Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P00750 (TPA_HUMAN)

Protein

Tissue-type plasminogen activator

Gene

PLAT

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Converts the abundant, but inactive, zymogen plasminogen to plasmin by hydrolyzing a single Arg-Val bond in plasminogen. By controlling plasmin-mediated proteolysis, it plays an important role in tissue remodeling and degradation, in cell migration and many other physiopathological events. Plays a direct role in facilitating neuronal migration.

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

  • Specific cleavage of Arg-|-Val bond in plasminogen to form plasmin. EC:3.4.21.68

<p>This subsection of the ‘Function’ section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Inhibited by SERPINA5.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei102Important for binding to LRP11
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei357Charge relay system1 Publication1
Active sitei406Charge relay system1 Publication1
Sitei464Important for single-chain activity1
Sitei512Important for single-chain activity1
Active sitei513Charge relay system1 Publication1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • phosphoprotein binding Source: AgBase
  • serine-type endopeptidase activity Source: BHF-UCL
  • signaling receptor binding Source: AgBase
View the complete GO annotation on QuickGO ...

GO - Biological processi

View the complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Protease, Serine protease
Biological processPlasminogen activation

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...BRENDAi		3.4.21.68 2681

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-186797 Signaling by PDGF
R-HSA-75205 Dissolution of Fibrin Clot

SIGNOR Signaling Network Open Resource

More...SIGNORi		P00750

Protein family/group databases

MEROPS protease database

More...MEROPSi		S01.232

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Tissue-type plasminogen activator (EC:3.4.21.68)
Short name:
t-PA
Short name:
t-plasminogen activator
Short name:
tPA
Alternative name(s):
INN: Alteplase
INN: Reteplase
Cleaved into the following 2 chains:
Tissue-type plasminogen activator chain A
Tissue-type plasminogen activator chain B
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PLAT
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 8

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000104368.17

Human Gene Nomenclature Database

More...HGNCi		HGNC:9051 PLAT

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		173370 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P00750

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Increased activity of TPA results in increased fibrinolysis of fibrin blood clots that is associated with excessive bleeding. Defective release of TPA results in hypofibrinolysis that can lead to thrombosis or embolism.1 Publication

<p>This subsection of the ‘Pathology and Biotech’ section describes the use of a protein as a pharmaceutical drug. It indicates the name of the drug, the name of the firm that commercializes it and explains in a few words in which context the drug is used. In some cases, drugs that are under development are also described.<p><a href='/help/pharmaceutical_use' target='_top'>More...</a></p>Pharmaceutical usei

Available under the names Activase (Genentech) and Retavase (Centocor and Roche) [Retavase is a fragment of TPA that contains kringle 2 and the protease domain; it was also known as BM 06.022]. Used in Acute Myocardial Infarction (AMI), in Acute Ischemic Stroke (AIS) and Pulmonary Embolism (PE) to initiate fibrinolysis.

Organism-specific databases

DisGeNET

More...DisGeNETi		5327

MalaCards human disease database

More...MalaCardsi		PLAT

Open Targets

More...OpenTargetsi		ENSG00000104368

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		480528 Lethal hydranencephaly-diaphragmatic hernia syndrome

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA33381

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL1873

Drug and drug target database

More...DrugBanki		DB07684 5-(DIMETHYLAMINO)-2-NAPHTHALENESULFONIC ACID
DB00513 Aminocaproic Acid
DB06404 C1 Esterase Inhibitor (Human)
DB09228 C1 Esterase Inhibitor (Recombinant)
DB01050 Ibuprofen
DB01088 Iloprost
DB00013 Urokinase

IUPHAR/BPS Guide to PHARMACOLOGY

More...GuidetoPHARMACOLOGYi		2392

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		PLAT

Domain mapping of disease mutations (DMDM)

More...DMDMi		137119

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 221 PublicationAdd BLAST22
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes a propeptide, which is a part of a protein that is cleaved during maturation or activation. Once cleaved, a propeptide generally has no independent biological function.<p><a href='/help/propep' target='_top'>More...</a></p>PropeptideiPRO_000002834823 – 321 Publication10
PropeptideiPRO_000002834933 – 35Removed by plasmin1 Publication3
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000002835036 – 562Tissue-type plasminogen activatorAdd BLAST527
ChainiPRO_000002835136 – 310Tissue-type plasminogen activator chain AAdd BLAST275
ChainiPRO_0000028352311 – 562Tissue-type plasminogen activator chain BAdd BLAST252

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi41 ↔ 711 Publication
Disulfide bondi69 ↔ 781 Publication
Disulfide bondi86 ↔ 971 Publication
Disulfide bondi91 ↔ 1081 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>GlycosylationiCAR_00002996O-linked (Fuc) threonine1 Publication1
Disulfide bondi110 ↔ 1191 Publication
Disulfide bondi127 ↔ 208By similarity
Disulfide bondi148 ↔ 190By similarity
Glycosylationi152N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi179 ↔ 203By similarity
Disulfide bondi215 ↔ 2961 Publication
GlycosylationiCAR_000030219N-linked (GlcNAc...) asparagine; partial1 Publication1
Disulfide bondi236 ↔ 2781 Publication
Disulfide bondi267 ↔ 2911 Publication
Disulfide bondi299 ↔ 430Interchain (between A and B chains)PROSITE-ProRule annotation1 Publication
Disulfide bondi342 ↔ 358By similarity
Disulfide bondi350 ↔ 419By similarity
Disulfide bondi444 ↔ 519By similarity
Disulfide bondi476 ↔ 492By similarity
GlycosylationiCAR_000031483N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi509 ↔ 537By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

The single chain, almost fully active enzyme, can be further processed into a two-chain fully active form by a cleavage after Arg-310 catalyzed by plasmin, tissue kallikrein or factor Xa.
Differential cell-specific N-linked glycosylation gives rise to two glycoforms, type I (glycosylated at Asn-219) and type II (not glycosylated at Asn-219). The single chain type I glycoform is less readily converted into the two-chain form by plasmin, and the two-chain type I glycoform has a lower activity than the two-chain type II glycoform in the presence of fibrin.1 Publication
N-glycosylation of Asn-152; the bound oligomannosidic glycan is involved in the interaction with the mannose receptor.1 Publication
Characterization of O-linked glycan was studied in Bowes melanoma cell line.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei253Not glycosylated1

Keywords - PTMi

Cleavage on pair of basic residues, Disulfide bond, Glycoprotein, Zymogen

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		P00750

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P00750

MaxQB - The MaxQuant DataBase

More...MaxQBi		P00750

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P00750

PeptideAtlas

More...PeptideAtlasi		P00750

PRoteomics IDEntifications database

More...PRIDEi		P00750

ProteomicsDB human proteome resource

More...ProteomicsDBi		51281
51282 [P00750-2]
51283 [P00750-3]
51284 [P00750-4]

PTM databases

GlyConnect protein glycosylation platform

More...GlyConnecti		503
504
603

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P00750

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P00750

UniCarbKB; an annotated and curated database of glycan structures

More...UniCarbKBi		P00750

Miscellaneous databases

CutDB - Proteolytic event database

More...PMAP-CutDBi		P00750

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Synthesized in numerous tissues (including tumors) and secreted into most extracellular body fluids, such as plasma, uterine fluid, saliva, gingival crevicular fluid, tears, seminal fluid, and milk.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000104368 Expressed in 217 organ(s), highest expression level in metanephric glomerulus

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P00750 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P00750 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		CAB009335
HPA003412

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterodimer of chain A and chain B held by a disulfide bond. Forms a heterodimer with SERPINA5. Binds to fibrin with high affinity. This interaction leads to an increase in the catalytic efficiency of the enzyme between 100-fold and 1000-fold, due to an increase in affinity for plasminogen. Similarly, binding to heparin increases the activation of plasminogen. Binds to annexin A2, cytokeratin-8, fibronectin and laminin. Binds to mannose receptor and the low-density lipoprotein receptor-related protein (LRP1); these proteins are involved in TPA clearance. Yet unidentified interactions on endothelial cells and vascular smooth muscle cells (VSMC) lead to a 100-fold stimulation of plasminogen activation. In addition, binding to VSMC reduces TPA inhibition by PAI-1 by 30-fold. Binds LRP1B; binding is followed by internalization and degradation.

GO - Molecular functioni

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		111343, 40 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...ComplexPortali		CPX-494 tPA-PAI-1 complex

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...ELMi		P00750

Protein interaction database and analysis system

More...IntActi		P00750, 2 interactors

Molecular INTeraction database

More...MINTi		P00750

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000220809

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		P00750

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1562
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1A5HX-ray2.90A/B311-562[»]
C/D298-304[»]
1BDAX-ray3.35A/B298-562[»]
1PK2NMR-A209-298[»]
1PMLX-ray2.38A/B/C213-298[»]
1RTFX-ray2.30B311-562[»]
1TPGNMR-A36-126[»]
1TPKX-ray2.40A/B/C211-298[»]
1TPMNMR-A36-85[»]
1TPNNMR-A36-85[»]
5BRRX-ray3.16E311-562[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...ProteinModelPortali		P00750

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P00750

Database of comparative protein structure models

More...ModBasei		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		P00750

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini39 – 81Fibronectin type-IPROSITE-ProRule annotationAdd BLAST43
Domaini82 – 120EGF-likePROSITE-ProRule annotationAdd BLAST39
Domaini127 – 208Kringle 1PROSITE-ProRule annotationAdd BLAST82
Domaini215 – 296Kringle 2PROSITE-ProRule annotationAdd BLAST82
Domaini311 – 561Peptidase S1PROSITE-ProRule annotationAdd BLAST251

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni42 – 52Important for binding to annexin A2Add BLAST11

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Both FN1 and one of the kringle domains are required for binding to fibrin.
Both FN1 and EGF-like domains are important for binding to LRP1.
The FN1 domain mediates binding to annexin A2.
The second kringle domain is implicated in binding to cytokeratin-8 and to the endothelial cell surface binding site.

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the peptidase S1 family.PROSITE-ProRule annotation

Keywords - Domaini

EGF-like domain, Kringle, Repeat, Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3627 Eukaryota
COG5640 LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000158930

The HOVERGEN Database of Homologous Vertebrate Genes

More...HOVERGENi		HBG008633

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P00750

KEGG Orthology (KO)

More...KOi		K01343

Identification of Orthologs from Complete Genome Data

More...OMAi		PLVCMKD

Database of Orthologous Groups

More...OrthoDBi		1314811at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P00750

TreeFam database of animal gene trees

More...TreeFami		TF329901

Family and domain databases

Conserved Domains Database

More...CDDi		cd00061 FN1, 1 hit
cd00108 KR, 2 hits
cd00190 Tryp_SPc, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.40.20.10, 2 hits

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR013032 EGF-like_CS
IPR000742 EGF-like_dom
IPR000083 Fibronectin_type1
IPR000001 Kringle
IPR013806 Kringle-like
IPR018056 Kringle_CS
IPR038178 Kringle_sf
IPR009003 Peptidase_S1_PA
IPR001314 Peptidase_S1A
IPR026280 Tissue_plasm_act
IPR034811 tPA
IPR001254 Trypsin_dom
IPR018114 TRYPSIN_HIS
IPR033116 TRYPSIN_SER

The PANTHER Classification System

More...PANTHERi		PTHR44617 PTHR44617, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00008 EGF, 1 hit
PF00039 fn1, 1 hit
PF00051 Kringle, 2 hits
PF00089 Trypsin, 1 hit

PIRSF; a whole-protein classification database

More...PIRSFi		PIRSF001145 Tissue_plasm_act, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00722 CHYMOTRYPSIN

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00058 FN1, 1 hit
SM00130 KR, 2 hits
SM00020 Tryp_SPc, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF50494 SSF50494, 1 hit
SSF57440 SSF57440, 2 hits

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00022 EGF_1, 1 hit
PS01186 EGF_2, 1 hit
PS50026 EGF_3, 1 hit
PS01253 FN1_1, 1 hit
PS51091 FN1_2, 1 hit
PS00021 KRINGLE_1, 2 hits
PS50070 KRINGLE_2, 2 hits
PS50240 TRYPSIN_DOM, 1 hit
PS00134 TRYPSIN_HIS, 1 hit
PS00135 TRYPSIN_SER, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P00750-1) [UniParc]FASTAAdd to basket
Also known as: Long

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDAMKRGLCC VLLLCGAVFV SPSQEIHARF RRGARSYQVI CRDEKTQMIY 
        60         70         80         90        100
QQHQSWLRPV LRSNRVEYCW CNSGRAQCHS VPVKSCSEPR CFNGGTCQQA 
       110        120        130        140        150
LYFSDFVCQC PEGFAGKCCE IDTRATCYED QGISYRGTWS TAESGAECTN 
       160        170        180        190        200
WNSSALAQKP YSGRRPDAIR LGLGNHNYCR NPDRDSKPWC YVFKAGKYSS 
       210        220        230        240        250
EFCSTPACSE GNSDCYFGNG SAYRGTHSLT ESGASCLPWN SMILIGKVYT 
       260        270        280        290        300
AQNPSAQALG LGKHNYCRNP DGDAKPWCHV LKNRRLTWEY CDVPSCSTCG 
       310        320        330        340        350
LRQYSQPQFR IKGGLFADIA SHPWQAAIFA KHRRSPGERF LCGGILISSC 
       360        370        380        390        400
WILSAAHCFQ ERFPPHHLTV ILGRTYRVVP GEEEQKFEVE KYIVHKEFDD 
       410        420        430        440        450
DTYDNDIALL QLKSDSSRCA QESSVVRTVC LPPADLQLPD WTECELSGYG 
       460        470        480        490        500
KHEALSPFYS ERLKEAHVRL YPSSRCTSQH LLNRTVTDNM LCAGDTRSGG 
       510        520        530        540        550
PQANLHDACQ GDSGGPLVCL NDGRMTLVGI ISWGLGCGQK DVPGVYTKVT 
       560 
NYLDWIRDNM RP
Length:562
Mass (Da):62,917
Last modified:July 21, 1986 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB7EC9B1A5E3FDC4D
GO
Isoform 2 (identifier: P00750-2) [UniParc]FASTAAdd to basket
Also known as: Short

The sequence of this isoform differs from the canonical sequence as follows:
     269-291: NPDGDAKPWCHVLKNRRLTWEYC → TGRSVSSPATASMRPCPLSIRSG
     292-562: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:291
Mass (Da):32,175
Checksum:i874E38C52F50FF5D
GO
Isoform 3 (identifier: P00750-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     39-85: VICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKS → G

Note: No experimental confirmation available.
Show »
Length:516
Mass (Da):57,371
Checksum:iBAB31901FDC96800
GO
Isoform 4 (identifier: P00750-4) [UniParc]FASTAAdd to basket
Also known as: Neonatal

The sequence of this isoform differs from the canonical sequence as follows:
     1-40: MDAMKRGLCCVLLLCGAVFVSPSQEIHARFRRGARSYQVI → MAS
     79-208: Missing.

Note: No experimental confirmation available.
Show »
Length:395
Mass (Da):44,373
Checksum:i55BB9FB94F65DF4F
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E7ESF4E7ESF4_HUMAN
Plasminogen activator
PLAT
499Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B4DN26B4DN26_HUMAN
Tissue-type plasminogen activator
PLAT
473Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B4DNJ1B4DNJ1_HUMAN
Tissue-type plasminogen activator
PLAT
436Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RGA1E5RGA1_HUMAN
Tissue-type plasminogen activator
PLAT
178Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RHG4E5RHG4_HUMAN
Tissue-type plasminogen activator
PLAT
157Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YBH9H0YBH9_HUMAN
Tissue-type plasminogen activator
PLAT
96Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti93N → T in AAB59510 (PubMed:6089198).Curated1
Sequence conflicti159 – 160KP → NA in CAA31489 (PubMed:2107528).Curated2
Sequence conflicti247K → N in AAO34406 (Ref. 9) Curated1
Sequence conflicti283N → S in AAH95403 (PubMed:15489334).Curated1
Sequence conflicti333 – 334RR → EE in AAK11956 (Ref. 8) Curated2
Sequence conflicti389V → C in AAK11956 (Ref. 8) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_02018134A → D1 PublicationCorresponds to variant dbSNP:rs8178733Ensembl.1
Natural variantiVAR_038732136R → S1 PublicationCorresponds to variant dbSNP:rs8178747Ensembl.1
Natural variantiVAR_038733146A → T1 PublicationCorresponds to variant dbSNP:rs8178748Ensembl.1
Natural variantiVAR_011783164R → W1 PublicationCorresponds to variant dbSNP:rs2020921Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0280291 – 40MDAMK…SYQVI → MAS in isoform 4. 1 PublicationAdd BLAST40
Alternative sequenceiVSP_01595739 – 85VICRD…VPVKS → G in isoform 3. 2 PublicationsAdd BLAST47
Alternative sequenceiVSP_02803079 – 208Missing in isoform 4. 1 PublicationAdd BLAST130
Alternative sequenceiVSP_005411269 – 291NPDGD…TWEYC → TGRSVSSPATASMRPCPLSI RSG in isoform 2. 1 PublicationAdd BLAST23
Alternative sequenceiVSP_005412292 – 562Missing in isoform 2. 1 PublicationAdd BLAST271

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
L00153
, L00141, L00142, L00143, L00144, L00145, L00146, L00147, L00148, L00149, L00150, L00151 Genomic DNA Translation: AAB59510.1
K03021 Genomic DNA Translation: AAA98809.1
M15518 mRNA Translation: AAA60111.1
M18182 mRNA Translation: AAA36800.1
X07393 mRNA Translation: CAA30302.1
X13097 mRNA Translation: CAA31489.1
AF260825 mRNA Translation: AAK11956.1
AY221101 mRNA Translation: AAO34406.1
AK289387 mRNA Translation: BAF82076.1
AK290575 mRNA Translation: BAF83264.1
AK313342 mRNA Translation: BAG36145.1
BT007060 mRNA Translation: AAP35709.1
AY291060 Genomic DNA Translation: AAP34246.1
CH471080 Genomic DNA Translation: EAW63235.1
CH471080 Genomic DNA Translation: EAW63233.1
BC002795 mRNA Translation: AAH02795.3
BC007231 mRNA Translation: AAH07231.1
BC013968 mRNA Translation: AAH13968.3
BC018636 mRNA Translation: AAH18636.3
BC095403 mRNA Translation: AAH95403.1
M11890, M11889 Genomic DNA Translation: AAA61213.1
D01096 mRNA Translation: BAA00881.1
V00570 mRNA Translation: CAA23833.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS6126.1 [P00750-1]
CCDS6127.1 [P00750-3]

Protein sequence database of the Protein Information Resource

More...PIRi		A94004 UKHUT
I38098

NCBI Reference Sequences

More...RefSeqi		NP_000921.1, NM_000930.4 [P00750-1]
NP_001306118.1, NM_001319189.1
NP_127509.1, NM_033011.3 [P00750-3]

UniGene gene-oriented nucleotide sequence clusters

More...UniGenei		Hs.491582

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000220809; ENSP00000220809; ENSG00000104368 [P00750-1]
ENST00000352041; ENSP00000270188; ENSG00000104368 [P00750-3]
ENST00000429089; ENSP00000392045; ENSG00000104368 [P00750-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		5327

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:5327

UCSC genome browser

More...UCSCi		uc003xos.3 human [P00750-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Wikipedia

Tissue plasminogen activator entry

SeattleSNPs
SHMPD

The Singapore human mutation and polymorphism database

Activase

Clinical information on Activase

Chiesi

Clinical information on Retavase

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L00153
, L00141, L00142, L00143, L00144, L00145, L00146, L00147, L00148, L00149, L00150, L00151 Genomic DNA Translation: AAB59510.1
K03021 Genomic DNA Translation: AAA98809.1
M15518 mRNA Translation: AAA60111.1
M18182 mRNA Translation: AAA36800.1
X07393 mRNA Translation: CAA30302.1
X13097 mRNA Translation: CAA31489.1
AF260825 mRNA Translation: AAK11956.1
AY221101 mRNA Translation: AAO34406.1
AK289387 mRNA Translation: BAF82076.1
AK290575 mRNA Translation: BAF83264.1
AK313342 mRNA Translation: BAG36145.1
BT007060 mRNA Translation: AAP35709.1
AY291060 Genomic DNA Translation: AAP34246.1
CH471080 Genomic DNA Translation: EAW63235.1
CH471080 Genomic DNA Translation: EAW63233.1
BC002795 mRNA Translation: AAH02795.3
BC007231 mRNA Translation: AAH07231.1
BC013968 mRNA Translation: AAH13968.3
BC018636 mRNA Translation: AAH18636.3
BC095403 mRNA Translation: AAH95403.1
M11890, M11889 Genomic DNA Translation: AAA61213.1
D01096 mRNA Translation: BAA00881.1
V00570 mRNA Translation: CAA23833.1
CCDSiCCDS6126.1 [P00750-1]
CCDS6127.1 [P00750-3]
PIRiA94004 UKHUT
I38098
RefSeqiNP_000921.1, NM_000930.4 [P00750-1]
NP_001306118.1, NM_001319189.1
NP_127509.1, NM_033011.3 [P00750-3]
UniGeneiHs.491582

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1A5HX-ray2.90A/B311-562[»]
C/D298-304[»]
1BDAX-ray3.35A/B298-562[»]
1PK2NMR-A209-298[»]
1PMLX-ray2.38A/B/C213-298[»]
1RTFX-ray2.30B311-562[»]
1TPGNMR-A36-126[»]
1TPKX-ray2.40A/B/C211-298[»]
1TPMNMR-A36-85[»]
1TPNNMR-A36-85[»]
5BRRX-ray3.16E311-562[»]
ProteinModelPortaliP00750
SMRiP00750
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111343, 40 interactors
ComplexPortaliCPX-494 tPA-PAI-1 complex
ELMiP00750
IntActiP00750, 2 interactors
MINTiP00750
STRINGi9606.ENSP00000220809

Chemistry databases

BindingDBiP00750
ChEMBLiCHEMBL1873
DrugBankiDB07684 5-(DIMETHYLAMINO)-2-NAPHTHALENESULFONIC ACID
DB00513 Aminocaproic Acid
DB06404 C1 Esterase Inhibitor (Human)
DB09228 C1 Esterase Inhibitor (Recombinant)
DB01050 Ibuprofen
DB01088 Iloprost
DB00013 Urokinase
GuidetoPHARMACOLOGYi2392

Protein family/group databases

MEROPSiS01.232

PTM databases

GlyConnecti503
504
603
iPTMnetiP00750
PhosphoSitePlusiP00750
UniCarbKBiP00750

Polymorphism and mutation databases

BioMutaiPLAT
DMDMi137119

Proteomic databases

EPDiP00750
jPOSTiP00750
MaxQBiP00750
PaxDbiP00750
PeptideAtlasiP00750
PRIDEiP00750
ProteomicsDBi51281
51282 [P00750-2]
51283 [P00750-3]
51284 [P00750-4]

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		5327
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000220809; ENSP00000220809; ENSG00000104368 [P00750-1]
ENST00000352041; ENSP00000270188; ENSG00000104368 [P00750-3]
ENST00000429089; ENSP00000392045; ENSG00000104368 [P00750-1]
GeneIDi5327
KEGGihsa:5327
UCSCiuc003xos.3 human [P00750-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		5327
DisGeNETi5327
EuPathDBiHostDB:ENSG00000104368.17

GeneCards: human genes, protein and diseases

More...GeneCardsi		PLAT
HGNCiHGNC:9051 PLAT
HPAiCAB009335
HPA003412
MalaCardsiPLAT
MIMi173370 gene
neXtProtiNX_P00750
OpenTargetsiENSG00000104368
Orphaneti480528 Lethal hydranencephaly-diaphragmatic hernia syndrome
PharmGKBiPA33381

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3627 Eukaryota
COG5640 LUCA
GeneTreeiENSGT00940000158930
HOVERGENiHBG008633
InParanoidiP00750
KOiK01343
OMAiPLVCMKD
OrthoDBi1314811at2759
PhylomeDBiP00750
TreeFamiTF329901

Enzyme and pathway databases

BRENDAi3.4.21.68 2681
ReactomeiR-HSA-186797 Signaling by PDGF
R-HSA-75205 Dissolution of Fibrin Clot
SIGNORiP00750

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		PLAT human
EvolutionaryTraceiP00750

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		Tissue_plasminogen_activator

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		5327
PMAP-CutDBiP00750

Protein Ontology

More...PROi		PR:P00750

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000104368 Expressed in 217 organ(s), highest expression level in metanephric glomerulus
ExpressionAtlasiP00750 baseline and differential
GenevisibleiP00750 HS

Family and domain databases

CDDicd00061 FN1, 1 hit
cd00108 KR, 2 hits
cd00190 Tryp_SPc, 1 hit
Gene3Di2.40.20.10, 2 hits
InterProiView protein in InterPro
IPR013032 EGF-like_CS
IPR000742 EGF-like_dom
IPR000083 Fibronectin_type1
IPR000001 Kringle
IPR013806 Kringle-like
IPR018056 Kringle_CS
IPR038178 Kringle_sf
IPR009003 Peptidase_S1_PA
IPR001314 Peptidase_S1A
IPR026280 Tissue_plasm_act
IPR034811 tPA
IPR001254 Trypsin_dom
IPR018114 TRYPSIN_HIS
IPR033116 TRYPSIN_SER
PANTHERiPTHR44617 PTHR44617, 1 hit
PfamiView protein in Pfam
PF00008 EGF, 1 hit
PF00039 fn1, 1 hit
PF00051 Kringle, 2 hits
PF00089 Trypsin, 1 hit
PIRSFiPIRSF001145 Tissue_plasm_act, 1 hit
PRINTSiPR00722 CHYMOTRYPSIN
SMARTiView protein in SMART
SM00058 FN1, 1 hit
SM00130 KR, 2 hits
SM00020 Tryp_SPc, 1 hit
SUPFAMiSSF50494 SSF50494, 1 hit
SSF57440 SSF57440, 2 hits
PROSITEiView protein in PROSITE
PS00022 EGF_1, 1 hit
PS01186 EGF_2, 1 hit
PS50026 EGF_3, 1 hit
PS01253 FN1_1, 1 hit
PS51091 FN1_2, 1 hit
PS00021 KRINGLE_1, 2 hits
PS50070 KRINGLE_2, 2 hits
PS50240 TRYPSIN_DOM, 1 hit
PS00134 TRYPSIN_HIS, 1 hit
PS00135 TRYPSIN_SER, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTPA_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P00750
Secondary accession number(s): A8K022
, B2R8E8, Q15103, Q503B0, Q6PJA5, Q7Z7N2, Q86YK8, Q9BU99, Q9BZW1
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 21, 1986
Last sequence update: July 21, 1986
Last modified: January 16, 2019
This is version 245 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Pharmaceutical, Reference proteome

Documents

  1. Peptidase families
    Classification of peptidase families and list of entries
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. UniProtKB entry view manual
    User manual for the UniProtKB entry view
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  8. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again