UniProtKB - P01222 (TSHB_HUMAN)
Thyrotropin subunit beta
TSHB
Functioni
GO - Molecular functioni
- hormone activity Source: ProtInc
GO - Biological processi
- anatomical structure morphogenesis Source: ProtInc
- cell-cell signaling Source: ProtInc
- G protein-coupled receptor signaling pathway Source: GO_Central
- hormone-mediated signaling pathway Source: GO_Central
- peptide hormone processing Source: Reactome
- response to calcium ion Source: Ensembl
- response to estrogen Source: Ensembl
- response to vitamin A Source: Ensembl
Keywordsi
Molecular function | Hormone |
Enzyme and pathway databases
PathwayCommonsi | P01222 |
Reactomei | R-HSA-209822, Glycoprotein hormones R-HSA-209968, Thyroxine biosynthesis R-HSA-375281, Hormone ligand-binding receptors R-HSA-418555, G alpha (s) signalling events R-HSA-9660821, ADORA2B mediated anti-inflammatory cytokines production |
SIGNORi | P01222 |
Names & Taxonomyi
Protein namesi | Recommended name: Thyrotropin subunit betaAlternative name(s): Thyroid-stimulating hormone subunit beta Short name: TSH-B Short name: TSH-beta Thyrotropin beta chain INN: Thyrotropin alfa |
Gene namesi | Name:TSHB |
Organismi | Homo sapiens (Human) |
Taxonomic identifieri | 9606 [NCBI] |
Taxonomic lineagei | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Proteomesi |
|
Organism-specific databases
EuPathDBi | HostDB:ENSG00000134200.3 |
HGNCi | HGNC:12372, TSHB |
MIMi | 188540, gene |
neXtProti | NX_P01222 |
Subcellular locationi
Extracellular region or secreted
Extracellular region or secreted
- extracellular region Source: Reactome
- extracellular space Source: GO_Central
Other locations
- cytoplasm Source: GO_Central
Keywords - Cellular componenti
SecretedPathology & Biotechi
Pharmaceutical usei
Organism-specific databases
DisGeNETi | 7252 |
MalaCardsi | TSHB |
MIMi | 275100, phenotype |
OpenTargetsi | ENSG00000134200 |
Orphaneti | 90674, Isolated thyroid-stimulating hormone deficiency |
PharmGKBi | PA37041 |
Miscellaneous databases
Pharosi | P01222, Tbio |
Polymorphism and mutation databases
BioMutai | TSHB |
DMDMi | 311033515 |
PTM / Processingi
Molecule processing
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
Signal peptidei | 1 – 20 | 1 PublicationAdd BLAST | 20 | |
ChainiPRO_0000011746 | 21 – 132 | Thyrotropin subunit betaAdd BLAST | 112 | |
PropeptideiPRO_0000011747 | 133 – 138 | 6 |
Amino acid modifications
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
Disulfide bondi | 22 ↔ 72 | By similarity | ||
Disulfide bondi | 36 ↔ 87 | By similarity | ||
Disulfide bondi | 39 ↔ 125 | By similarity | ||
Glycosylationi | 43 | N-linked (GlcNAc...) asparagine | 1 | |
Disulfide bondi | 47 ↔ 103 | By similarity | ||
Disulfide bondi | 51 ↔ 105 | By similarity | ||
Disulfide bondi | 108 ↔ 115 | By similarity |
Keywords - PTMi
Disulfide bond, GlycoproteinProteomic databases
CPTACi | CPTAC-691 CPTAC-729 |
MassIVEi | P01222 |
PaxDbi | P01222 |
PeptideAtlasi | P01222 |
PRIDEi | P01222 |
ProteomicsDBi | 51347 [P01222-1] |
PTM databases
GlyGeni | P01222, 1 site, 7 N-linked glycans (1 site) |
UniCarbKBi | P01222 |
Expressioni
Gene expression databases
Bgeei | ENSG00000134200, Expressed in pituitary gland and 99 other tissues |
Genevisiblei | P01222, HS |
Organism-specific databases
HPAi | ENSG00000134200, Tissue enriched (pituitary) |
Interactioni
Subunit structurei
Heterodimer of a common alpha chain and a unique beta chain which confers biological specificity to thyrotropin, lutropin, follitropin and gonadotropin.
GO - Molecular functioni
- hormone activity Source: ProtInc
Protein-protein interaction databases
BioGRIDi | 113103, 15 interactors |
IntActi | P01222, 16 interactors |
STRINGi | 9606.ENSP00000256592 |
Miscellaneous databases
RNActi | P01222, protein |
Family & Domainsi
Sequence similaritiesi
Keywords - Domaini
SignalPhylogenomic databases
eggNOGi | ENOG502S2JW, Eukaryota |
GeneTreei | ENSGT00940000158152 |
HOGENOMi | CLU_126319_0_2_1 |
InParanoidi | P01222 |
OMAi | HVTPYFS |
OrthoDBi | 1362225at2759 |
PhylomeDBi | P01222 |
TreeFami | TF332940 |
Family and domain databases
CDDi | cd00069, GHB_like, 1 hit |
Gene3Di | 2.10.90.10, 1 hit |
InterProi | View protein in InterPro IPR029034, Cystine-knot_cytokine IPR006208, Glyco_hormone_CN IPR001545, Gonadotropin_bsu IPR018245, Gonadotropin_bsu_CS |
PANTHERi | PTHR11515, PTHR11515, 1 hit |
Pfami | View protein in Pfam PF00007, Cys_knot, 1 hit |
SMARTi | View protein in SMART SM00068, GHB, 1 hit |
SUPFAMi | SSF57501, SSF57501, 1 hit |
PROSITEi | View protein in PROSITE PS00261, GLYCO_HORMONE_BETA_1, 1 hit PS00689, GLYCO_HORMONE_BETA_2, 1 hit |
s (2)i Sequence
Sequence statusi: Complete.
: The displayed sequence is further processed into a mature form. Sequence processingi
This entry describes 2 produced by isoformsialternative splicing. AlignAdd to basketThis isoform has been chosen as the sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. canonicali
10 20 30 40 50
MTALFLMSML FGLTCGQAMS FCIPTEYTMH IERRECAYCL TINTTICAGY
60 70 80 90 100
CMTRDINGKL FLPKYALSQD VCTYRDFIYR TVEIPGCPLH VAPYFSYPVA
110 120 130
LSCKCGKCNT DYSDCIHEAI KTNYCTKPQK SYLVGFSV
The sequence of this isoform differs from the canonical sequence as follows:
1-54: MTALFLMSMLFGLTCGQAMSFCIPTEYTMHIERRECAYCLTINTTICAGYCMTR → MLSFLFFPQ
Experimental Info
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
Sequence conflicti | 46 | I → M in AAB30828 (PubMed:8196184).Curated | 1 |
Natural variant
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
Natural variantiVAR_054769 | 14 | T → A6 PublicationsCorresponds to variant dbSNP:rs10776792EnsemblClinVar. | 1 |
Alternative sequence
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
Alternative sequenceiVSP_053387 | 1 – 54 | MTALF…YCMTR → MLSFLFFPQ in isoform 2. 1 PublicationAdd BLAST | 54 |
Sequence databases
Select the link destinations: EMBLi GenBanki DDBJi Links Updated | X02866 Genomic DNA Translation: CAA26618.1 X02867 Genomic DNA Translation: CAA26619.1 M23671, M23670 Genomic DNA Translation: AAB05845.1 M25164 Genomic DNA Translation: AAA61235.1 M21024 Genomic DNA Translation: AAA36782.1 S70587 Genomic DNA Translation: AAB30828.2 AL109660 Genomic DNA No translation available. BC069298 mRNA Translation: AAH69298.1 |
CCDSi | CCDS880.1 [P01222-1] |
PIRi | A23997, TTHUB |
RefSeqi | NP_000540.2, NM_000549.4 [P01222-1] NP_001264920.1, NM_001277991.1 [P01222-2] XP_011540367.1, XM_011542065.2 [P01222-1] |
Genome annotation databases
Ensembli | ENST00000256592; ENSP00000256592; ENSG00000134200 [P01222-1] |
GeneIDi | 7252 |
KEGGi | hsa:7252 |
UCSCi | uc001efs.2, human [P01222-1] |
Keywords - Coding sequence diversityi
Alternative splicing, PolymorphismSimilar proteinsi
Cross-referencesi
Web resourcesi
Wikipedia Thyroid-stimulating hormone entry |
Sequence databases
Select the link destinations: EMBLi GenBanki DDBJi Links Updated | X02866 Genomic DNA Translation: CAA26618.1 X02867 Genomic DNA Translation: CAA26619.1 M23671, M23670 Genomic DNA Translation: AAB05845.1 M25164 Genomic DNA Translation: AAA61235.1 M21024 Genomic DNA Translation: AAA36782.1 S70587 Genomic DNA Translation: AAB30828.2 AL109660 Genomic DNA No translation available. BC069298 mRNA Translation: AAH69298.1 |
CCDSi | CCDS880.1 [P01222-1] |
PIRi | A23997, TTHUB |
RefSeqi | NP_000540.2, NM_000549.4 [P01222-1] NP_001264920.1, NM_001277991.1 [P01222-2] XP_011540367.1, XM_011542065.2 [P01222-1] |
3D structure databases
SMRi | P01222 |
ModBasei | Search... |
Protein-protein interaction databases
BioGRIDi | 113103, 15 interactors |
IntActi | P01222, 16 interactors |
STRINGi | 9606.ENSP00000256592 |
PTM databases
GlyGeni | P01222, 1 site, 7 N-linked glycans (1 site) |
UniCarbKBi | P01222 |
Polymorphism and mutation databases
BioMutai | TSHB |
DMDMi | 311033515 |
Proteomic databases
CPTACi | CPTAC-691 CPTAC-729 |
MassIVEi | P01222 |
PaxDbi | P01222 |
PeptideAtlasi | P01222 |
PRIDEi | P01222 |
ProteomicsDBi | 51347 [P01222-1] |
Protocols and materials databases
Antibodypediai | 20170, 1011 antibodies |
CPTCi | P01222, 2 antibodies |
DNASUi | 7252 |
Genome annotation databases
Ensembli | ENST00000256592; ENSP00000256592; ENSG00000134200 [P01222-1] |
GeneIDi | 7252 |
KEGGi | hsa:7252 |
UCSCi | uc001efs.2, human [P01222-1] |
Organism-specific databases
CTDi | 7252 |
DisGeNETi | 7252 |
EuPathDBi | HostDB:ENSG00000134200.3 |
GeneCardsi | TSHB |
HGNCi | HGNC:12372, TSHB |
HPAi | ENSG00000134200, Tissue enriched (pituitary) |
MalaCardsi | TSHB |
MIMi | 188540, gene 275100, phenotype |
neXtProti | NX_P01222 |
OpenTargetsi | ENSG00000134200 |
Orphaneti | 90674, Isolated thyroid-stimulating hormone deficiency |
PharmGKBi | PA37041 |
GenAtlasi | Search... |
Phylogenomic databases
eggNOGi | ENOG502S2JW, Eukaryota |
GeneTreei | ENSGT00940000158152 |
HOGENOMi | CLU_126319_0_2_1 |
InParanoidi | P01222 |
OMAi | HVTPYFS |
OrthoDBi | 1362225at2759 |
PhylomeDBi | P01222 |
TreeFami | TF332940 |
Enzyme and pathway databases
PathwayCommonsi | P01222 |
Reactomei | R-HSA-209822, Glycoprotein hormones R-HSA-209968, Thyroxine biosynthesis R-HSA-375281, Hormone ligand-binding receptors R-HSA-418555, G alpha (s) signalling events R-HSA-9660821, ADORA2B mediated anti-inflammatory cytokines production |
SIGNORi | P01222 |
Miscellaneous databases
BioGRID-ORCSi | 7252, 19 hits in 818 CRISPR screens |
GeneWikii | TSHB |
GenomeRNAii | 7252 |
Pharosi | P01222, Tbio |
PROi | PR:P01222 |
RNActi | P01222, protein |
SOURCEi | Search... |
Gene expression databases
Bgeei | ENSG00000134200, Expressed in pituitary gland and 99 other tissues |
Genevisiblei | P01222, HS |
Family and domain databases
CDDi | cd00069, GHB_like, 1 hit |
Gene3Di | 2.10.90.10, 1 hit |
InterProi | View protein in InterPro IPR029034, Cystine-knot_cytokine IPR006208, Glyco_hormone_CN IPR001545, Gonadotropin_bsu IPR018245, Gonadotropin_bsu_CS |
PANTHERi | PTHR11515, PTHR11515, 1 hit |
Pfami | View protein in Pfam PF00007, Cys_knot, 1 hit |
SMARTi | View protein in SMART SM00068, GHB, 1 hit |
SUPFAMi | SSF57501, SSF57501, 1 hit |
PROSITEi | View protein in PROSITE PS00261, GLYCO_HORMONE_BETA_1, 1 hit PS00689, GLYCO_HORMONE_BETA_2, 1 hit |
ProtoNeti | Search... |
MobiDBi | Search... |
Entry informationi
Entry namei | TSHB_HUMAN | |
Accessioni | P01222Primary (citable) accession number: P01222 Secondary accession number(s): B1AKP0, Q16163 | |
Entry historyi | Integrated into UniProtKB/Swiss-Prot: | July 21, 1986 |
Last sequence update: | November 2, 2010 | |
Last modified: | December 2, 2020 | |
This is version 179 of the entry and version 2 of the sequence. See complete history. | ||
Entry statusi | Reviewed (UniProtKB/Swiss-Prot) | |
Annotation program | Chordata Protein Annotation Program | |
Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. |
Miscellaneousi
Keywords - Technical termi
Direct protein sequencing, Pharmaceutical, Reference proteomeDocuments
- Human polymorphisms and disease mutations
Index of human polymorphisms and disease mutations - MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot - SIMILARITY comments
Index of protein domains and families - Human chromosome 1
Human chromosome 1: entries, gene names and cross-references to MIM - Human entries with polymorphisms or disease mutations
List of human entries with polymorphisms or disease mutations