Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Alpha-1-antichymotrypsin

Gene

SERPINA3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Although its physiological function is unclear, it can inhibit neutrophil cathepsin G and mast cell chymase, both of which can convert angiotensin-1 to the active angiotensin-2.1 Publication

Miscellaneous

Alpha-1-antichymotrypsin can bind DNA.

Caution

It is uncertain whether Met-1 or Met-4 is the initiator.Curated

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei383 – 384Reactive bond2

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi235 – 2373

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • DNA binding Source: UniProtKB
  • serine-type endopeptidase inhibitor activity Source: GO_Central

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionProtease inhibitor, Serine protease inhibitor
Biological processAcute phase

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-114608 Platelet degranulation
R-HSA-6798695 Neutrophil degranulation

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P01011

Protein family/group databases

MEROPS protease database

More...
MEROPSi
I04.002

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Alpha-1-antichymotrypsin
Short name:
ACT
Alternative name(s):
Cell growth-inhibiting gene 24/25 protein
Serpin A3
Cleaved into the following chain:
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SERPINA3
Synonyms:AACT
ORF Names:GIG24, GIG25
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 14

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000196136.16

Human Gene Nomenclature Database

More...
HGNCi
HGNC:16 SERPINA3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
107280 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P01011

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNET

More...
DisGeNETi
12

Open Targets

More...
OpenTargetsi
ENSG00000196136

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
93594 Alpha-1-antichymotrypsin deficiency

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA35020

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL5960

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SERPINA3

Domain mapping of disease mutations (DMDM)

More...
DMDMi
112874

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 231 PublicationAdd BLAST23
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000003241124 – 423Alpha-1-antichymotrypsinAdd BLAST400
ChainiPRO_000003241226 – 423Alpha-1-antichymotrypsin His-Pro-lessAdd BLAST398

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi33N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi93N-linked (GlcNAc...) asparagine4 Publications1
Glycosylationi106N-linked (GlcNAc...) asparagine3 Publications1
Glycosylationi127N-linked (GlcNAc...) asparagine2 Publications1
Glycosylationi186N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi271N-linked (GlcNAc...) asparagine2 Publications1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

N- and O-glycosylated.5 Publications

Keywords - PTMi

Glycoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P01011

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P01011

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P01011

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P01011

PeptideAtlas

More...
PeptideAtlasi
P01011

PRoteomics IDEntifications database

More...
PRIDEi
P01011

ProteomicsDB human proteome resource

More...
ProteomicsDBi
51303
51304 [P01011-2]
51305 [P01011-3]

2D gel databases

DOSAC-COBS 2D-PAGE database

More...
DOSAC-COBS-2DPAGEi
P01011

Two-dimensional polyacrylamide gel electrophoresis database from the Geneva University Hospital

More...
SWISS-2DPAGEi
P01011

PTM databases

CarbonylDB database of protein carbonylation sites

More...
CarbonylDBi
P01011

GlyConnect protein glycosylation platform

More...
GlyConnecti
19

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P01011

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P01011

UniCarbKB; an annotated and curated database of glycan structures

More...
UniCarbKBi
P01011

Miscellaneous databases

CutDB - Proteolytic event database

More...
PMAP-CutDBi
P01011

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Plasma. Synthesized in the liver. Like the related alpha-1-antitrypsin, its concentration increases in the acute phase of inflammation or infection. Found in the amyloid plaques from the hippocampus of Alzheimer disease brains.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000196136 Expressed in 92 organ(s), highest expression level in liver

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P01011 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P01011 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB016647
HPA000893
HPA002560

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with DNAJC1.1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
DNAJC1Q96KC83EBI-296557,EBI-296550

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
106530, 29 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
P01011

Protein interaction database and analysis system

More...
IntActi
P01011, 10 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000376793

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1423
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1AS4X-ray2.10A43-383[»]
B387-423[»]
1QMNX-ray2.27A26-423[»]
2ACHX-ray2.70A24-383[»]
B384-423[»]
3CAAX-ray2.40A43-383[»]
B387-423[»]
3DLWX-ray2.70A25-423[»]
4CAAX-ray2.90A43-383[»]
B387-423[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P01011

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P01011

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P01011

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni369 – 394RCLAdd BLAST26
Regioni381 – 389O-glycosylated at one site9

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The reactive center loop (RCL) extends out from the body of the protein and directs binding to the target protease. The protease cleaves the serpin at the reactive site within the RCL, establishing a covalent linkage between the carboxyl group of the serpin reactive site and the serine hydroxyl of the protease. The resulting inactive serpin-protease complex is highly stable.

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the serpin family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2392 Eukaryota
COG4826 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154392

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG005957

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P01011

KEGG Orthology (KO)

More...
KOi
K04525

Identification of Orthologs from Complete Genome Data

More...
OMAi
FLMIIVP

Database of Orthologous Groups

More...
OrthoDBi
131191at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P01011

TreeFam database of animal gene trees

More...
TreeFami
TF343201

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR023795 Serpin_CS
IPR023796 Serpin_dom
IPR000215 Serpin_fam
IPR036186 Serpin_sf

The PANTHER Classification System

More...
PANTHERi
PTHR11461 PTHR11461, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00079 Serpin, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00093 SERPIN, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF56574 SSF56574, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00284 SERPIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P01011-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MERMLPLLAL GLLAAGFCPA VLCHPNSPLD EENLTQENQD RGTHVDLGLA
60 70 80 90 100
SANVDFAFSL YKQLVLKAPD KNVIFSPLSI STALAFLSLG AHNTTLTEIL
110 120 130 140 150
KGLKFNLTET SEAEIHQSFQ HLLRTLNQSS DELQLSMGNA MFVKEQLSLL
160 170 180 190 200
DRFTEDAKRL YGSEAFATDF QDSAAAKKLI NDYVKNGTRG KITDLIKDLD
210 220 230 240 250
SQTMMVLVNY IFFKAKWEMP FDPQDTHQSR FYLSKKKWVM VPMMSLHHLT
260 270 280 290 300
IPYFRDEELS CTVVELKYTG NASALFILPD QDKMEEVEAM LLPETLKRWR
310 320 330 340 350
DSLEFREIGE LYLPKFSISR DYNLNDILLQ LGIEEAFTSK ADLSGITGAR
360 370 380 390 400
NLAVSQVVHK AVLDVFEEGT EASAATAVKI TLLSALVETR TIVRFNRPFL
410 420
MIIVPTDTQN IFFMSKVTNP KQA
Length:423
Mass (Da):47,651
Last modified:August 1, 1991 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB002F946C86A8951
GO
Isoform 2 (identifier: P01011-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     215-216: AK → ER
     217-423: Missing.

Note: No experimental confirmation available.
Show »
Length:216
Mass (Da):24,034
Checksum:i49312EDF91439D4D
GO
Isoform 3 (identifier: P01011-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     64-95: LVLKAPDKNVIFSPLSISTALAFLSLGAHNTT → SPRWSIRLCLMYLRRAQKHLLPQQSKSPSFLH
     96-423: Missing.

Note: No experimental confirmation available.
Show »
Length:95
Mass (Da):10,717
Checksum:i15B1759843F9809B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
G3V595G3V595_HUMAN
Alpha-1-antichymotrypsin
SERPINA3
305Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3V3A0G3V3A0_HUMAN
Alpha-1-antichymotrypsin
SERPINA3 hCG_2039549
205Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WY93A0A087WY93_HUMAN
Alpha-1-antichymotrypsin
SERPINA3
46Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAA51543 differs from that shown. Reason: Frameshift at positions 101, 106, 111, 117, 123, 129 and 421.Curated
The sequence AAT08029 differs from that shown. Reason: Frameshift at position 4.Curated
The sequence AAT08029 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAD92297 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence CAA48671 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti55D → S AA sequence (PubMed:6687683).Curated1
Sequence conflicti69P → L in AAA51543 (PubMed:6606438).Curated1
Sequence conflicti101K → R in BAD92297 (Ref. 5) Curated1
Sequence conflicti106N → Y in AAT08028 (Ref. 3) Curated1
Sequence conflicti198D → N in AAT08029 (Ref. 3) Curated1
Sequence conflicti199L → P in AAA51543 (PubMed:6606438).Curated1
Sequence conflicti234S → N in AAT08029 (Ref. 3) Curated1
Sequence conflicti339S → G in AAT08028 (Ref. 3) Curated1
Sequence conflicti346I → S in AAT08028 (Ref. 3) Curated1
Sequence conflicti361 – 363AVL → VVS in AAA51543 (PubMed:6606438).Curated3

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0069739A → T4 PublicationsCorresponds to variant dbSNP:rs4934EnsemblClinVar.1
Natural variantiVAR_00697478L → P in Bochum-1. 1 PublicationCorresponds to variant dbSNP:rs1800463EnsemblClinVar.1
Natural variantiVAR_006975167A → G. 1
Natural variantiVAR_006976252P → A in Bonn-1. 2 PublicationsCorresponds to variant dbSNP:rs17473EnsemblClinVar.1
Natural variantiVAR_037902267K → R1 PublicationCorresponds to variant dbSNP:rs17853314Ensembl.1
Natural variantiVAR_006977401M → V Associated with occlusive-cerebrovascular disease; Isehara-1. 2 PublicationsCorresponds to variant dbSNP:rs755521612Ensembl.1
Natural variantiVAR_011742407D → G. Corresponds to variant dbSNP:rs10956Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_01422564 – 95LVLKA…AHNTT → SPRWSIRLCLMYLRRAQKHL LPQQSKSPSFLH in isoform 3. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_01422696 – 423Missing in isoform 3. 1 PublicationAdd BLAST328
Alternative sequenceiVSP_014227215 – 216AK → ER in isoform 2. 1 Publication2
Alternative sequenceiVSP_014228217 – 423Missing in isoform 2. 1 PublicationAdd BLAST207

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
K01500 mRNA Translation: AAA51543.1 Frameshift.
X68733
, X68734, X68735, X68736, X68737 Genomic DNA Translation: CAA48671.1 Different initiation.
AY513275 mRNA Translation: AAT08028.1
AY513276 mRNA Translation: AAT08029.1 Sequence problems.
AK123091 mRNA Translation: BAG53869.1
AB209060 mRNA Translation: BAD92297.1 Different initiation.
BC003559 mRNA Translation: AAH03559.3
BC010530 mRNA Translation: AAH10530.1
BC013189 mRNA Translation: AAH13189.1
BC034554 mRNA Translation: AAH34554.1
BC070265 mRNA Translation: AAH70265.1
M18906 mRNA Translation: AAA51559.1
AF089747 mRNA Translation: AAD08810.1
J05176 mRNA Translation: AAA51560.1
X00947 Genomic DNA Translation: CAA25459.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS32150.1 [P01011-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
A90475 ITHUC
S62374

NCBI Reference Sequences

More...
RefSeqi
NP_001076.2, NM_001085.4 [P01011-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.534293
Hs.710488

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000393078; ENSP00000376793; ENSG00000196136 [P01011-1]
ENST00000393080; ENSP00000376795; ENSG00000196136 [P01011-1]
ENST00000467132; ENSP00000450540; ENSG00000196136 [P01011-1]
ENST00000556968; ENSP00000452476; ENSG00000196136 [P01011-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
12

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:12

UCSC genome browser

More...
UCSCi
uc001ydp.4 human [P01011-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Wikipedia

Alpha-1 antichymotrypsin entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
K01500 mRNA Translation: AAA51543.1 Frameshift.
X68733
, X68734, X68735, X68736, X68737 Genomic DNA Translation: CAA48671.1 Different initiation.
AY513275 mRNA Translation: AAT08028.1
AY513276 mRNA Translation: AAT08029.1 Sequence problems.
AK123091 mRNA Translation: BAG53869.1
AB209060 mRNA Translation: BAD92297.1 Different initiation.
BC003559 mRNA Translation: AAH03559.3
BC010530 mRNA Translation: AAH10530.1
BC013189 mRNA Translation: AAH13189.1
BC034554 mRNA Translation: AAH34554.1
BC070265 mRNA Translation: AAH70265.1
M18906 mRNA Translation: AAA51559.1
AF089747 mRNA Translation: AAD08810.1
J05176 mRNA Translation: AAA51560.1
X00947 Genomic DNA Translation: CAA25459.1
CCDSiCCDS32150.1 [P01011-1]
PIRiA90475 ITHUC
S62374
RefSeqiNP_001076.2, NM_001085.4 [P01011-1]
UniGeneiHs.534293
Hs.710488

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1AS4X-ray2.10A43-383[»]
B387-423[»]
1QMNX-ray2.27A26-423[»]
2ACHX-ray2.70A24-383[»]
B384-423[»]
3CAAX-ray2.40A43-383[»]
B387-423[»]
3DLWX-ray2.70A25-423[»]
4CAAX-ray2.90A43-383[»]
B387-423[»]
ProteinModelPortaliP01011
SMRiP01011
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi106530, 29 interactors
CORUMiP01011
IntActiP01011, 10 interactors
STRINGi9606.ENSP00000376793

Chemistry databases

ChEMBLiCHEMBL5960

Protein family/group databases

MEROPSiI04.002

PTM databases

CarbonylDBiP01011
GlyConnecti19
iPTMnetiP01011
PhosphoSitePlusiP01011
UniCarbKBiP01011

Polymorphism and mutation databases

BioMutaiSERPINA3
DMDMi112874

2D gel databases

DOSAC-COBS-2DPAGEiP01011
SWISS-2DPAGEiP01011

Proteomic databases

EPDiP01011
jPOSTiP01011
MaxQBiP01011
PaxDbiP01011
PeptideAtlasiP01011
PRIDEiP01011
ProteomicsDBi51303
51304 [P01011-2]
51305 [P01011-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
12
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000393078; ENSP00000376793; ENSG00000196136 [P01011-1]
ENST00000393080; ENSP00000376795; ENSG00000196136 [P01011-1]
ENST00000467132; ENSP00000450540; ENSG00000196136 [P01011-1]
ENST00000556968; ENSP00000452476; ENSG00000196136 [P01011-2]
GeneIDi12
KEGGihsa:12
UCSCiuc001ydp.4 human [P01011-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
12
DisGeNETi12
EuPathDBiHostDB:ENSG00000196136.16

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SERPINA3

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0079611
HGNCiHGNC:16 SERPINA3
HPAiCAB016647
HPA000893
HPA002560
MIMi107280 gene
neXtProtiNX_P01011
OpenTargetsiENSG00000196136
Orphaneti93594 Alpha-1-antichymotrypsin deficiency
PharmGKBiPA35020

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2392 Eukaryota
COG4826 LUCA
GeneTreeiENSGT00940000154392
HOVERGENiHBG005957
InParanoidiP01011
KOiK04525
OMAiFLMIIVP
OrthoDBi131191at2759
PhylomeDBiP01011
TreeFamiTF343201

Enzyme and pathway databases

ReactomeiR-HSA-114608 Platelet degranulation
R-HSA-6798695 Neutrophil degranulation
SIGNORiP01011

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SERPINA3 human
EvolutionaryTraceiP01011

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
Alpha_1-antichymotrypsin

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
12
PMAP-CutDBiP01011

Protein Ontology

More...
PROi
PR:P01011

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000196136 Expressed in 92 organ(s), highest expression level in liver
ExpressionAtlasiP01011 baseline and differential
GenevisibleiP01011 HS

Family and domain databases

InterProiView protein in InterPro
IPR023795 Serpin_CS
IPR023796 Serpin_dom
IPR000215 Serpin_fam
IPR036186 Serpin_sf
PANTHERiPTHR11461 PTHR11461, 1 hit
PfamiView protein in Pfam
PF00079 Serpin, 1 hit
SMARTiView protein in SMART
SM00093 SERPIN, 1 hit
SUPFAMiSSF56574 SSF56574, 1 hit
PROSITEiView protein in PROSITE
PS00284 SERPIN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiAACT_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P01011
Secondary accession number(s): B3KVQ7
, Q13703, Q2TU87, Q2TU88, Q59GP9, Q6LBY8, Q6LDT7, Q6NSC9, Q8N177, Q96DW8, Q9UC47, Q9UNU9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 21, 1986
Last sequence update: August 1, 1991
Last modified: January 16, 2019
This is version 225 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again