Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P00973 (OAS1_HUMAN)

Entry version 209 (26 Feb 2020)
Sequence version 4 (18 May 2010)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

2'-5'-oligoadenylate synthase 1

Gene

OAS1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Interferon-induced, dsRNA-activated antiviral enzyme which plays a critical role in cellular innate antiviral response. In addition, it may also play a role in other cellular processes such as apoptosis, cell growth, differentiation and gene regulation. Synthesizes higher oligomers of 2'-5'-oligoadenylates (2-5A) from ATP which then bind to the inactive monomeric form of ribonuclease L (RNase L) leading to its dimerization and subsequent activation. Activation of RNase L leads to degradation of cellular as well as viral RNA, resulting in the inhibition of protein synthesis, thus terminating viral replication. Can mediate the antiviral effect via the classical RNase L-dependent pathway or an alternative antiviral pathway independent of RNase L. The secreted form displays antiviral effect against vesicular stomatitis virus (VSV), herpes simplex virus type 2 (HSV-2), and encephalomyocarditis virus (EMCV) and stimulates the alternative antiviral pathway independent of RNase L.4 Publications

Caution

PubMed:1651324 sequence was originally thought to originate from mouse.Curated

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mg2+1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Produced as a latent enzyme which is activated by dsRNA generated during the course of viral infection. The dsRNA activator must be at least 15 nucleotides long, and no modification of the 2'-hydroxyl group is tolerated. ssRNA or dsDNA do not act as activators.2 Publications

<p>This subsection of the 'Function' section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=0.31 mM for ATP1 Publication

    Sites

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei63ATP1 Publication1
    <p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi75Magnesium; catalytic1
    Metal bindingi77Magnesium; catalytic1
    Metal bindingi148Magnesium; catalytic1
    Binding sitei210ATPBy similarity1
    Binding sitei213ATP1 Publication1
    Binding sitei229ATP1 Publication1

    <p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

    Complete GO annotation on QuickGO ...

    GO - Biological processi

    Complete GO annotation on QuickGO ...

    <p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

    Molecular functionNucleotidyltransferase, RNA-binding, Transferase
    Biological processAntiviral defense, Immunity, Innate immunity
    LigandATP-binding, Magnesium, Metal-binding, Nucleotide-binding

    Enzyme and pathway databases

    BioCyc Collection of Pathway/Genome Databases

    More...    BioCyci    		MetaCyc:ENSG00000089127-MONOMER

    Reactome - a knowledgebase of biological pathways and processes

    More...    Reactomei    		R-HSA-877300 Interferon gamma signaling
    R-HSA-8983711 OAS antiviral response
    R-HSA-909733 Interferon alpha/beta signaling

    <p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
    Recommended name:
    2'-5'-oligoadenylate synthase 1 (EC:2.7.7.847 Publications)
    Short name:
    (2-5')oligo(A) synthase 1
    Short name:
    2-5A synthase 1
    Alternative name(s):
    E18/E16
    p46/p42 OAS
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
    Name:OAS1
    Synonyms:OIAS
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
    • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

    Organism-specific databases

    Human Gene Nomenclature Database

    More...    HGNCi    		HGNC:8086 OAS1

    Online Mendelian Inheritance in Man (OMIM)

    More...    MIMi    		164350 gene

    neXtProt; the human protein knowledge platform

    More...    neXtProti    		NX_P00973

    <p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

    Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

    Keywords - Cellular componenti

    Cytoplasm, Endoplasmic reticulum, Microsome, Mitochondrion, Nucleus, Secreted

    <p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi66K → A: Decreased enzyme activity. 1 Publication1
    Mutagenesisi75D → A: Loss of activity; when associated with A-77. 2 Publications1
    Mutagenesisi77D → A: Loss of activity; when associated with A-75. 2 Publications1
    Mutagenesisi148D → A: Strongly reduced enzyme activity. 1 Publication1
    Mutagenesisi233E → A: Loss of enzyme activity. 1 Publication1
    Mutagenesisi331C → A: Loss of activity; when associated with A-332 and A-333. 1 Publication1
    Mutagenesisi332F → A: Loss of activity; when associated with A-331 and A-333. 1 Publication1
    Mutagenesisi333K → A: Loss of activity; when associated with A-331 and A-332. 1 Publication1

    Organism-specific databases

    DisGeNET

    More...    DisGeNETi    		4938

    MalaCards human disease database

    More...    MalaCardsi    		OAS1

    Open Targets

    More...    OpenTargetsi    		ENSG00000089127

    Orphanet; a database dedicated to information on rare diseases and orphan drugs

    More...    Orphaneti    		264675 Hereditary pulmonary alveolar proteinosis

    The Pharmacogenetics and Pharmacogenomics Knowledge Base

    More...    PharmGKBi    		PA31875

    Miscellaneous databases

    Pharos NIH Druggable Genome Knowledgebase

    More...    Pharosi    		P00973 Tbio

    Chemistry databases

    Drug and drug target database

    More...    DrugBanki    		DB02987 Cysteine-S-Acetamide

    Polymorphism and mutation databases

    BioMuta curated single-nucleotide variation and disease association database

    More...    BioMutai    		OAS1

    Domain mapping of disease mutations (DMDM)

    More...    DMDMi    		296439492

    <p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001602591 – 4002'-5'-oligoadenylate synthase 1Add BLAST400

    Proteomic databases

    Encyclopedia of Proteome Dynamics

    More...    EPDi    		P00973

    jPOST - Japan Proteome Standard Repository/Database

    More...    jPOSTi    		P00973

    MassIVE - Mass Spectrometry Interactive Virtual Environment

    More...    MassIVEi    		P00973

    MaxQB - The MaxQuant DataBase

    More...    MaxQBi    		P00973

    PaxDb, a database of protein abundance averages across all three domains of life

    More...    PaxDbi    		P00973

    PeptideAtlas

    More...    PeptideAtlasi    		P00973

    PRoteomics IDEntifications database

    More...    PRIDEi    		P00973

    ProteomicsDB: a multi-organism proteome resource

    More...    ProteomicsDBi    		51294 [P00973-1]
    51295 [P00973-2]
    51296 [P00973-3]
    51297 [P00973-4]

    PTM databases

    iPTMnet integrated resource for PTMs in systems biology context

    More...    iPTMneti    		P00973

    Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

    More...    PhosphoSitePlusi    		P00973

    <p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

    <p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

    By type I interferon (IFN) and viruses.2 Publications

    Gene expression databases

    Bgee dataBase for Gene Expression Evolution

    More...    Bgeei    		ENSG00000089127 Expressed in ectocervix and 190 other tissues

    ExpressionAtlas, Differential and Baseline Expression

    More...    ExpressionAtlasi    		P00973 baseline and differential

    Genevisible search portal to normalized and curated expression data from Genevestigator

    More...    Genevisiblei    		P00973 HS

    Organism-specific databases

    Human Protein Atlas

    More...    HPAi    		CAB021104
    HPA003657

    <p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

    <p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

    Monomer (PubMed:9407111). Homotetramer (PubMed:9407111, PubMed:23319625).

    2 Publications

    Sites

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections ('Function', 'PTM / Processing', 'Pathology and Biotech') according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei158Interaction with dsRNA1

    <p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

    Show more details

    Protein-protein interaction databases

    The Biological General Repository for Interaction Datasets (BioGrid)

    More...    BioGridi    		110992, 9 interactors

    Protein interaction database and analysis system

    More...    IntActi    		P00973, 15 interactors

    Molecular INTeraction database

    More...    MINTi    		P00973

    STRING: functional protein association networks

    More...    STRINGi    		9606.ENSP00000388001

    Miscellaneous databases

    RNAct, Protein-RNA interaction predictions for model organisms.

    More...    RNActi    		P00973 protein

    <p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

    Secondary structure

    1400
    Legend: HelixTurnBeta strandPDB Structure known for this area
    Show more details

    3D structure databases

    SWISS-MODEL Repository - a database of annotated 3D protein structure models

    More...    SMRi    		P00973

    Database of comparative protein structure models

    More...    ModBasei    		Search...

    Protein Data Bank in Europe - Knowledge Base

    More...    PDBe-KBi    		Search...

    <p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

    Region

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni13 – 60Interaction with dsRNAAdd BLAST48
    Regioni200 – 210Interaction with dsRNAAdd BLAST11

    <p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

    Belongs to the 2-5A synthase family.Curated

    Phylogenomic databases

    evolutionary genealogy of genes: Non-supervised Orthologous Groups

    More...    eggNOGi    		KOG0001 Eukaryota
    COG5272 LUCA

    Ensembl GeneTree

    More...    GeneTreei    		ENSGT00510000046406

    KEGG Orthology (KO)

    More...    KOi    		K14216

    Identification of Orthologs from Complete Genome Data

    More...    OMAi    		VGRRHYT

    Database of Orthologous Groups

    More...    OrthoDBi    		611234at2759

    Database for complete collections of gene phylogenies

    More...    PhylomeDBi    		P00973

    TreeFam database of animal gene trees

    More...    TreeFami    		TF329749

    Family and domain databases

    Gene3D Structural and Functional Annotation of Protein Families

    More...    Gene3Di    		1.10.1410.20, 1 hit

    Integrated resource of protein families, domains and functional sites

    More...    InterProi    		View protein in InterPro
    IPR006117 2-5-oligoadenylate_synth_CS
    IPR006116 2-5-oligoadenylate_synth_N
    IPR018952 2-5-oligoAdlate_synth_1_dom2/C
    IPR038121 2-5-oligoAdlate_synth_2_sf
    IPR026774 2-5A_synthase
    IPR002934 Polymerase_NTP_transf_dom

    The PANTHER Classification System

    More...    PANTHERi    		PTHR11258 PTHR11258, 1 hit

    Pfam protein domain database

    More...    Pfami    		View protein in Pfam
    PF01909 NTP_transf_2, 1 hit
    PF10421 OAS1_C, 1 hit

    PROSITE; a protein domain and family database

    More...    PROSITEi    		View protein in PROSITE
    PS00832 25A_SYNTH_1, 1 hit
    PS00833 25A_SYNTH_2, 1 hit
    PS50152 25A_SYNTH_3, 1 hit

    <p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

    This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

    This entry has 4 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

    Isoform p46 (identifier: P00973-1) [UniParc]FASTAAdd to basket
    Also known as: 46 kDa, E18

    This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide
            10         20         30         40         50
    MMDLRNTPAK SLDKFIEDYL LPDTCFRMQI NHAIDIICGF LKERCFRGSS 
            60         70         80         90        100
    YPVCVSKVVK GGSSGKGTTL RGRSDADLVV FLSPLTTFQD QLNRRGEFIQ 
           110        120        130        140        150
    EIRRQLEACQ RERAFSVKFE VQAPRWGNPR ALSFVLSSLQ LGEGVEFDVL 
           160        170        180        190        200
    PAFDALGQLT GGYKPNPQIY VKLIEECTDL QKEGEFSTCF TELQRDFLKQ 
           210        220        230        240        250
    RPTKLKSLIR LVKHWYQNCK KKLGKLPPQY ALELLTVYAW ERGSMKTHFN 
           260        270        280        290        300
    TAQGFRTVLE LVINYQQLCI YWTKYYDFKN PIIEKYLRRQ LTKPRPVILD 
           310        320        330        340        350
    PADPTGNLGG GDPKGWRQLA QEAEAWLNYP CFKNWDGSPV SSWILLAESN 
           360        370        380        390        400
    SADDETDDPR RYQKYGYIGT HEYPHFSHRP STLQAASTPQ AEEDWTCTIL
    Length:400
    Mass (Da):46,029
    Last modified:May 18, 2010 - v4
    <p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i03F0A3AA17DAD4E4
    GO
    Isoform p41 (identifier: P00973-2) [UniParc]FASTAAdd to basket
    Also known as: 41 kDa, E16, 3-9

    The sequence of this isoform differs from the canonical sequence as follows:
         347-364: AESNSADDETDDPRRYQK → VRPPASSLPFIPAPLHEA
         365-400: Missing.

    Show »
    Length:364
    Mass (Da):41,740
    Checksum:i2FC9CA8944EC5901
    GO
    Isoform p48 (identifier: P00973-3) [UniParc]FASTAAdd to basket
    Also known as: 9-2

    The sequence of this isoform differs from the canonical sequence as follows:
         347-400: AESNSADDET...AEEDWTCTIL → TQHTPGSIHP...CIIQDRTQVS

    Show »
    Length:414
    Mass (Da):47,408
    Checksum:iE17B28ECAE185399
    GO
    Isoform p44 (identifier: P00973-4) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         347-382: AESNSADDETDDPRRYQKYGYIGTHEYPHFSHRPST → VNLTLVGRRNYPIISEHAVNLQQTRRASLSYSFQVA
         383-400: Missing.

    Show »
    Length:382
    Mass (Da):43,944
    Checksum:i89654CF4DFFD195C
    GO

    <p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

    There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
    EntryEntry nameProtein names
    		Gene namesLengthAnnotation
    F8VXY3F8VXY3_HUMAN
    2'-5'-oligoadenylate synthase 1
    OAS1
    		360Annotation score:

    Annotation score:2 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    H0YI20H0YI20_HUMAN
    2'-5'-oligoadenylate synthase 1
    OAS1
    		302Annotation score:

    Annotation score:2 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    H0YIB8H0YIB8_HUMAN
    2'-5'-oligoadenylate synthase 1
    OAS1
    		130Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    F8VPW7F8VPW7_HUMAN
    2'-5'-oligoadenylate synthase 1
    OAS1
    		83Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    F8VUC8F8VUC8_HUMAN
    2'-5'-oligoadenylate synthase 1
    OAS1
    		177Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    S4R3A5S4R3A5_HUMAN
    2'-5'-oligoadenylate synthase 1
    OAS1
    		22Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    C6EMZ7C6EMZ7_HUMAN
    2'-5' oligoadenylate synthetase 1 p...
    OAS1
    		15Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

    <p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

    The sequence AAA39857 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
    The sequence AAA39858 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
    The sequence AAA59955 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
    The sequence BAD96726 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated
    The sequence CAA26497 differs from that shown. Reason: Erroneous gene model prediction.Curated
    The sequence CAA30164 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

    Experimental Info

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti18D → E in AAA39857 (PubMed:1651324).Curated1
    Sequence conflicti111R → S in AAH71981 (PubMed:15489334).Curated1
    Sequence conflicti115F → L in AAB59552 (PubMed:2416561).Curated1
    Sequence conflicti115F → L in AAB59553 (PubMed:2416561).Curated1
    Sequence conflicti115F → L in CAA26633 (PubMed:2416561).Curated1
    Sequence conflicti120E → V in BAD96726 (Ref. 10) Curated1
    Sequence conflicti122Q → QE in AAA39858 (PubMed:1651324).Curated1
    Sequence conflicti157G → D in AAA39857 (PubMed:1651324).Curated1
    Sequence conflicti176E → D in AAA39858 (PubMed:1651324).Curated1
    Sequence conflicti295R → T in CAB51602 (PubMed:3753689).Curated1
    Sequence conflicti315G → R in CAB51602 (PubMed:3753689).Curated1
    Isoform p48 (identifier: P00973-3)
    Sequence conflicti397G → R in AAA39858 (PubMed:1651324).Curated1
    Sequence conflicti397G → R in AAW63050 (PubMed:17024523).Curated1
    Sequence conflicti397G → R in CAA26497 (PubMed:2411547).Curated1

    Natural variant

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_06047131N → D1 PublicationCorresponds to variant dbSNP:rs1050994Ensembl.1
    Natural variantiVAR_060472127G → R. Corresponds to variant dbSNP:rs4767022Ensembl.1
    Natural variantiVAR_034872162G → S9 PublicationsCorresponds to variant dbSNP:rs1131454EnsemblClinVar.1
    Natural variantiVAR_060473352A → T3 PublicationsCorresponds to variant dbSNP:rs1131476Ensembl.1
    Natural variantiVAR_057658354D → G. Corresponds to variant dbSNP:rs35919998Ensembl.1
    Natural variantiVAR_057659361R → T3 PublicationsCorresponds to variant dbSNP:rs1051042Ensembl.1

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_003740347 – 400AESNS…TCTIL → TQHTPGSIHPTGRRGLDLHH PLNASASWGKGLQCYLDQFL HFQVGLLIQRGQSSSVSWCI IQDRTQVS in isoform p48. 2 PublicationsAdd BLAST54
    Alternative sequenceiVSP_027804347 – 382AESNS…HRPST → VNLTLVGRRNYPIISEHAVN LQQTRRASLSYSFQVA in isoform p44. 1 PublicationAdd BLAST36
    Alternative sequenceiVSP_003738347 – 364AESNS…RRYQK → VRPPASSLPFIPAPLHEA in isoform p41. 8 PublicationsAdd BLAST18
    Alternative sequenceiVSP_003739365 – 400Missing in isoform p41. 8 PublicationsAdd BLAST36
    Alternative sequenceiVSP_027805383 – 400Missing in isoform p44. 1 PublicationAdd BLAST18

    Sequence databases

    Select the link destinations:

    EMBL nucleotide sequence database

    More...    EMBLi

    GenBank nucleotide sequence database

    More...    GenBanki

    DNA Data Bank of Japan; a nucleotide sequence database

    More...    DDBJi
    Links Updated
    		M11809 M11808 Genomic DNA Translation: AAB59552.1
    M11810 Genomic DNA Translation: AAB59553.1
    X02874 mRNA Translation: CAA26633.1
    X02875 mRNA Translation: CAA26634.1
    X04371 mRNA Translation: CAB51602.1
    D00068 mRNA Translation: BAA00047.1
    M63849 Genomic DNA Translation: AAA39857.1 Different initiation.
    M63850 Genomic DNA Translation: AAA39858.1 Different initiation.
    AJ629455 mRNA Translation: CAF33358.1
    AY730628 mRNA Translation: AAW63050.1
    DQ445949 Genomic DNA Translation: ABE27977.1
    AK291003 mRNA Translation: BAF83692.1
    BT006785 mRNA Translation: AAP35431.1
    AK223006 mRNA Translation: BAD96726.1 Different initiation.
    AC004551 Genomic DNA No translation available.
    BC000562 mRNA Translation: AAH00562.4
    BC061587 mRNA Translation: AAH61587.1
    BC071981 mRNA Translation: AAH71981.3
    X06560 Genomic DNA Translation: CAA29803.1
    M18099 Genomic DNA Translation: AAA59955.1 Different initiation.
    X07179 Genomic DNA Translation: CAA30164.1 Different initiation.
    X02661 mRNA Translation: CAA26497.1 Sequence problems.

    The Consensus CDS (CCDS) project

    More...    CCDSi    		CCDS31905.1 [P00973-3]
    CCDS41838.1 [P00973-1]
    CCDS44980.1 [P00973-2]

    Protein sequence database of the Protein Information Resource

    More...    PIRi    		A39417 SYMSO2
    A91013 SYHU16
    B24359 SYHU18
    B39417 SYMSO3

    NCBI Reference Sequences

    More...    RefSeqi    		NP_001027581.1, NM_001032409.2 [P00973-3]
    NP_001307080.1, NM_001320151.1
    NP_002525.2, NM_002534.3 [P00973-2]
    NP_058132.2, NM_016816.3 [P00973-1]

    Genome annotation databases

    Ensembl eukaryotic genome annotation project

    More...    Ensembli    		ENST00000202917; ENSP00000202917; ENSG00000089127 [P00973-1]
    ENST00000445409; ENSP00000388001; ENSG00000089127 [P00973-3]
    ENST00000452357; ENSP00000415721; ENSG00000089127 [P00973-2]

    Database of genes from NCBI RefSeq genomes

    More...    GeneIDi    		4938

    KEGG: Kyoto Encyclopedia of Genes and Genomes

    More...    KEGGi    		hsa:4938

    UCSC genome browser

    More...    UCSCi    		uc001tub.4 human [P00973-1]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    <p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

    <p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    		M11809 M11808 Genomic DNA Translation: AAB59552.1
    M11810 Genomic DNA Translation: AAB59553.1
    X02874 mRNA Translation: CAA26633.1
    X02875 mRNA Translation: CAA26634.1
    X04371 mRNA Translation: CAB51602.1
    D00068 mRNA Translation: BAA00047.1
    M63849 Genomic DNA Translation: AAA39857.1 Different initiation.
    M63850 Genomic DNA Translation: AAA39858.1 Different initiation.
    AJ629455 mRNA Translation: CAF33358.1
    AY730628 mRNA Translation: AAW63050.1
    DQ445949 Genomic DNA Translation: ABE27977.1
    AK291003 mRNA Translation: BAF83692.1
    BT006785 mRNA Translation: AAP35431.1
    AK223006 mRNA Translation: BAD96726.1 Different initiation.
    AC004551 Genomic DNA No translation available.
    BC000562 mRNA Translation: AAH00562.4
    BC061587 mRNA Translation: AAH61587.1
    BC071981 mRNA Translation: AAH71981.3
    X06560 Genomic DNA Translation: CAA29803.1
    M18099 Genomic DNA Translation: AAA59955.1 Different initiation.
    X07179 Genomic DNA Translation: CAA30164.1 Different initiation.
    X02661 mRNA Translation: CAA26497.1 Sequence problems.
    CCDSiCCDS31905.1 [P00973-3]
    CCDS41838.1 [P00973-1]
    CCDS44980.1 [P00973-2]
    PIRiA39417 SYMSO2
    A91013 SYHU16
    B24359 SYHU18
    B39417 SYMSO3
    RefSeqiNP_001027581.1, NM_001032409.2 [P00973-3]
    NP_001307080.1, NM_001320151.1
    NP_002525.2, NM_002534.3 [P00973-2]
    NP_058132.2, NM_016816.3 [P00973-1]

    3D structure databases

    Select the link destinations:

    Protein Data Bank Europe

    More...    PDBei

    Protein Data Bank RCSB

    More...    RCSB PDBi

    Protein Data Bank Japan

    More...    PDBji
    Links Updated
    		PDB entryMethodResolution (Å)ChainPositionsPDBsum
    4IG8X-ray2.70A1-347[»]
    SMRiP00973
    ModBaseiSearch...
    PDBe-KBiSearch...

    Protein-protein interaction databases

    BioGridi110992, 9 interactors
    IntActiP00973, 15 interactors
    MINTiP00973
    STRINGi9606.ENSP00000388001

    Chemistry databases

    DrugBankiDB02987 Cysteine-S-Acetamide

    PTM databases

    iPTMnetiP00973
    PhosphoSitePlusiP00973

    Polymorphism and mutation databases

    BioMutaiOAS1
    DMDMi296439492

    Proteomic databases

    EPDiP00973
    jPOSTiP00973
    MassIVEiP00973
    MaxQBiP00973
    PaxDbiP00973
    PeptideAtlasiP00973
    PRIDEiP00973
    ProteomicsDBi51294 [P00973-1]
    51295 [P00973-2]
    51296 [P00973-3]
    51297 [P00973-4]

    Protocols and materials databases

    The DNASU plasmid repository

    More...    DNASUi    		4938

    Genome annotation databases

    EnsembliENST00000202917; ENSP00000202917; ENSG00000089127 [P00973-1]
    ENST00000445409; ENSP00000388001; ENSG00000089127 [P00973-3]
    ENST00000452357; ENSP00000415721; ENSG00000089127 [P00973-2]
    GeneIDi4938
    KEGGihsa:4938
    UCSCiuc001tub.4 human [P00973-1]

    Organism-specific databases

    Comparative Toxicogenomics Database

    More...    CTDi    		4938
    DisGeNETi4938

    GeneCards: human genes, protein and diseases

    More...    GeneCardsi    		OAS1
    HGNCiHGNC:8086 OAS1
    HPAiCAB021104
    HPA003657
    MalaCardsiOAS1
    MIMi164350 gene
    neXtProtiNX_P00973
    OpenTargetsiENSG00000089127
    Orphaneti264675 Hereditary pulmonary alveolar proteinosis
    PharmGKBiPA31875

    GenAtlas: human gene database

    More...    GenAtlasi    		Search...

    Phylogenomic databases

    eggNOGiKOG0001 Eukaryota
    COG5272 LUCA
    GeneTreeiENSGT00510000046406
    KOiK14216
    OMAiVGRRHYT
    OrthoDBi611234at2759
    PhylomeDBiP00973
    TreeFamiTF329749

    Enzyme and pathway databases

    BioCyciMetaCyc:ENSG00000089127-MONOMER
    ReactomeiR-HSA-877300 Interferon gamma signaling
    R-HSA-8983711 OAS antiviral response
    R-HSA-909733 Interferon alpha/beta signaling

    Miscellaneous databases

    ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

    More...    ChiTaRSi    		OAS1 human

    The Gene Wiki collection of pages on human genes and proteins

    More...    GeneWikii    		OAS1

    Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

    More...    GenomeRNAii    		4938
    PharosiP00973 Tbio

    Protein Ontology

    More...    PROi    		PR:P00973
    RNActiP00973 protein

    The Stanford Online Universal Resource for Clones and ESTs

    More...    SOURCEi    		Search...

    Gene expression databases

    BgeeiENSG00000089127 Expressed in ectocervix and 190 other tissues
    ExpressionAtlasiP00973 baseline and differential
    GenevisibleiP00973 HS

    Family and domain databases

    Gene3Di1.10.1410.20, 1 hit
    InterProiView protein in InterPro
    IPR006117 2-5-oligoadenylate_synth_CS
    IPR006116 2-5-oligoadenylate_synth_N
    IPR018952 2-5-oligoAdlate_synth_1_dom2/C
    IPR038121 2-5-oligoAdlate_synth_2_sf
    IPR026774 2-5A_synthase
    IPR002934 Polymerase_NTP_transf_dom
    PANTHERiPTHR11258 PTHR11258, 1 hit
    PfamiView protein in Pfam
    PF01909 NTP_transf_2, 1 hit
    PF10421 OAS1_C, 1 hit
    PROSITEiView protein in PROSITE
    PS00832 25A_SYNTH_1, 1 hit
    PS00833 25A_SYNTH_2, 1 hit
    PS50152 25A_SYNTH_3, 1 hit

    ProtoNet; Automatic hierarchical classification of proteins

    More...    ProtoNeti    		Search...

    MobiDB: a database of protein disorder and mobility annotations

    More...    MobiDBi    		Search...

    <p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

    <p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiOAS1_HUMAN
    <p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P00973
    Secondary accession number(s): A8K4N8
    , P04820, P29080, P29081, P78485, P78486, Q16700, Q16701, Q1PG42, Q3ZM01, Q53GC5, Q53YA4, Q6A1Z3, Q6IPC6, Q6P7N9, Q96J61
    <p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 21, 1986
    Last sequence update: May 18, 2010
    Last modified: February 26, 2020
    This is version 209 of the entry and version 4 of the sequence. See complete history.
    <p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    <p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

    Keywords - Technical termi

    3D-structure, Reference proteome

    Documents

    1. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    2. SIMILARITY comments
      Index of protein domains and families
    3. Human chromosome 12
      Human chromosome 12: entries, gene names and cross-references to MIM
    4. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    5. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    6. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again