Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Thyrotropin subunit beta

Gene

TSHB

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Indispensable for the control of thyroid structure and metabolism.

GO - Molecular functioni

  • hormone activity Source: ProtInc

GO - Biological processi

Keywordsi

Molecular functionHormone

Enzyme and pathway databases

ReactomeiR-HSA-209822 Glycoprotein hormones
R-HSA-209968 Thyroxine biosynthesis
R-HSA-375281 Hormone ligand-binding receptors
R-HSA-418555 G alpha (s) signalling events
SIGNORiP01222

Names & Taxonomyi

Protein namesi
Recommended name:
Thyrotropin subunit beta
Alternative name(s):
Thyroid-stimulating hormone subunit beta
Short name:
TSH-B
Short name:
TSH-beta
Thyrotropin beta chain
INN: Thyrotropin alfa
Gene namesi
Name:TSHB
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000134200.3
HGNCiHGNC:12372 TSHB
MIMi188540 gene
neXtProtiNX_P01222

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Pharmaceutical usei

Available under the name Thyrogen (Genzyme). Used in combination with other tests to detect recurring or leftover thyroid cancer cells in patients with a history of certain types of thyroid cancer.

Organism-specific databases

DisGeNETi7252
MalaCardsiTSHB
MIMi275100 phenotype
OpenTargetsiENSG00000134200
Orphaneti90674 Isolated thyroid-stimulating hormone deficiency
PharmGKBiPA37041

Polymorphism and mutation databases

DMDMi311033515

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 201 PublicationAdd BLAST20
ChainiPRO_000001174621 – 132Thyrotropin subunit betaAdd BLAST112
PropeptideiPRO_0000011747133 – 1386

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi22 ↔ 72By similarity
Disulfide bondi36 ↔ 87By similarity
Disulfide bondi39 ↔ 125By similarity
Glycosylationi43N-linked (GlcNAc...) asparagine1
Disulfide bondi47 ↔ 103By similarity
Disulfide bondi51 ↔ 105By similarity
Disulfide bondi108 ↔ 115By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiP01222
PeptideAtlasiP01222
PRIDEiP01222
ProteomicsDBi51347

PTM databases

UniCarbKBiP01222

Expressioni

Gene expression databases

BgeeiENSG00000134200
CleanExiHS_TSHB
GenevisibleiP01222 HS

Organism-specific databases

HPAiCAB022202
HPA042681

Interactioni

Subunit structurei

Heterodimer of a common alpha chain and a unique beta chain which confers biological specificity to thyrotropin, lutropin, follitropin and gonadotropin.

GO - Molecular functioni

  • hormone activity Source: ProtInc

Protein-protein interaction databases

BioGridi113103, 15 interactors
IntActiP01222, 1 interactor
STRINGi9606.ENSP00000256592

Structurei

3D structure databases

ProteinModelPortaliP01222
SMRiP01222
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiENOG410IXJG Eukaryota
ENOG410YSY0 LUCA
GeneTreeiENSGT00390000010115
HOGENOMiHOG000116098
HOVERGENiHBG006698
InParanoidiP01222
KOiK05251
OMAiTNYCTKP
OrthoDBiEOG091G0XFH
PhylomeDBiP01222
TreeFamiTF332940

Family and domain databases

CDDicd00069 GHB_like, 1 hit
Gene3Di2.10.90.10, 1 hit
InterProiView protein in InterPro
IPR029034 Cystine-knot_cytokine
IPR006208 Glyco_hormone_CN
IPR001545 Gonadotropin_bsu
IPR018245 Gonadotropin_bsu_CS
PANTHERiPTHR11515 PTHR11515, 1 hit
PfamiView protein in Pfam
PF00007 Cys_knot, 1 hit
SMARTiView protein in SMART
SM00068 GHB, 1 hit
SUPFAMiSSF57501 SSF57501, 1 hit
PROSITEiView protein in PROSITE
PS00261 GLYCO_HORMONE_BETA_1, 1 hit
PS00689 GLYCO_HORMONE_BETA_2, 1 hit

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P01222-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTALFLMSML FGLTCGQAMS FCIPTEYTMH IERRECAYCL TINTTICAGY
60 70 80 90 100
CMTRDINGKL FLPKYALSQD VCTYRDFIYR TVEIPGCPLH VAPYFSYPVA
110 120 130
LSCKCGKCNT DYSDCIHEAI KTNYCTKPQK SYLVGFSV
Length:138
Mass (Da):15,639
Last modified:November 2, 2010 - v2
Checksum:i6A367538D8393DB7
GO
Isoform 2 (identifier: P01222-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-54: MTALFLMSMLFGLTCGQAMSFCIPTEYTMHIERRECAYCLTINTTICAGYCMTR → MLSFLFFPQ

Note: Major isoform in peripheral blood leukocytes and thyroid, may form heterodimers with isoform 1.
Show »
Length:93
Mass (Da):10,624
Checksum:iE1989F2A0A00126E
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti46I → M in AAB30828 (PubMed:8196184).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05476914T → A6 PublicationsCorresponds to variant dbSNP:rs10776792EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0533871 – 54MTALF…YCMTR → MLSFLFFPQ in isoform 2. 1 PublicationAdd BLAST54

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X02866 Genomic DNA Translation: CAA26618.1
X02867 Genomic DNA Translation: CAA26619.1
M23671, M23670 Genomic DNA Translation: AAB05845.1
M25164 Genomic DNA Translation: AAA61235.1
M21024 Genomic DNA Translation: AAA36782.1
S70587 Genomic DNA Translation: AAB30828.2
AL109660 Genomic DNA No translation available.
BC069298 mRNA Translation: AAH69298.1
CCDSiCCDS880.1 [P01222-1]
PIRiA23997 TTHUB
RefSeqiNP_000540.2, NM_000549.4 [P01222-1]
NP_001264920.1, NM_001277991.1 [P01222-2]
XP_011540367.1, XM_011542065.2 [P01222-1]
UniGeneiHs.406687

Genome annotation databases

EnsembliENST00000256592; ENSP00000256592; ENSG00000134200 [P01222-1]
ENST00000369517; ENSP00000358530; ENSG00000134200 [P01222-1]
GeneIDi7252
KEGGihsa:7252
UCSCiuc001efs.2 human [P01222-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiTSHB_HUMAN
AccessioniPrimary (citable) accession number: P01222
Secondary accession number(s): B1AKP0, Q16163
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 21, 1986
Last sequence update: November 2, 2010
Last modified: June 20, 2018
This is version 163 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Pharmaceutical, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health