TSHB

Functionⁱ

Indispensable for the control of thyroid structure and metabolism.

GO - Molecular functionⁱ

hormone activity
Source: ProtInc
Traceable author statementⁱ
- 2792087

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

anatomical structure morphogenesis
Source: ProtInc
Traceable author statementⁱ
- 2792087
cell-cell signaling
Source: ProtInc
Traceable author statementⁱ
- 2792087
G protein-coupled receptor signaling pathway Source: Reactome
hormone-mediated signaling pathway
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
peptide hormone processing Source: Reactome
response to calcium ion Source: Ensembl
response to estrogen Source: Ensembl
response to vitamin A Source: Ensembl

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Hormone

Molecular function

Hormone

Enzyme and pathway databases

Reactomeⁱ	R-HSA-209822 Glycoprotein hormones R-HSA-209968 Thyroxine biosynthesis R-HSA-375281 Hormone ligand-binding receptors R-HSA-418555 G alpha (s) signalling events
SIGNORⁱ	P01222

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Thyrotropin subunit beta Alternative name(s): Thyroid-stimulating hormone subunit beta Short name: TSH-B Short name: TSH-beta Thyrotropin beta chain INN: Thyrotropin alfa
Gene namesⁱ	Name:TSHB
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 1

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000134200.3
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:12372 TSHB
MIMⁱ	188540 gene
neXtProtⁱ	NX_P01222

Keywords - Cellular componentⁱ

Secreted

Pathology & Biotechⁱ

Pharmaceutical useⁱ

Available under the name Thyrogen (Genzyme). Used in combination with other tests to detect recurring or leftover thyroid cancer cells in patients with a history of certain types of thyroid cancer.

Organism-specific databases

DisGeNET More...DisGeNETⁱ	7252
MalaCards human disease database More...MalaCardsⁱ	TSHB
MIMⁱ	275100 phenotype
Open Targets More...OpenTargetsⁱ	ENSG00000134200
Orphanetⁱ	90674 Isolated thyroid-stimulating hormone deficiency
PharmGKBⁱ	PA37041

Polymorphism and mutation databases

DMDMⁱ	311033515

DMDMⁱ

311033515

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Length
Signal peptideⁱ	1 – 20	1 PublicationAdd BLAST	20
ChainⁱPRO_0000011746	21 – 132	Thyrotropin subunit betaAdd BLAST	112
PropeptideⁱPRO_0000011747	133 – 138		6

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Length
Disulfide bondⁱ	22 ↔ 72	By similarity
Disulfide bondⁱ	36 ↔ 87	By similarity
Disulfide bondⁱ	39 ↔ 125	By similarity
Glycosylationⁱ	43	N-linked (GlcNAc...) asparagine	1
Disulfide bondⁱ	47 ↔ 103	By similarity
Disulfide bondⁱ	51 ↔ 105	By similarity
Disulfide bondⁱ	108 ↔ 115	By similarity

Keywords - PTMⁱ

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbⁱ	P01222
PeptideAtlas More...PeptideAtlasⁱ	P01222
PRIDEⁱ	P01222
ProteomicsDBⁱ	51347

PTM databases

UniCarbKBⁱ	P01222

UniCarbKBⁱ

P01222

Expressionⁱ

Gene expression databases

Bgeeⁱ	ENSG00000134200 Expressed in 79 organ(s), highest expression level in pituitary gland
CleanExⁱ	HS_TSHB
Genevisibleⁱ	P01222 HS

Organism-specific databases

Human Protein Atlas More...HPAⁱ	CAB022202 HPA042681

HPAⁱ

CAB022202
HPA042681

Interactionⁱ

Subunit structureⁱ

Heterodimer of a common alpha chain and a unique beta chain which confers biological specificity to thyrotropin, lutropin, follitropin and gonadotropin.

GO - Molecular functionⁱ

hormone activity
Source: ProtInc
Traceable author statementⁱ
- 2792087

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

BioGridⁱ	113103, 15 interactors
IntActⁱ	P01222, 1 interactor
STRINGⁱ	9606.ENSP00000256592

Structureⁱ

3D structure databases

ProteinModelPortalⁱ	P01222
SMRⁱ	P01222
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Family & Domainsⁱ

Sequence similaritiesⁱ

Belongs to the glycoprotein hormones subunit beta family.Curated

Keywords - Domainⁱ

Signal

Phylogenomic databases

eggNOGⁱ	ENOG410IXJG Eukaryota ENOG410YSY0 LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00390000010115
HOGENOMⁱ	HOG000116098
HOVERGENⁱ	HBG006698
InParanoidⁱ	P01222
KEGG Orthology (KO) More...KOⁱ	K05251
OMAⁱ	DVCTYRD
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G0XFH
PhylomeDBⁱ	P01222
TreeFamⁱ	TF332940

Family and domain databases

Conserved Domains Database More...CDDⁱ	cd00069 GHB_like, 1 hit
Gene3Dⁱ	2.10.90.10, 1 hit
InterProⁱ	View protein in InterPro IPR029034 Cystine-knot_cytokine IPR006208 Glyco_hormone_CN IPR001545 Gonadotropin_bsu IPR018245 Gonadotropin_bsu_CS
PANTHERⁱ	PTHR11515 PTHR11515, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF00007 Cys_knot, 1 hit
SMARTⁱ	View protein in SMART SM00068 GHB, 1 hit
SUPFAMⁱ	SSF57501 SSF57501, 1 hit
PROSITEⁱ	View protein in PROSITE PS00261 GLYCO_HORMONE_BETA_1, 1 hit PS00689 GLYCO_HORMONE_BETA_2, 1 hit

Sequences (2)ⁱ

Sequence statusⁱ: Complete.

Sequence processingⁱ: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsⁱ produced by alternative splicing. Align Add to basket

Isoform 1 (identifier: P01222-1) [UniParc]FASTA Add to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTALFLMSML FGLTCGQAMS FCIPTEYTMH IERRECAYCL TINTTICAGY 
        60         70         80         90        100
CMTRDINGKL FLPKYALSQD VCTYRDFIYR TVEIPGCPLH VAPYFSYPVA 
       110        120        130 
LSCKCGKCNT DYSDCIHEAI KTNYCTKPQK SYLVGFSV

Length:138

Mass (Da):15,639

Last modified:November 2, 2010 - v2

Checksum:ⁱ6A367538D8393DB7

GO

Isoform 2 (identifier: P01222-2) [UniParc]FASTA Add to basket

The sequence of this isoform differs from the canonical sequence as follows:
1-54: MTALFLMSMLFGLTCGQAMSFCIPTEYTMHIERRECAYCLTINTTICAGYCMTR → MLSFLFFPQ

« Hide

        10         20         30         40         50
MLSFLFFPQD INGKLFLPKY ALSQDVCTYR DFIYRTVEIP GCPLHVAPYF 
        60         70         80         90 
SYPVALSCKC GKCNTDYSDC IHEAIKTNYC TKPQKSYLVG FSV

Note: Major isoform in peripheral blood leukocytes and thyroid, may form heterodimers with isoform 1.

Show »

Length:93

Mass (Da):10,624

Checksum:ⁱE1989F2A0A00126E

GO

Experimental Info

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Sequence conflictⁱ	46	I → M in AAB30828 (PubMed:8196184).Curated		1

Natural variant

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Natural variantⁱVAR_054769	14	T → A6 PublicationsCorresponds to variant dbSNP:rs10776792EnsemblClinVar.		1

Alternative sequence

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Alternative sequenceⁱVSP_053387	1 – 54	MTALF…YCMTR → MLSFLFFPQ in isoform 2. 1 PublicationAdd BLAST		54

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	X02866 Genomic DNA Translation: CAA26618.1 X02867 Genomic DNA Translation: CAA26619.1 M23671, M23670 Genomic DNA Translation: AAB05845.1 M25164 Genomic DNA Translation: AAA61235.1 M21024 Genomic DNA Translation: AAA36782.1 S70587 Genomic DNA Translation: AAB30828.2 AL109660 Genomic DNA No translation available. BC069298 mRNA Translation: AAH69298.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS880.1 [P01222-1]
PIRⁱ	A23997 TTHUB
NCBI Reference Sequences More...RefSeqⁱ	NP_000540.2, NM_000549.4 [P01222-1] NP_001264920.1, NM_001277991.1 [P01222-2] XP_011540367.1, XM_011542065.2 [P01222-1]
UniGeneⁱ	Hs.406687

Genome annotation databases

Ensemblⁱ	ENST00000256592; ENSP00000256592; ENSG00000134200 [P01222-1] ENST00000369517; ENSP00000358530; ENSG00000134200 [P01222-1]
GeneIDⁱ	7252
KEGGⁱ	hsa:7252
UCSC genome browser More...UCSCⁱ	uc001efs.2 human [P01222-1]

Keywords - Coding sequence diversityⁱ

Alternative splicing, Polymorphism

Similar proteinsⁱ

90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
P01222	Thyrotropin subunit beta		CANLF		138	UniRef90_P01222
Uncharacterized protein		RABIT		141
Thyroid-stimulating hormone subunit bet (Fragment)		LEPBR		33
Thyrotropin beta subunit (Fragment)		Korean hare		33
Thyrotropin beta subunit (Fragment)		LEPMN		33
+73

Protein	Similar proteins		Species	Score	Length	Source
P01222	Thyrotropin subunit beta		CANLF		138	UniRef50_P01222
Thyrotropin subunit beta		PIG		138
Thyrotropin subunit beta		HORSE		138
Thyrotropin subunit beta		FELCA		138
Thyrotropin subunit beta		CHICK		134
+472
P01222-2	Thyrotropin subunit beta (Fragment)		PHOSU		101	UniRef50_P01222-2
Thyrotropin subunit beta		CAMFR		88
Thyrotropin beta subunit (Fragment)		HUMAN		87
Thyrotropin beta chain protein (Fragment)		ALLEL		85
Thyrotropin beta chain protein (Fragment)		Northern birch mouse		85
+51

Cross-referencesⁱ

Web resourcesⁱ

Wikipedia

Thyroid-stimulating hormone entry

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	X02866 Genomic DNA Translation: CAA26618.1 X02867 Genomic DNA Translation: CAA26619.1 M23671, M23670 Genomic DNA Translation: AAB05845.1 M25164 Genomic DNA Translation: AAA61235.1 M21024 Genomic DNA Translation: AAA36782.1 S70587 Genomic DNA Translation: AAB30828.2 AL109660 Genomic DNA No translation available. BC069298 mRNA Translation: AAH69298.1
CCDSⁱ	CCDS880.1 [P01222-1]
PIRⁱ	A23997 TTHUB
RefSeqⁱ	NP_000540.2, NM_000549.4 [P01222-1] NP_001264920.1, NM_001277991.1 [P01222-2] XP_011540367.1, XM_011542065.2 [P01222-1]
UniGeneⁱ	Hs.406687

3D structure databases

ProteinModelPortalⁱ	P01222
SMRⁱ	P01222
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	113103, 15 interactors
IntActⁱ	P01222, 1 interactor
STRINGⁱ	9606.ENSP00000256592

PTM databases

UniCarbKBⁱ	P01222

UniCarbKBⁱ

P01222

Polymorphism and mutation databases

DMDMⁱ	311033515

DMDMⁱ

311033515

Proteomic databases

PaxDbⁱ	P01222
PeptideAtlasⁱ	P01222
PRIDEⁱ	P01222
ProteomicsDBⁱ	51347

Protocols and materials databases

The DNASU plasmid repository More...DNASUⁱ	7252
Structural Biology Knowledgebase	Search...

Genome annotation databases

Ensemblⁱ	ENST00000256592; ENSP00000256592; ENSG00000134200 [P01222-1] ENST00000369517; ENSP00000358530; ENSG00000134200 [P01222-1]
GeneIDⁱ	7252
KEGGⁱ	hsa:7252
UCSCⁱ	uc001efs.2 human [P01222-1]

Organism-specific databases

CTDⁱ	7252
DisGeNETⁱ	7252
EuPathDBⁱ	HostDB:ENSG00000134200.3
GeneCardsⁱ	TSHB
H-InvDBⁱ	HIX0028781
HGNCⁱ	HGNC:12372 TSHB
HPAⁱ	CAB022202 HPA042681
MalaCardsⁱ	TSHB
MIMⁱ	188540 gene 275100 phenotype
neXtProtⁱ	NX_P01222
OpenTargetsⁱ	ENSG00000134200
Orphanetⁱ	90674 Isolated thyroid-stimulating hormone deficiency
PharmGKBⁱ	PA37041
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	ENOG410IXJG Eukaryota ENOG410YSY0 LUCA
GeneTreeⁱ	ENSGT00390000010115
HOGENOMⁱ	HOG000116098
HOVERGENⁱ	HBG006698
InParanoidⁱ	P01222
KOⁱ	K05251
OMAⁱ	DVCTYRD
OrthoDBⁱ	EOG091G0XFH
PhylomeDBⁱ	P01222
TreeFamⁱ	TF332940

Enzyme and pathway databases

Reactomeⁱ	R-HSA-209822 Glycoprotein hormones R-HSA-209968 Thyroxine biosynthesis R-HSA-375281 Hormone ligand-binding receptors R-HSA-418555 G alpha (s) signalling events
SIGNORⁱ	P01222

Miscellaneous databases

GeneWikiⁱ	TSHB
GenomeRNAiⁱ	7252
Protein Ontology More...PROⁱ	PR:P01222
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000134200 Expressed in 79 organ(s), highest expression level in pituitary gland
CleanExⁱ	HS_TSHB
Genevisibleⁱ	P01222 HS

Family and domain databases

CDDⁱ	cd00069 GHB_like, 1 hit
Gene3Dⁱ	2.10.90.10, 1 hit
InterProⁱ	View protein in InterPro IPR029034 Cystine-knot_cytokine IPR006208 Glyco_hormone_CN IPR001545 Gonadotropin_bsu IPR018245 Gonadotropin_bsu_CS
PANTHERⁱ	PTHR11515 PTHR11515, 1 hit
Pfamⁱ	View protein in Pfam PF00007 Cys_knot, 1 hit
SMARTⁱ	View protein in SMART SM00068 GHB, 1 hit
SUPFAMⁱ	SSF57501 SSF57501, 1 hit
PROSITEⁱ	View protein in PROSITE PS00261 GLYCO_HORMONE_BETA_1, 1 hit PS00689 GLYCO_HORMONE_BETA_2, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	TSHB_HUMAN
Accessionⁱ	P01222Primary (citable) accession number: P01222 Secondary accession number(s): B1AKP0, Q16163
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	July 21, 1986
	Last sequence update:	November 2, 2010
	Last modified:	November 7, 2018
	This is version 165 of the entry and version 2 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

Complete proteome, Direct protein sequencing, Pharmaceutical, Reference proteome

Documents

SIMILARITY comments
Index of protein domains and families
Human chromosome 1
Human chromosome 1: entries, gene names and cross-references to MIM
Human entries with polymorphisms or disease mutations
List of human entries with polymorphisms or disease mutations
Human polymorphisms and disease mutations
Index of human polymorphisms and disease mutations
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P01222 (TSHB_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Thyrotropin subunit beta

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted

Extracellular region or secreted

Other locations

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Phylogenomic databases

Family and domain databases

Experimental Info

Natural variant

Alternative sequence

Sequence databases

Genome annotation databases

Keywords - Coding sequence diversityi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Sequence databases

3D structure databases

Protein-protein interaction databases

PTM databases

Polymorphism and mutation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

GO - Molecular functionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Keywords - Domainⁱ

Keywords - Coding sequence diversityⁱ

Cross-referencesⁱ

Web resourcesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ