSGALG TRGTFNFSQF
510 520 530 540 550
FQQLGLASFL NGGRQEDLAK PLSVGLDSNS STGTPEAAKK DGTMNKPTVG
560 570 580 590 600
SFGFEINLQE NQNALKFLAS LLELPEFLLF LQHAISVPED VARDLGDVME
610 620 630 640 650
TVLSSQTCEQ TPERLFVPSC TTEGSYEDVQ CFSGECWCVN SWGKELPGSR
660 670 680 690 700
VRGGQPRCPT DCEKQRARMQ SLMGSQPAGS TLFVPACTSE GHFLPVQCFN
710 720 730 740 750
SECYCVDAEG QAIPGTRSAI GKPKKCPTPC QLQSEQAFLR TVQALLSNSS
760 770 780 790 800
MLPTLSDTYI PQCSTDGQWR QVQCNGPPEQ VFELYQRWEA QNKGQDLTPA
810 820 830 840 850
KLLVKIMSYR EAASGNFSLF IQSLYEAGQQ DVFPVLSQYP SLQDVPLAAL
860 870 880 890 900
EGKRPQPREN ILLEPYLFWQ ILNGQLSQYP GSYSDFSTPL AHFDLRNCWC
910 920 930 940 950
VDEAGQELEG MRSEPSKLPT CPGSCEEAKL RVLQFIRETE EIVSASNSSR
960 970 980 990 1000
FPLGESFLVA KGIRLRNEDL GLPPLFPPRE AFAEQFLRGS DYAIRLAAQS
1010 1020 1030 1040 1050
TLSFYQRRRF SPDDSAGASA LLRSGPYMPQ CDAFGSWEPV QCHAGTGHCW
1060 1070 1080 1090 1100
CVDEKGGFIP GSLTARSLQI PQCPTTCEKS RTSGLLSSWK QARSQENPSP
1110 1120 1130 1140 1150
KDLFVPACLE TGEYARLQAS GAGTWCVDPA SGEELRPGSS SSAQCPSLCN
1160 1170 1180 1190 1200
VLKSGVLSRR VSPGYVPACR AEDGGFSPVQ CDQAQGSCWC VMDSGEEVPG
1210 1220 1230 1240 1250
TRVTGGQPAC ESPRCPLPFN ASEVVGGTIL CETISGPTGS AMQQCQLLCR
1260 1270 1280 1290 1300
QGSWSVFPPG PLICSLESGR WESQLPQPRA CQRPQLWQTI QTQGHFQLQL
1310 1320 1330 1340 1350
PPGKMCSADY ADLLQTFQVF ILDELTARGF CQIQVKTFGT LVSIPVCNNS
1360 1370 1380 1390 1400
SVQVGCLTRE RLGVNVTWKS RLEDIPVASL PDLHDIERAL VGKDLLGRFT
1410 1420 1430 1440 1450
DLIQSGSFQL HLDSKTFPAE TIRFLQGDHF GTSPRTWFGC SEGFYQVLTS
1460 1470 1480 1490 1500
EASQDGLGCV KCPEGSYSQD EECIPCPVGF YQEQAGSLAC VPCPVGRTTI
1510 1520 1530 1540 1550
SAGAFSQTHC VTDCQRNEAG LQCDQNGQYR ASQKDRGSGK AFCVDGEGRR
1560 1570 1580 1590 1600
LPWWETEAPL EDSQCLMMQK FEKVPESKVI FDANAPVAVR SKVPDSEFPV
1610 1620 1630 1640 1650
MQCLTDCTED EACSFFTVST TEPEISCDFY AWTSDNVACM TSDQKRDALG
1660 1670 1680 1690 1700
NSKATSFGSL RCQVKVRSHG QDSPAVYLKK GQGSTTTLQK RFEPTGFQNM
1710 1720 1730 1740 1750
LSGLYNPIVF SASGANLTDA HLFCLLACDR DLCCDGFVLT QVQGGAIICG
1760 1770 1780 1790 1800
LLSSPSVLLC NVKDWMDPSE AWANATCPGV TYDQESHQVI LRLGDQEFIK
1810 1820 1830 1840 1850
SLTPLEGTQD TFTNFQQVYL WKDSDMGSRP ESMGCRKDTV PRPASPTEAG
1860 1870 1880 1890 1900
LTTELFSPVD LNQVIVNGNQ SLSSQKHWLF KHLFSAQQAN LWCLSRCVQE
1910 1920 1930 1940 1950
HSFCQLAEIT ESASLYFTCT LYPEAQVCDD IMESNAQGCR LILPQMPKAL
1960 1970 1980 1990 2000
FRKKVILEDK VKNFYTRLPF QKLMGISIRN KVPMSEKSIS NGFFECERRC
2010 2020 2030 2040 2050
DADPCCTGFG FLNVSQLKGG EVTCLTLNSL GIQMCSEENG GAWRILDCGS
2060 2070 2080 2090 2100
PDIEVHTYPF GWYQKPIAQN NAPSFCPLVV LPSLTEKVSL DSWQSLALSS
2110 2120 2130 2140 2150
VVVDPSIRHF DVAHVSTAAT SNFSAVRDLC LSECSQHEAC LITTLQTQPG
2160 2170 2180 2190 2200
AVRCMFYADT QSCTHSLQGQ NCRLLLREEA THIYRKPGIS LLSYEASVPS
2210 2220 2230 2240 2250
VPISTHGRLL GRSQAIQVGT SWKQVDQFLG VPYAAPPLAE RRFQAPEPLN
2260 2270 2280 2290 2300
WTGSWDASKP RASCWQPGTR TSTSPGVSED CLYLNVFIPQ NVAPNASVLV
2310 2320 2330 2340 2350
FFHNTMDREE SEGWPAIDGS FLAAVGNLIV VTASYRVGVF GFLSSGSGEV
2360 2370 2380 2390 2400
SGNWGLLDQV AALTWVQTHI RGFGGDPRRV SLAADRGGAD VASIHLLTAR
2410 2420 2430 2440 2450
ATNSQLFRRA VLMGGSALSP AAVISHERAQ QQAIALAKEV SCPMSSSQEV
2460 2470 2480 2490 2500
VSCLRQKPAN VLNDAQTKLL AVSGPFHYWG PVIDGHFLRE PPARALKRSL
2510 2520 2530 2540 2550
WVEVDLLIGS SQDDGLINRA KAVKQFEESR GRTSSKTAFY QALQNSLGGE
2560 2570 2580 2590 2600
DSDARVEAAA TWYYSLEHST DDYASFSRAL ENATRDYFII CPIIDMASAW
2610 2620 2630 2640 2650
AKRARGNVFM YHAPENYGHG SLELLADVQF ALGLPFYPAY EGQFSLEEKS
2660 2670 2680 2690 2700
LSLKIMQYFS HFIRSGNPNY PYEFSRKVPT FATPWPDFVP RAGGENYKEF
2710 2720 2730 2740 2750
SELLPNRQGL KKADCSFWSK YISSLKTSAD GAKGGQSAES EEEELTAGSG
2760
LREDLLSLQE PGSKTYSK
Length:2,768
Mass (Da):304,790
Last modified:February 20, 2007 - v5
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i69A87D935F1BAA72
GO
Isoform 2 (identifier: P01266-2) [UniParc]FASTAAdd to basket
Also known as: Minor

The sequence of this isoform differs from the canonical sequence as follows:
     1510-1567: CVTDCQRNEAGLQCDQNGQYRASQKDRGSGKAFCVDGEGRRLPWWETEAPLEDSQCLM → L

Show »
Length:2,711
Mass (Da):298,383
Checksum:iEEC6895F22D55EE0
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YB42H0YB42_HUMAN
Thyroglobulin
TG
147Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YBJ2H0YBJ2_HUMAN
Thyroglobulin
TG
226Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RG33E5RG33_HUMAN
Thyroglobulin
TG
59Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YBY1H0YBY1_HUMAN
Thyroglobulin
TG
1,224Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7EVM0E7EVM0_HUMAN
Thyroglobulin
TG
901Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YBL4H0YBL4_HUMAN
Thyroglobulin
TG
194Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YBR7H0YBR7_HUMAN
Thyroglobulin
TG
172Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YBQ6H0YBQ6_HUMAN
Thyroglobulin
TG
74Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YBC5H0YBC5_HUMAN
Thyroglobulin
TG
62Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti23 – 25EYQ → GKF in CAA26527 (PubMed:2991855).Curated3
Sequence conflicti848Missing AA sequence (PubMed:8615697).Curated1
Sequence conflicti984 – 985EQ → DR in CAA29456 (PubMed:3681978).Curated2
Sequence conflicti1359 – 1360Missing AA sequence (PubMed:8615697).Curated2
Sequence conflicti1717L → A AA sequence (PubMed:8615697).Curated1
Sequence conflicti1776T → S AA sequence (PubMed:8615697).Curated1
Sequence conflicti2019G → H AA sequence (PubMed:8615697).Curated1
Sequence conflicti2287F → P AA sequence (PubMed:8615697).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_010212135Q → H1 PublicationCorresponds to variant dbSNP:rs2069546Ensembl.1
Natural variantiVAR_063034183C → Y in TDH3. 1 Publication1
Natural variantiVAR_016190515Q → E1 PublicationCorresponds to variant dbSNP:rs180222EnsemblClinVar.1
Natural variantiVAR_016852604S → D Requires 2 nucleotide substitutions. 3 PublicationsCorresponds to variant dbSNP:rs2069547Ensembl.1
Natural variantiVAR_016853653G → D3 PublicationsCorresponds to variant dbSNP:rs2069548Ensembl.1
Natural variantiVAR_010213734S → A Polymorphism associated with AITD3. 3 PublicationsCorresponds to variant dbSNP:rs180223EnsemblClinVar.1
Natural variantiVAR_049077777P → L. Corresponds to variant dbSNP:rs3739274EnsemblClinVar.1
Natural variantiVAR_049078815G → R. Corresponds to variant dbSNP:rs16904774EnsemblClinVar.1
Natural variantiVAR_010214830Q → E1 PublicationCorresponds to variant dbSNP:rs2076737Ensembl.1
Natural variantiVAR_002365870Q → H1 PublicationCorresponds to variant dbSNP:rs2229843EnsemblClinVar.1
Natural variantiVAR_016854985Missing 2 Publications1
Natural variantiVAR_049079988R → P. Corresponds to variant dbSNP:rs16893332EnsemblClinVar.1
Natural variantiVAR_0102151028M → V Polymorphism associated with AITD3. 2 PublicationsCorresponds to variant dbSNP:rs853326EnsemblClinVar.1
Natural variantiVAR_0168551043H → Y2 PublicationsCorresponds to variant dbSNP:rs143983705Ensembl.1
Natural variantiVAR_0168561059I → T2 PublicationsCorresponds to variant dbSNP:rs1016185504Ensembl.1
Natural variantiVAR_0490801063L → M. Corresponds to variant dbSNP:rs11992497EnsemblClinVar.1
Natural variantiVAR_0490811222S → L. Corresponds to variant dbSNP:rs12549018Ensembl.1
Natural variantiVAR_0102161264C → R in TDH3; autosomal recessive. 1 PublicationCorresponds to variant dbSNP:rs2076738Ensembl.1
Natural variantiVAR_0102171312D → G3 PublicationsCorresponds to variant dbSNP:rs2069556EnsemblClinVar.1
Natural variantiVAR_0168571437W → R2 PublicationsCorresponds to variant dbSNP:rs2069558Ensembl.1
Natural variantiVAR_0168581463P → H2 Publications1
Natural variantiVAR_0490821740T → K. Corresponds to variant dbSNP:rs16904791Ensembl.1
Natural variantiVAR_0102181838D → N1 PublicationCorresponds to variant dbSNP:rs2069561EnsemblClinVar.1
Natural variantiVAR_0630351897C → Y in TDH3. 1 PublicationCorresponds to variant dbSNP:rs121912649EnsemblClinVar.1
Natural variantiVAR_0168591936A → T2 PublicationsCorresponds to variant dbSNP:rs2069562Ensembl.1
Natural variantiVAR_0611731974M → T. Corresponds to variant dbSNP:rs56230101EnsemblClinVar.1
Natural variantiVAR_0320131979R → W Polymorphism associated with AITD3. 1 Publication1
Natural variantiVAR_0102191996C → S in TDH3; autosomal recessive. 1 PublicationCorresponds to variant dbSNP:rs2076739EnsemblClinVar.1
Natural variantiVAR_0102201999R → W1 PublicationCorresponds to variant dbSNP:rs2076740EnsemblClinVar.1
Natural variantiVAR_0168602091D → E2 Publications1
Natural variantiVAR_0168612149P → L3 PublicationsCorresponds to variant dbSNP:rs2069564Ensembl.1
Natural variantiVAR_0168622170Q → R3 PublicationsCorresponds to variant dbSNP:rs2069565Ensembl.1
Natural variantiVAR_0630362234A → D in TDH3; reduces thyroglobulin synthesis and secretion; promotes thyroglobulin retention within the endoplasmic reticulum. 2 PublicationsCorresponds to variant dbSNP:rs370991693Ensembl.1
Natural variantiVAR_0168632242R → H2 PublicationsCorresponds to variant dbSNP:rs2069566EnsemblClinVar.1
Natural variantiVAR_0783382336 – 2768Missing in TDH3; unknown pathological significance. 1 PublicationAdd BLAST433
Natural variantiVAR_0630372336R → Q in TDH3. 1 PublicationCorresponds to variant dbSNP:rs121912650EnsemblClinVar.1
Natural variantiVAR_0630382375G → R in TDH3. 1 PublicationCorresponds to variant dbSNP:rs137854434EnsemblClinVar.1
Natural variantiVAR_0490832455R → H. Corresponds to variant dbSNP:rs2272707Ensembl.1
Natural variantiVAR_0490842469L → P. Corresponds to variant dbSNP:rs2069568Ensembl.1
Natural variantiVAR_0102212501W → R1 PublicationCorresponds to variant dbSNP:rs2069569EnsemblClinVar.1
Natural variantiVAR_0490852526F → L. Corresponds to variant dbSNP:rs12114109EnsemblClinVar.1
Natural variantiVAR_0102222530R → Q1 PublicationCorresponds to variant dbSNP:rs1133076EnsemblClinVar.1
Natural variantiVAR_0490862616N → S. Corresponds to variant dbSNP:rs10091530EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0126551510 – 1567CVTDC…SQCLM → L in isoform 2. 1 PublicationAdd BLAST58

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X05615 mRNA Translation: CAA29104.1
U93033 mRNA Translation: AAC51924.1
AF230667 Genomic DNA No translation available.
AF235100 Genomic DNA No translation available.
AF230666 Genomic DNA No translation available.
AF305872 Genomic DNA No translation available.
X02154 mRNA Translation: CAA26089.1
X06059
, X06060, X06061, X06062, X06063, X06064, X06065, X06066 Genomic DNA Translation: CAA29454.1
X06067, X06068 Genomic DNA Translation: CAA29455.1
X06069, X06070 Genomic DNA Translation: CAA29456.1
X02749 Genomic DNA Translation: CAA26527.1
AH008122 Genomic DNA Translation: AAD51647.1
AH007064 Genomic DNA Translation: AAC95473.1
AF080484
, AF169654, AF169655, AF169656, AF169657, AF169658, AF169659, AF169661, AF169662, AF169663, AF169664, AF080472, AF080473, AF080474, AF080475, AF080476, AF080477, AF080478, AF080479, AF080480, AF080481, AF080482, AF080483 Genomic DNA Translation: AAD50912.2
S40807 mRNA Translation: AAB22685.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS34944.1 [P01266-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
A59110 UIHU

NCBI Reference Sequences

More...
RefSeqi
NP_003226.4, NM_003235.4 [P01266-1]
XP_016869284.1, XM_017013795.1 [P01266-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.654591

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000220616; ENSP00000220616; ENSG00000042832 [P01266-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
7038

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:7038

UCSC genome browser

More...
UCSCi
uc003ytw.4 human [P01266-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Wikipedia

Thyroglobulin entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X05615 mRNA Translation: CAA29104.1
U93033 mRNA Translation: AAC51924.1
AF230667 Genomic DNA No translation available.
AF235100 Genomic DNA No translation available.
AF230666 Genomic DNA No translation available.
AF305872 Genomic DNA No translation available.
X02154 mRNA Translation: CAA26089.1
X06059
, X06060, X06061, X06062, X06063, X06064, X06065, X06066 Genomic DNA Translation: CAA29454.1
X06067, X06068 Genomic DNA Translation: CAA29455.1
X06069, X06070 Genomic DNA Translation: CAA29456.1
X02749 Genomic DNA Translation: CAA26527.1
AH008122 Genomic DNA Translation: AAD51647.1
AH007064 Genomic DNA Translation: AAC95473.1
AF080484
, AF169654, AF169655, AF169656, AF169657, AF169658, AF169659, AF169661, AF169662, AF169663, AF169664, AF080472, AF080473, AF080474, AF080475, AF080476, AF080477, AF080478, AF080479, AF080480, AF080481, AF080482, AF080483 Genomic DNA Translation: AAD50912.2
S40807 mRNA Translation: AAB22685.1
CCDSiCCDS34944.1 [P01266-1]
PIRiA59110 UIHU
RefSeqiNP_003226.4, NM_003235.4 [P01266-1]
XP_016869284.1, XM_017013795.1 [P01266-2]
UniGeneiHs.654591

3D structure databases

ProteinModelPortaliP01266
SMRiP01266
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112896, 3 interactors
ELMiP01266
IntActiP01266, 2 interactors
STRINGi9606.ENSP00000220616

Protein family/group databases

ESTHERihuman-TG Thyroglobulin
MEROPSiI31.950

PTM databases

CarbonylDBiP01266
GlyConnecti600
iPTMnetiP01266
PhosphoSitePlusiP01266
UniCarbKBiP01266

Polymorphism and mutation databases

BioMutaiTG
DMDMi126302607

Proteomic databases

PaxDbiP01266
PeptideAtlasiP01266
PRIDEiP01266
ProteomicsDBi51364
51365 [P01266-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000220616; ENSP00000220616; ENSG00000042832 [P01266-1]
GeneIDi7038
KEGGihsa:7038
UCSCiuc003ytw.4 human [P01266-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
7038
DisGeNETi7038
EuPathDBiHostDB:ENSG00000042832.11

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TG

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0034371
HGNCiHGNC:11764 TG
HPAiCAB000077
CAB056155
HPA002740
MalaCardsiTG
MIMi188450 gene
274700 phenotype
608175 phenotype
neXtProtiNX_P01266
OpenTargetsiENSG00000042832
Orphaneti95716 Familial thyroid dyshormonogenesis
PharmGKBiPA36479

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IG6K Eukaryota
COG2272 LUCA
GeneTreeiENSGT00940000159300
HOVERGENiHBG017929
InParanoidiP01266
KOiK10809
OMAiLRSCWCV
OrthoDBiEOG091G004S
PhylomeDBiP01266
TreeFamiTF351833

Enzyme and pathway databases

BioCyciMetaCyc:ENSG00000042832-MONOMER
SIGNORiP01266

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
TG human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
Thyroglobulin

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
7038

Protein Ontology

More...
PROi
PR:P01266

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000042832 Expressed in 103 organ(s), highest expression level in thyroid gland
ExpressionAtlasiP01266 baseline and differential
GenevisibleiP01266 HS

Family and domain databases

CDDicd00191 TY, 7 hits
Gene3Di3.40.50.1820, 1 hit
4.10.800.10, 8 hits
InterProiView protein in InterPro
IPR029058 AB_hydrolase
IPR002018 CarbesteraseB
IPR019819 Carboxylesterase_B_CS
IPR016324 Thyroglobulin
IPR000716 Thyroglobulin_1
IPR036857 Thyroglobulin_1_sf
IPR011641 Tyr-kin_ephrin_A/B_rcpt-like
PfamiView protein in Pfam
PF00135 COesterase, 1 hit
PF07699 Ephrin_rec_like, 1 hit
PF00086 Thyroglobulin_1, 10 hits
PIRSFiPIRSF001831 Thyroglobulin, 1 hit
SMARTiView protein in SMART
SM01411 Ephrin_rec_like, 1 hit
SM00211 TY, 10 hits
SUPFAMiSSF53474 SSF53474, 1 hit
SSF57610 SSF57610, 11 hits
PROSITEiView protein in PROSITE
PS00941 CARBOXYLESTERASE_B_2, 1 hit
PS00484 THYROGLOBULIN_1_1, 9 hits
PS51162 THYROGLOBULIN_1_2, 11 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTHYG_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P01266
Secondary accession number(s): O15274
, O43899, Q15593, Q15948, Q9NYR1, Q9NYR2, Q9UMZ0, Q9UNY3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 21, 1986
Last sequence update: February 20, 2007
Last modified: December 5, 2018
This is version 206 of the entry and version 5 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. UniProtKB entry view manual
    User manual for the UniProtKB entry view
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again