Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P01222 (TSHB_HUMAN)

Entry version 179 (02 Dec 2020)
Sequence version 2 (02 Nov 2010)
Previous versions | rss
Add a publicationFeedback
Protein

Thyrotropin subunit beta

Gene

TSHB

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Indispensable for the control of thyroid structure and metabolism.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • hormone activity Source: ProtInc
Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHormone

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		P01222

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-209822, Glycoprotein hormones
R-HSA-209968, Thyroxine biosynthesis
R-HSA-375281, Hormone ligand-binding receptors
R-HSA-418555, G alpha (s) signalling events
R-HSA-9660821, ADORA2B mediated anti-inflammatory cytokines production

SIGNOR Signaling Network Open Resource

More...SIGNORi		P01222

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Thyrotropin subunit beta
Alternative name(s):
Thyroid-stimulating hormone subunit beta
Short name:
TSH-B
Short name:
TSH-beta
Thyrotropin beta chain
INN: Thyrotropin alfa
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TSHB
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen and Host Database Resources

More...EuPathDBi		HostDB:ENSG00000134200.3

Human Gene Nomenclature Database

More...HGNCi		HGNC:12372, TSHB

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		188540, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P01222

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the use of a protein as a pharmaceutical drug. It indicates the name of the drug, the name of the firm that commercializes it and explains in a few words in which context the drug is used. In some cases, drugs that are under development are also described.<p><a href='/help/pharmaceutical_use' target='_top'>More...</a></p>Pharmaceutical usei

Available under the name Thyrogen (Genzyme). Used in combination with other tests to detect recurring or leftover thyroid cancer cells in patients with a history of certain types of thyroid cancer.

Organism-specific databases

DisGeNET

More...DisGeNETi		7252

MalaCards human disease database

More...MalaCardsi		TSHB
MIMi275100, phenotype

Open Targets

More...OpenTargetsi		ENSG00000134200

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		90674, Isolated thyroid-stimulating hormone deficiency

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA37041

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P01222, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		TSHB

Domain mapping of disease mutations (DMDM)

More...DMDMi		311033515

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 201 PublicationAdd BLAST20
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001174621 – 132Thyrotropin subunit betaAdd BLAST112
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes a propeptide, which is a part of a protein that is cleaved during maturation or activation. Once cleaved, a propeptide generally has no independent biological function.<p><a href='/help/propep' target='_top'>More...</a></p>PropeptideiPRO_0000011747133 – 1386

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi22 ↔ 72By similarity
Disulfide bondi36 ↔ 87By similarity
Disulfide bondi39 ↔ 125By similarity
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi43N-linked (GlcNAc...) asparagine1
Disulfide bondi47 ↔ 103By similarity
Disulfide bondi51 ↔ 105By similarity
Disulfide bondi108 ↔ 115By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

The CPTAC Assay portal

More...CPTACi		CPTAC-691
CPTAC-729

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P01222

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P01222

PeptideAtlas

More...PeptideAtlasi		P01222

PRoteomics IDEntifications database

More...PRIDEi		P01222

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		51347 [P01222-1]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		P01222, 1 site, 7 N-linked glycans (1 site)

UniCarbKB; an annotated and curated database of glycan structures

More...UniCarbKBi		P01222

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000134200, Expressed in pituitary gland and 99 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P01222, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000134200, Tissue enriched (pituitary)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterodimer of a common alpha chain and a unique beta chain which confers biological specificity to thyrotropin, lutropin, follitropin and gonadotropin.

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		113103, 15 interactors

Protein interaction database and analysis system

More...IntActi		P01222, 16 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000256592

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P01222, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P01222

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the glycoprotein hormones subunit beta family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502S2JW, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000158152

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_126319_0_2_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P01222

Identification of Orthologs from Complete Genome Data

More...OMAi		HVTPYFS

Database of Orthologous Groups

More...OrthoDBi		1362225at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P01222

TreeFam database of animal gene trees

More...TreeFami		TF332940

Family and domain databases

Conserved Domains Database

More...CDDi		cd00069, GHB_like, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.10.90.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR029034, Cystine-knot_cytokine
IPR006208, Glyco_hormone_CN
IPR001545, Gonadotropin_bsu
IPR018245, Gonadotropin_bsu_CS

The PANTHER Classification System

More...PANTHERi		PTHR11515, PTHR11515, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00007, Cys_knot, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00068, GHB, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF57501, SSF57501, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00261, GLYCO_HORMONE_BETA_1, 1 hit
PS00689, GLYCO_HORMONE_BETA_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: P01222-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTALFLMSML FGLTCGQAMS FCIPTEYTMH IERRECAYCL TINTTICAGY 
        60         70         80         90        100
CMTRDINGKL FLPKYALSQD VCTYRDFIYR TVEIPGCPLH VAPYFSYPVA 
       110        120        130 
LSCKCGKCNT DYSDCIHEAI KTNYCTKPQK SYLVGFSV
Length:138
Mass (Da):15,639
Last modified:November 2, 2010 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i6A367538D8393DB7
GO
Isoform 2 (identifier: P01222-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-54: MTALFLMSMLFGLTCGQAMSFCIPTEYTMHIERRECAYCLTINTTICAGYCMTR → MLSFLFFPQ

Note: Major isoform in peripheral blood leukocytes and thyroid, may form heterodimers with isoform 1.Curated
Show »
Length:93
Mass (Da):10,624
Checksum:iE1989F2A0A00126E
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti46I → M in AAB30828 (PubMed:8196184).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_05476914T → A6 PublicationsCorresponds to variant dbSNP:rs10776792EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0533871 – 54MTALF…YCMTR → MLSFLFFPQ in isoform 2. 1 PublicationAdd BLAST54

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
X02866 Genomic DNA Translation: CAA26618.1
X02867 Genomic DNA Translation: CAA26619.1
M23671, M23670 Genomic DNA Translation: AAB05845.1
M25164 Genomic DNA Translation: AAA61235.1
M21024 Genomic DNA Translation: AAA36782.1
S70587 Genomic DNA Translation: AAB30828.2
AL109660 Genomic DNA No translation available.
BC069298 mRNA Translation: AAH69298.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS880.1 [P01222-1]

Protein sequence database of the Protein Information Resource

More...PIRi		A23997, TTHUB

NCBI Reference Sequences

More...RefSeqi		NP_000540.2, NM_000549.4 [P01222-1]
NP_001264920.1, NM_001277991.1 [P01222-2]
XP_011540367.1, XM_011542065.2 [P01222-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000256592; ENSP00000256592; ENSG00000134200 [P01222-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		7252

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:7252

UCSC genome browser

More...UCSCi		uc001efs.2, human [P01222-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Wikipedia

Thyroid-stimulating hormone entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X02866 Genomic DNA Translation: CAA26618.1
X02867 Genomic DNA Translation: CAA26619.1
M23671, M23670 Genomic DNA Translation: AAB05845.1
M25164 Genomic DNA Translation: AAA61235.1
M21024 Genomic DNA Translation: AAA36782.1
S70587 Genomic DNA Translation: AAB30828.2
AL109660 Genomic DNA No translation available.
BC069298 mRNA Translation: AAH69298.1
CCDSiCCDS880.1 [P01222-1]
PIRiA23997, TTHUB
RefSeqiNP_000540.2, NM_000549.4 [P01222-1]
NP_001264920.1, NM_001277991.1 [P01222-2]
XP_011540367.1, XM_011542065.2 [P01222-1]

3D structure databases

SMRiP01222
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi113103, 15 interactors
IntActiP01222, 16 interactors
STRINGi9606.ENSP00000256592

PTM databases

GlyGeniP01222, 1 site, 7 N-linked glycans (1 site)
UniCarbKBiP01222

Polymorphism and mutation databases

BioMutaiTSHB
DMDMi311033515

Proteomic databases

CPTACiCPTAC-691
CPTAC-729
MassIVEiP01222
PaxDbiP01222
PeptideAtlasiP01222
PRIDEiP01222
ProteomicsDBi51347 [P01222-1]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		20170, 1011 antibodies

The CPTC Antibody Portal

More...CPTCi		P01222, 2 antibodies

The DNASU plasmid repository

More...DNASUi		7252

Genome annotation databases

EnsembliENST00000256592; ENSP00000256592; ENSG00000134200 [P01222-1]
GeneIDi7252
KEGGihsa:7252
UCSCiuc001efs.2, human [P01222-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		7252
DisGeNETi7252
EuPathDBiHostDB:ENSG00000134200.3

GeneCards: human genes, protein and diseases

More...GeneCardsi		TSHB
HGNCiHGNC:12372, TSHB
HPAiENSG00000134200, Tissue enriched (pituitary)
MalaCardsiTSHB
MIMi188540, gene
275100, phenotype
neXtProtiNX_P01222
OpenTargetsiENSG00000134200
Orphaneti90674, Isolated thyroid-stimulating hormone deficiency
PharmGKBiPA37041

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG502S2JW, Eukaryota
GeneTreeiENSGT00940000158152
HOGENOMiCLU_126319_0_2_1
InParanoidiP01222
OMAiHVTPYFS
OrthoDBi1362225at2759
PhylomeDBiP01222
TreeFamiTF332940

Enzyme and pathway databases

PathwayCommonsiP01222
ReactomeiR-HSA-209822, Glycoprotein hormones
R-HSA-209968, Thyroxine biosynthesis
R-HSA-375281, Hormone ligand-binding receptors
R-HSA-418555, G alpha (s) signalling events
R-HSA-9660821, ADORA2B mediated anti-inflammatory cytokines production
SIGNORiP01222

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		7252, 19 hits in 818 CRISPR screens

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		TSHB

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		7252
PharosiP01222, Tbio

Protein Ontology

More...PROi		PR:P01222
RNActiP01222, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000134200, Expressed in pituitary gland and 99 other tissues
GenevisibleiP01222, HS

Family and domain databases

CDDicd00069, GHB_like, 1 hit
Gene3Di2.10.90.10, 1 hit
InterProiView protein in InterPro
IPR029034, Cystine-knot_cytokine
IPR006208, Glyco_hormone_CN
IPR001545, Gonadotropin_bsu
IPR018245, Gonadotropin_bsu_CS
PANTHERiPTHR11515, PTHR11515, 1 hit
PfamiView protein in Pfam
PF00007, Cys_knot, 1 hit
SMARTiView protein in SMART
SM00068, GHB, 1 hit
SUPFAMiSSF57501, SSF57501, 1 hit
PROSITEiView protein in PROSITE
PS00261, GLYCO_HORMONE_BETA_1, 1 hit
PS00689, GLYCO_HORMONE_BETA_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTSHB_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P01222
Secondary accession number(s): B1AKP0, Q16163
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 21, 1986
Last sequence update: November 2, 2010
Last modified: December 2, 2020
This is version 179 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Direct protein sequencing, Pharmaceutical, Reference proteome

Documents

  1. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again