UniProtKB - P00806 (ENLYS_BPT7)

BLAST

>sp|P00806|ENLYS_BPT7 Endolysin OS=Enterobacteria phage T7 OX=10760 GN=3.5 PE=1 SV=4
MARVQFKQRESTDAIFVHCSATKPSQNVGVREIRQWHKEQGWLDVGYHFIIKRDGTVEAG
RDEMAVGSHAKGYNHNSIGVCLVGGIDDKGKFDANFTPAQMQSLRSLLVTLLAKYEGAVL
RAHHEVAPKACPSFDLKRWWEKNELVTSDRG

Align
Format
Add to basket Added to basket
History
Entry version 123 (10 Oct 2018)
Sequence version 4 (23 Jan 2007)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

Endolysin

Gene

3.5

Organism

Enterobacteria phage T7 (Bacteriophage T7)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Plays an important role in the switch between viral transcription and genome replication. Once produced in sufficient amount, interacts with and inhibits the viral RNA polymerase that becomes unable to produce additional late transcripts. This lysozyme-polymerase complex in turn plays an active role in viral genome replication and packaging.UniRule annotation3 Publications

Endolysin with amidase activity that degrades host peptidoglycans and participates with the holin and spanin proteins in the sequential events which lead to the programmed host cell lysis releasing the mature viral particles. Once the holin has permeabilized the host cell membrane, the endolysin can reach the periplasm and breaking down the peptidoglycan layer.UniRule annotation1 Publication

Catalytic activityⁱ

Hydrolyzes the link between N-acetylmuramoyl residues and L-amino acid residues in certain cell-wall glycopeptides.UniRule annotation1 Publication

Cofactorⁱ

Zn²⁺UniRule annotation1 PublicationNote: Zn²⁺ is required for amidase activity.UniRule annotation1 Publication

Activity regulationⁱ

Binding to the viral RNA polymerase inhibits amidase activity.UniRule annotation1 Publication

Sites

Feature key	Position(s)	DescriptionActions	Length
Metal bindingⁱ	18	ZincUniRule annotationCombined sources1 Publication	1
Siteⁱ	47	Essential for amidase activity and zinc hydrate coordinationUniRule annotation1 Publication	1
Metal bindingⁱ	123	ZincUniRule annotationCombined sources1 Publication	1
Siteⁱ	129	Important for catalytic activityCombined sources1 Publication	1
Metal bindingⁱ	131	ZincUniRule annotationCombined sources1 Publication	1

GO - Molecular functionⁱ

N-acetylmuramoyl-L-alanine amidase activity
Source: UniProtKB
Inferred from direct assayⁱ
- 8171031
zinc ion binding Source: InterPro

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

cytolysis Source: UniProtKB-KW
cytolysis by virus of host cell
Source: UniProtKB
Inferred from direct assayⁱ
- 15223315
defense response to bacterium Source: UniProtKB-KW
negative regulation of viral transcription
Source: UniProtKB
Inferred from direct assayⁱ
- 9192997
peptidoglycan catabolic process Source: UniProtKB-UniRule

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Antimicrobial, Bacteriolytic enzyme, Hydrolase
Biological process	Cytolysis, Host cell lysis by virus, Viral release from host cell
Ligand	Metal-binding, Zinc

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: EndolysinUniRule annotation (EC:3.5.1.28UniRule annotation1 Publication) Alternative name(s): N-acetylmuramoyl-L-alanine amidaseUniRule annotation
Gene namesⁱ	Ordered Locus Names:3.5
Organismⁱ	Enterobacteria phage T7 (Bacteriophage T7)
Taxonomic identifierⁱ	10760 [NCBI]
Taxonomic lineageⁱ	Viruses › dsDNA viruses, no RNA stage › Caudovirales › Podoviridae › Autographivirinae › T7virus › Escherichia virus T7
Virus hostⁱ	Escherichia coli [TaxID: 562]
Proteomesⁱ	UP000000840 Componentⁱ: Genome

Subcellular locationⁱ

Host cytoplasm
UniRule annotation
Manual assertion according to rulesⁱ
- HAMAP-Rule:MF_04111

Note:

The endolysin is cytoplasmic, but can reach the periplasmic space with the help of the holins which disrupt the host cell membrane.UniRule annotation

GO - Cellular componentⁱ

host cell cytoplasm Source: UniProtKB-SubCell

View the complete GO annotation on QuickGO ...

Keywords - Cellular componentⁱ

Host cytoplasm

Pathology & Biotechⁱ

Mutagenesis

Feature key	Position(s)	DescriptionActions	Length
Mutagenesisⁱ	18	H → N, Q or R: Complete loss of amidase activity. 1 Publication	1
Mutagenesisⁱ	47	Y → D, F or L: Complete loss of amidase activity. 1 Publication	1
Mutagenesisⁱ	129	K → I, M, Q, W or Y: Complete loss of amidase activity. 1 Publication	1

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Initiator methionineⁱ		Removed; by host
ChainⁱPRO_0000164410	2 – 151	EndolysinAdd BLAST		150

Expressionⁱ

Keywords - Developmental stageⁱ

Late protein

Interactionⁱ

Subunit structureⁱ

Interacts with the viral RNA polymerase.UniRule annotation2 Publications

Protein-protein interaction databases

Database of interacting proteins More...DIPⁱ	DIP-6090N
IntActⁱ	P00806, 1 interactor
Molecular INTeraction database More...MINTⁱ	P00806

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Beta strandⁱ	14 – 19	Combined sources	6
Helixⁱ	30 – 39	Combined sources	10
Beta strandⁱ	48 – 51	Combined sources	4
Beta strandⁱ	53 – 55	Combined sources	3
Beta strandⁱ	57 – 59	Combined sources	3
Beta strandⁱ	68 – 70	Combined sources	3
Helixⁱ	74 – 76	Combined sources	3
Beta strandⁱ	77 – 83	Combined sources	7
Beta strandⁱ	90 – 92	Combined sources	3
Helixⁱ	98 – 114	Combined sources	17
Turnⁱ	115 – 117	Combined sources	3
Beta strandⁱ	119 – 122	Combined sources	4
Helixⁱ	123 – 125	Combined sources	3
Beta strandⁱ	127 – 129	Combined sources	3
Helixⁱ	136 – 142	Combined sources	7

Show more details

3D structure databases

ProteinModelPortalⁱ	P00806
SMRⁱ	P00806
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ	P00806

EvolutionaryTraceⁱ

P00806

Family & Domainsⁱ

Domains and Repeats

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Domainⁱ	10 – 132	N-acetylmuramoyl-L-alanine amidaseSequence analysisAdd BLAST		123

Sequence similaritiesⁱ

Belongs to the N-acetylmuramoyl-L-alanine amidase 2 family.UniRule annotation

Phylogenomic databases

Database of Orthologous Groups More...OrthoDBⁱ	VOG090000Z1

OrthoDBⁱ

VOG090000Z1

Family and domain databases

Conserved Domains Database More...CDDⁱ	cd06583 PGRP, 1 hit
Gene3Dⁱ	3.40.80.10, 1 hit
HAMAPⁱ	MF_04111 ENDOLYSIN_T7, 1 hit
InterProⁱ	View protein in InterPro IPR036505 Amidase/PGRP_sf IPR002502 Amidase_domain IPR034689 Endolysin_T7_type IPR015510 PGRP IPR006619 PGRP_domain_met/bac
PANTHERⁱ	PTHR11022 PTHR11022, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF01510 Amidase_2, 1 hit
SMARTⁱ	View protein in SMART SM00644 Ami_2, 1 hit SM00701 PGRP, 1 hit
SUPFAMⁱ	SSF55846 SSF55846, 1 hit

Sequenceⁱ

Sequence statusⁱ: Complete.

Sequence processingⁱ: The displayed sequence is further processed into a mature form.

P00806-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MARVQFKQRE STDAIFVHCS ATKPSQNVGV REIRQWHKEQ GWLDVGYHFI 
        60         70         80         90        100
IKRDGTVEAG RDEMAVGSHA KGYNHNSIGV CLVGGIDDKG KFDANFTPAQ 
       110        120        130        140        150
MQSLRSLLVT LLAKYEGAVL RAHHEVAPKA CPSFDLKRWW EKNELVTSDR 

G

Length:151

Mass (Da):16,979

Last modified:January 23, 2007 - v4

Checksum:ⁱC36BC018754A4146

Experimental Info

Feature key	Position(s)	DescriptionActions	Length
Sequence conflictⁱ	90	G → V in AAB32819 (PubMed:7801634).Curated	1
Sequence conflictⁱ	119	V → G (PubMed:6864790).Curated	1
Sequence conflictⁱ	119	V → G (PubMed:7310871).Curated	1
Sequence conflictⁱ	119	V → G (PubMed:7801634).Curated	1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	V01146 Genomic DNA Translation: CAA24403.1 V01127 Genomic DNA Translation: CAA24346.1 S75616 Genomic DNA Translation: AAB32819.1
PIRⁱ	C94615 MUBPA7
NCBI Reference Sequences More...RefSeqⁱ	NP_041973.1, NC_001604.1

Genome annotation databases

GeneIDⁱ	1261077
KEGGⁱ	vg:1261077

Protein	Similar proteins		Species	Score	Length	Source
P00806	Lysozyme		METMZ		151	UniRef100_P00806
Endolysin		BPT7		151
Endolysin		Enterobacteria phage T7.1		151
Lysozyme (Fragment)		METMZ		113
Lysozyme (Fragment)		BPT7		96

Protein	Similar proteins		Species	Score	Length	Source
P00806	Endolysin		BPT3		151	UniRef90_P00806
Lysozyme		METMZ		151
Endolysin		BPT7		151
Endolysin		Enterobacteria phage T7.1		151
Endolysin		Enterobacteria phage T7M		151
+38

Protein	Similar proteins		Species	Score	Length	Source
P00806	Endolysin		BPT3		151	UniRef50_P00806
Lysozyme		METMZ		151
Endolysin		BPT7		151
Endolysin		Enterobacteria phage T7.1		151
Endolysin		Serratia phage SM9-3Y		151
+141

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	V01146 Genomic DNA Translation: CAA24403.1 V01127 Genomic DNA Translation: CAA24346.1 S75616 Genomic DNA Translation: AAB32819.1
PIRⁱ	C94615 MUBPA7
RefSeqⁱ	NP_041973.1, NC_001604.1

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	1ARO	X-ray	2.80	L	1-151	[»]
	1LBA	X-ray	2.20	A	7-151	[»]
ProteinModelPortalⁱ	P00806
SMRⁱ	P00806
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

DIPⁱ	DIP-6090N
IntActⁱ	P00806, 1 interactor
MINTⁱ	P00806

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

GeneIDⁱ	1261077
KEGGⁱ	vg:1261077

Phylogenomic databases

OrthoDBⁱ	VOG090000Z1

OrthoDBⁱ

VOG090000Z1

Miscellaneous databases

EvolutionaryTraceⁱ	P00806

EvolutionaryTraceⁱ

P00806

Family and domain databases

CDDⁱ	cd06583 PGRP, 1 hit
Gene3Dⁱ	3.40.80.10, 1 hit
HAMAPⁱ	MF_04111 ENDOLYSIN_T7, 1 hit
InterProⁱ	View protein in InterPro IPR036505 Amidase/PGRP_sf IPR002502 Amidase_domain IPR034689 Endolysin_T7_type IPR015510 PGRP IPR006619 PGRP_domain_met/bac
PANTHERⁱ	PTHR11022 PTHR11022, 1 hit
Pfamⁱ	View protein in Pfam PF01510 Amidase_2, 1 hit
SMARTⁱ	View protein in SMART SM00644 Ami_2, 1 hit SM00701 PGRP, 1 hit
SUPFAMⁱ	SSF55846 SSF55846, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	ENLYS_BPT7
Accessionⁱ	P00806Primary (citable) accession number: P00806 Secondary accession number(s): Q38567
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	July 21, 1986
	Last sequence update:	January 23, 2007
	Last modified:	October 10, 2018
	This is version 123 of the entry and version 4 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Viral Protein Annotation Program

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P00806 (ENLYS_BPT7)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Endolysin

3.5

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Sites

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

GO - Cellular componenti

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Keywords - Developmental stagei

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

Family and domain databases

Experimental Info

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Protocols and materials databases

Genome annotation databases

Phylogenomic databases

Miscellaneous databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

GO - Cellular componentⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Expressionⁱ

Keywords - Developmental stageⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ