Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
We will be switching to the new UniProt website on Tuesday, June 28. Please explore and share your feedback. Take me to UniProt BETA

UniProtKB - P01044 (KNG1_BOVIN)

Entry version 161 (25 May 2022)
Sequence version 1 (21 Jul 1986)
Previous versions | rss
Add a publicationFeedback
Protein

Kininogen-1

Gene

KNG1

Organism
Bos taurus (Bovine)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

1 Kininogens are inhibitors of thiol proteases; (2) HMW-kininogen plays an important role in blood coagulation by helping to position optimally prekallikrein and factor XI next to factor XII; (3) HMW-kininogen inhibits the thrombin- and plasmin-induced aggregation of thrombocytes; (4) the active peptide bradykinin that is released from HMW-kininogen shows a variety of physiological effects: (4A) influence in smooth muscle contraction, (4B) induction of hypotension, (4C) natriuresis and diuresis, (4D) decrease in blood glucose level, (4E) it is a mediator of inflammation and causes (4E1) increase in vascular permeability, (4E2) stimulation of nociceptors (4E3) release of other mediators of inflammation (e.g. prostaglandins), (4F) it has a cardioprotective effect (directly via bradykinin action, indirectly via endothelium-derived relaxing factor action); (5) LMW-kininogen inhibits the aggregation of thrombocytes; (6) LMW-kininogen is in contrast to HMW-kininogen not involved in blood clotting.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionProtease inhibitor, Thiol protease inhibitor, Vasoactive, Vasodilator
Biological processBlood coagulation, Hemostasis, Inflammatory response

Protein family/group databases

MEROPS protease database

More...MEROPSi		I25.016

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Kininogen-1
Alternative name(s):
Kininogen I
Thiol proteinase inhibitor
Cleaved into the following 4 chains:
Kininogen-1 heavy chain
Bradykinin
Alternative name(s):
Kallidin I
Lysyl-bradykinin
Alternative name(s):
Kallidin II
Kininogen-1 light chain
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:KNG1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiBos taurus (Bovine)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9913 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Laurasiatheria › Artiodactyla › Ruminantia › Pecora › Bovidae › Bovinae › Bos
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000009136 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Unplaced

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Secreted

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 181 PublicationAdd BLAST18
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000000667519 – 621Kininogen-1Add BLAST603
ChainiPRO_000000667619 – 378Kininogen-1 heavy chainAdd BLAST360
<p>This subsection of the 'PTM / Processing' section describes the position and length of an active peptide in the mature protein.<p><a href='/help/peptide' target='_top'>More...</a></p>PeptideiPRO_0000006677379 – 388Lysyl-bradykinin10
PeptideiPRO_0000006678380 – 388Bradykinin9
ChainiPRO_0000006679389 – 621Kininogen-1 light chainAdd BLAST233

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi27 ↔ 591Interchain (between heavy and light chains)
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi47N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi82 ↔ 93PROSITE-ProRule annotation1 Publication
Glycosylationi87N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi106 ↔ 125PROSITE-ProRule annotation1 Publication
Glycosylationi136O-linked (GalNAc...) threonine; partial2 Publications1
Disulfide bondi141 ↔ 144PROSITE-ProRule annotation1 Publication
Glycosylationi168N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi169N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi197N-linked (GlcNAc...) asparagine; partial1 Publication1
Glycosylationi204N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi205 ↔ 217PROSITE-ProRule annotation1 Publication
Disulfide bondi228 ↔ 247PROSITE-ProRule annotation1 Publication
Disulfide bondi263 ↔ 266PROSITE-ProRule annotation1 Publication
Disulfide bondi327 ↔ 339PROSITE-ProRule annotation1 Publication
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei331PhosphoserineBy similarity1
Disulfide bondi350 ↔ 369PROSITE-ProRule annotation1 Publication
Glycosylationi398O-linked (GalNAc...) serine1
Glycosylationi399O-linked (GalNAc...) threonine1
Glycosylationi400O-linked (GalNAc...) threonine1
Glycosylationi406O-linked (GalNAc...) serine1
Glycosylationi512O-linked (GalNAc...) serine1
Glycosylationi520O-linked (GalNAc...) threonine1
Glycosylationi524O-linked (GalNAc...) threonine1
Glycosylationi536O-linked (GalNAc...) threonine1
Glycosylationi548O-linked (GalNAc...) threonine1
Glycosylationi553O-linked (GalNAc...) threonine1
Glycosylationi570O-linked (GalNAc...) threonine1
Glycosylationi581O-linked (GalNAc...) serine1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Bradykinin is released from kininogen by plasma kallikrein.
Phosphorylated by FAM20C in the extracellular medium.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections ('Function', 'PTM / Processing', 'Pathology and Biotech') according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei378 – 379Cleavage; by kallikrein2
Sitei388 – 389Cleavage; by kallikrein2
Sitei498 – 499Cleavage; by kallikrein2

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P01044

PeptideAtlas

More...PeptideAtlasi		P01044

PRoteomics IDEntifications database

More...PRIDEi		P01044

PTM databases

GlyConnect protein glycosylation platform

More...GlyConnecti		785, 1 O-Linked glycan (2 sites)

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P01044

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Plasma.

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...STRINGi		9913.ENSBTAP00000048995

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

AlphaFold Protein Structure Database

More...AlphaFoldDBi		P01044

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P01044

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini27 – 131Cystatin kininogen-type 1PROSITE-ProRule annotationAdd BLAST105
Domaini150 – 253Cystatin kininogen-type 2PROSITE-ProRule annotationAdd BLAST104
Domaini272 – 375Cystatin kininogen-type 3PROSITE-ProRule annotationAdd BLAST104

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni396 – 497DisorderedSequence analysisAdd BLAST102

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi410 – 435Basic and acidic residuesSequence analysisAdd BLAST26
Compositional biasi439 – 491Basic residuesSequence analysisAdd BLAST53

Keywords - Domaini

Repeat, Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502RYAC, Eukaryota

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_029531_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P01044

Database of Orthologous Groups

More...OrthoDBi		740995at2759

TreeFam database of animal gene trees

More...TreeFami		TF351852

Family and domain databases

Conserved Domains Database

More...CDDi		cd00042, CY, 3 hits

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR000010, Cystatin_dom
IPR046350, Cystatin_sf
IPR002395, Kininogen
IPR027358, Kininogen-type_cystatin_dom
IPR018073, Prot_inh_cystat_CS

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00031, Cystatin, 3 hits

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00334, KININOGEN

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00043, CY, 3 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF54403, SSF54403, 3 hits

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00287, CYSTATIN, 2 hits
PS51647, CYSTATIN_KININOGEN, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform HMW (identifier: P01044-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKLITILFLC SRLLPSLTQE SSQEIDCNDQ DVFKAVDAAL TKYNSENKSG 
        60         70         80         90        100
NQFVLYRITE VARMDNPDTF YSLKYQIKEG DCPFQSNKTW QDCDYKDSAQ 
       110        120        130        140        150
AATGECTATV AKRGNMKFSV AIQTCLITPA EGPVVTAQYE CLGCVHPIST 
       160        170        180        190        200
KSPDLEPVLR YAIQYFNNNT SHSHLFDLKE VKRAQRQVVS GWNYEVNYSI 
       210        220        230        240        250
AQTNCSKEEF SFLTPDCKSL SSGDTGECTD KAHVDVKLRI SSFSQKCDLY 
       260        270        280        290        300
PVKDFVQPPT RLCAGCPKPI PVDSPDLEEP LSHSIAKLNA EHDGAFYFKI 
       310        320        330        340        350
DTVKKATVQV VAGLKYSIVF IARETTCSKG SNEELTKSCE INIHGQILHC 
       360        370        380        390        400
DANVYVVPWE EKVYPTVNCQ PLGQTSLMKR PPGFSPFRSV QVMKTEGSTT 
       410        420        430        440        450
VSLPHSAMSP VQDEERDSGK EQGPTHGHGW DHGKQIKLHG LGLGHKHKHD 
       460        470        480        490        500
QGHGHHGSHG LGHGHQKQHG LGHGHKHGHG HGKHKNKGKN NGKHYDWRTP 
       510        520        530        540        550
YLASSYEDST TSSAQTQEKT EETTLSSLAQ PGVAITFPDF QDSDLIATVM 
       560        570        580        590        600
PNTLPPHTES DDDWIPDIQT EPNSLAFKLI SDFPETTSPK CPSRPWKPVN 
       610        620 
GVNPTVEMKE SHDFDLVDAL L
Length:621
Mass (Da):68,890
Last modified:July 21, 1986 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD16850BEFE3C55CD
GO
Isoform LMW (identifier: P01044-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     401-436: VSLPHSAMSPVQDEERDSGKEQGPTHGHGWDHGKQI → THVKSCEYKGRPQEAGAEPAPQGEVSLPAESPQLAR
     437-621: Missing.

Show »
Length:436
Mass (Da):48,428
Checksum:iF01F7EB6814BCE6C
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti295A → T in CAA23709 (PubMed:6572010).Curated1
Sequence conflicti371P → S in AAI05500 (Ref. 3) Curated1
Sequence conflicti403L → V in AAI05500 (Ref. 3) Curated1
Sequence conflicti457G → R in AAI05500 (Ref. 3) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_013562401 – 436VSLPH…HGKQI → THVKSCEYKGRPQEAGAEPA PQGEVSLPAESPQLAR in isoform LMW. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_013563437 – 621Missing in isoform LMW. 1 PublicationAdd BLAST185

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
V01491 mRNA Translation: CAA24735.1
V00426 mRNA Translation: CAA23709.1
BC105499 mRNA Translation: AAI05500.1

Protein sequence database of the Protein Information Resource

More...PIRi		A01281, KGBOH1
A01283, KGBOL1

NCBI Reference Sequences

More...RefSeqi		NP_786968.2, NM_175774.3

Genome annotation databases

Database of genes from NCBI RefSeq genomes

More...GeneIDi		280833

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
V01491 mRNA Translation: CAA24735.1
V00426 mRNA Translation: CAA23709.1
BC105499 mRNA Translation: AAI05500.1
PIRiA01281, KGBOH1
A01283, KGBOL1
RefSeqiNP_786968.2, NM_175774.3

3D structure databases

AlphaFoldDBiP01044
SMRiP01044
ModBaseiSearch...

Protein-protein interaction databases

STRINGi9913.ENSBTAP00000048995

Protein family/group databases

MEROPSiI25.016

PTM databases

GlyConnecti785, 1 O-Linked glycan (2 sites)
iPTMnetiP01044

Proteomic databases

PaxDbiP01044
PeptideAtlasiP01044
PRIDEiP01044

Genome annotation databases

GeneIDi280833

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		3827

Phylogenomic databases

eggNOGiENOG502RYAC, Eukaryota
HOGENOMiCLU_029531_0_0_1
InParanoidiP01044
OrthoDBi740995at2759
TreeFamiTF351852

Family and domain databases

CDDicd00042, CY, 3 hits
InterProiView protein in InterPro
IPR000010, Cystatin_dom
IPR046350, Cystatin_sf
IPR002395, Kininogen
IPR027358, Kininogen-type_cystatin_dom
IPR018073, Prot_inh_cystat_CS
PfamiView protein in Pfam
PF00031, Cystatin, 3 hits
PRINTSiPR00334, KININOGEN
SMARTiView protein in SMART
SM00043, CY, 3 hits
SUPFAMiSSF54403, SSF54403, 3 hits
PROSITEiView protein in PROSITE
PS00287, CYSTATIN, 2 hits
PS51647, CYSTATIN_KININOGEN, 3 hits

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiKNG1_BOVIN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P01044
Secondary accession number(s): P01046, Q2KJ62
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 21, 1986
Last sequence update: July 21, 1986
Last modified: May 25, 2022
This is version 161 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Direct protein sequencing, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again