Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Haptoglobin-related protein

Gene

HPR

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Primate-specific plasma protein associated with apolipoprotein L-I (apoL-I)-containing high-density lipoprotein (HDL). This HDL particle, termed trypanosome lytic factor-1 (TLF-1), mediates human innate immune protection against many species of African trypanosomes. Binds hemoglobin with high affinity and may contribute to the clearance of cell-free hemoglobin to allow hepatic recycling of heme iron.1 Publication

Caution

Although homologous to serine proteases, it has lost all essential catalytic residues and has no enzymatic activity.Curated

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • hemoglobin binding Source: UniProtKB
  • serine-type endopeptidase activity Source: GO_Central

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionSerine protease homolog
LigandHemoglobin-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-2168880 Scavenging of heme from plasma

Protein family/group databases

MEROPS protease database

More...
MEROPSi
S01.974

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Haptoglobin-related protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:HPR
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000261701.6

Human Gene Nomenclature Database

More...
HGNCi
HGNC:5156 HPR

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
140210 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P00739

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
3250

Open Targets

More...
OpenTargetsi
ENSG00000261701

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA29426

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
HPR

Domain mapping of disease mutations (DMDM)

More...
DMDMi
262527547

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000284861 – 348Haptoglobin-related proteinAdd BLAST348
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 18Not cleaved1 PublicationAdd BLAST18

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi251 ↔ 282PROSITE-ProRule annotation
Disulfide bondi293 ↔ 323PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P00739

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P00739

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P00739

PeptideAtlas

More...
PeptideAtlasi
P00739

PRoteomics IDEntifications database

More...
PRIDEi
P00739

ProteomicsDB human proteome resource

More...
ProteomicsDBi
51272
51273 [P00739-2]

2D gel databases

DOSAC-COBS 2D-PAGE database

More...
DOSAC-COBS-2DPAGEi
P00739

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
1293

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P00739

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P00739

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

In adult liver the amount of HPR mRNA is at the lower limit of detection, therefore the extent of its expression is at most less than 1000-fold that of the HP1F gene. No HPR mRNA can be detected in fetal liver. Expressed in Hep-G2 and leukemia MOLT-4 cell lines.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000261701 Expressed in 125 organ(s), highest expression level in liver

CleanEx database of gene expression profiles

More...
CleanExi
HS_HPR

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P00739 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P00739 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA047750

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
109487, 3 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
P00739

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000441828

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P00739

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P00739

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini34 – 87SushiAdd BLAST54
Domaini104 – 346Peptidase S1PROSITE-ProRule annotationAdd BLAST243

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The uncleaved signal sequence interacts with HDL fluid lipids and mediates incorporation into the HDL particle.1 Publication

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the peptidase S1 family.PROSITE-ProRule annotation

Keywords - Domaini

Signal, Sushi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3627 Eukaryota
COG5640 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000159903

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000112945

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG005989

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P00739

KEGG Orthology (KO)

More...
KOi
K14477

Identification of Orthologs from Complete Genome Data

More...
OMAi
SYLPWIH

Database of Orthologous Groups

More...
OrthoDBi
798576at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P00739

TreeFam database of animal gene trees

More...
TreeFami
TF334326

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00190 Tryp_SPc, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR008292 Haptoglobin
IPR009003 Peptidase_S1_PA
IPR001314 Peptidase_S1A
IPR035976 Sushi/SCR/CCP_sf
IPR001254 Trypsin_dom

The PANTHER Classification System

More...
PANTHERi
PTHR44686 PTHR44686, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00089 Trypsin, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF001137 Haptoglobin, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00722 CHYMOTRYPSIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00020 Tryp_SPc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50494 SSF50494, 1 hit
SSF57535 SSF57535, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50240 TRYPSIN_DOM, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P00739-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSDLGAVISL LLWGRQLFAL YSGNDVTDIS DDRFPKPPEI ANGYVEHLFR
60 70 80 90 100
YQCKNYYRLR TEGDGVYTLN DKKQWINKAV GDKLPECEAV CGKPKNPANP
110 120 130 140 150
VQRILGGHLD AKGSFPWQAK MVSHHNLTTG ATLINEQWLL TTAKNLFLNH
160 170 180 190 200
SENATAKDIA PTLTLYVGKK QLVEIEKVVL HPNYHQVDIG LIKLKQKVLV
210 220 230 240 250
NERVMPICLP SKNYAEVGRV GYVSGWGQSD NFKLTDHLKY VMLPVADQYD
260 270 280 290 300
CITHYEGSTC PKWKAPKSPV GVQPILNEHT FCVGMSKYQE DTCYGDAGSA
310 320 330 340
FAVHDLEEDT WYAAGILSFD KSCAVAEYGV YVKVTSIQHW VQKTIAEN
Length:348
Mass (Da):39,030
Last modified:November 3, 2009 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iCF9EC3352B8182FA
GO
Isoform 2 (identifier: P00739-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MHVCVCVCVCVYMPVCVDACMCCEAGRPAFRSFLFSLC

Show »
Length:385
Mass (Da):43,078
Checksum:i8445DD27A496188B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
J3KTC3J3KTC3_HUMAN
Haptoglobin-related protein
HPR
117Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MRD9A0A0A0MRD9_HUMAN
Haptoglobin-related protein
HPR
281Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3B3ISM1A0A3B3ISM1_HUMAN
Haptoglobin-related protein
HPR
44Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti191L → I in CAA25927 (PubMed:4018023).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_05716127T → M. Corresponds to variant dbSNP:rs11642506Ensembl.1
Natural variantiVAR_05716242N → H. Corresponds to variant dbSNP:rs152832Ensembl.1
Natural variantiVAR_05716358R → K. Corresponds to variant dbSNP:rs152833Ensembl.1
Natural variantiVAR_059789156A → V. Corresponds to variant dbSNP:rs1049933Ensembl.1
Natural variantiVAR_057164203R → K. Corresponds to variant dbSNP:rs2021171Ensembl.1
Natural variantiVAR_057165283V → A. Corresponds to variant dbSNP:rs1065360Ensembl.1
Natural variantiVAR_014571339H → D3 PublicationsCorresponds to variant dbSNP:rs12646Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0145291M → MHVCVCVCVCVYMPVCVDAC MCCEAGRPAFRSFLFSLC in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X01794
, X01787, X01788, X01790, X01792 Genomic DNA Translation: CAA25927.1
K03431, M10935 Genomic DNA Translation: AAA88081.1
M69197 Genomic DNA Translation: AAA88079.1
X89214 mRNA Translation: CAA61501.1
AC009087 Genomic DNA No translation available.
AC004682 Genomic DNA Translation: AAC27433.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS42193.1 [P00739-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
A00919 HPHUR

NCBI Reference Sequences

More...
RefSeqi
NP_066275.3, NM_020995.3 [P00739-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.655361

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000540303; ENSP00000441828; ENSG00000261701 [P00739-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
3250

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:3250

UCSC genome browser

More...
UCSCi
uc002fby.4 human [P00739-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X01794
, X01787, X01788, X01790, X01792 Genomic DNA Translation: CAA25927.1
K03431, M10935 Genomic DNA Translation: AAA88081.1
M69197 Genomic DNA Translation: AAA88079.1
X89214 mRNA Translation: CAA61501.1
AC009087 Genomic DNA No translation available.
AC004682 Genomic DNA Translation: AAC27433.1
CCDSiCCDS42193.1 [P00739-1]
PIRiA00919 HPHUR
RefSeqiNP_066275.3, NM_020995.3 [P00739-1]
UniGeneiHs.655361

3D structure databases

ProteinModelPortaliP00739
SMRiP00739
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi109487, 3 interactors
CORUMiP00739
STRINGi9606.ENSP00000441828

Protein family/group databases

MEROPSiS01.974

PTM databases

GlyConnecti1293
iPTMnetiP00739
PhosphoSitePlusiP00739

Polymorphism and mutation databases

BioMutaiHPR
DMDMi262527547

2D gel databases

DOSAC-COBS-2DPAGEiP00739

Proteomic databases

jPOSTiP00739
MaxQBiP00739
PaxDbiP00739
PeptideAtlasiP00739
PRIDEiP00739
ProteomicsDBi51272
51273 [P00739-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
3250
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000540303; ENSP00000441828; ENSG00000261701 [P00739-1]
GeneIDi3250
KEGGihsa:3250
UCSCiuc002fby.4 human [P00739-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
3250
DisGeNETi3250
EuPathDBiHostDB:ENSG00000261701.6

GeneCards: human genes, protein and diseases

More...
GeneCardsi
HPR
HGNCiHGNC:5156 HPR
HPAiHPA047750
MIMi140210 gene
neXtProtiNX_P00739
OpenTargetsiENSG00000261701
PharmGKBiPA29426

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3627 Eukaryota
COG5640 LUCA
GeneTreeiENSGT00940000159903
HOGENOMiHOG000112945
HOVERGENiHBG005989
InParanoidiP00739
KOiK14477
OMAiSYLPWIH
OrthoDBi798576at2759
PhylomeDBiP00739
TreeFamiTF334326

Enzyme and pathway databases

ReactomeiR-HSA-2168880 Scavenging of heme from plasma

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
HPR human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
HPR_(gene)

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
3250

Protein Ontology

More...
PROi
PR:P00739

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000261701 Expressed in 125 organ(s), highest expression level in liver
CleanExiHS_HPR
ExpressionAtlasiP00739 baseline and differential
GenevisibleiP00739 HS

Family and domain databases

CDDicd00190 Tryp_SPc, 1 hit
InterProiView protein in InterPro
IPR008292 Haptoglobin
IPR009003 Peptidase_S1_PA
IPR001314 Peptidase_S1A
IPR035976 Sushi/SCR/CCP_sf
IPR001254 Trypsin_dom
PANTHERiPTHR44686 PTHR44686, 1 hit
PfamiView protein in Pfam
PF00089 Trypsin, 1 hit
PIRSFiPIRSF001137 Haptoglobin, 1 hit
PRINTSiPR00722 CHYMOTRYPSIN
SMARTiView protein in SMART
SM00020 Tryp_SPc, 1 hit
SUPFAMiSSF50494 SSF50494, 1 hit
SSF57535 SSF57535, 1 hit
PROSITEiView protein in PROSITE
PS50240 TRYPSIN_DOM, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiHPTR_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P00739
Secondary accession number(s): Q7LE20
, Q92658, Q92659, Q9ULB0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 21, 1986
Last sequence update: November 3, 2009
Last modified: January 16, 2019
This is version 170 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Peptidase families
    Classification of peptidase families and list of entries
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again