Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Haptoglobin-related protein

Gene

HPR

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Primate-specific plasma protein associated with apolipoprotein L-I (apoL-I)-containing high-density lipoprotein (HDL). This HDL particle, termed trypanosome lytic factor-1 (TLF-1), mediates human innate immune protection against many species of African trypanosomes. Binds hemoglobin with high affinity and may contribute to the clearance of cell-free hemoglobin to allow hepatic recycling of heme iron.1 Publication

Caution

Although homologous to serine proteases, it has lost all essential catalytic residues and has no enzymatic activity.Curated

GO - Molecular functioni

  • hemoglobin binding Source: UniProtKB
  • serine-type endopeptidase activity Source: GO_Central

GO - Biological processi

Keywordsi

Molecular functionSerine protease homolog
LigandHemoglobin-binding

Enzyme and pathway databases

ReactomeiR-HSA-2168880 Scavenging of heme from plasma

Protein family/group databases

MEROPSiS01.974

Names & Taxonomyi

Protein namesi
Recommended name:
Haptoglobin-related protein
Gene namesi
Name:HPR
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

EuPathDBiHostDB:ENSG00000261701.6
HGNCiHGNC:5156 HPR
MIMi140210 gene
neXtProtiNX_P00739

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

DisGeNETi3250
OpenTargetsiENSG00000261701
PharmGKBiPA29426

Polymorphism and mutation databases

BioMutaiHPR
DMDMi262527547

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000284861 – 348Haptoglobin-related proteinAdd BLAST348
Signal peptidei1 – 18Not cleaved1 PublicationAdd BLAST18

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi251 ↔ 282PROSITE-ProRule annotation
Disulfide bondi293 ↔ 323PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond

Proteomic databases

MaxQBiP00739
PaxDbiP00739
PeptideAtlasiP00739
PRIDEiP00739
ProteomicsDBi51272
51273 [P00739-2]

2D gel databases

DOSAC-COBS-2DPAGEiP00739

PTM databases

GlyConnecti1293
iPTMnetiP00739
PhosphoSitePlusiP00739

Expressioni

Tissue specificityi

In adult liver the amount of HPR mRNA is at the lower limit of detection, therefore the extent of its expression is at most less than 1000-fold that of the HP1F gene. No HPR mRNA can be detected in fetal liver. Expressed in Hep-G2 and leukemia MOLT-4 cell lines.1 Publication

Gene expression databases

BgeeiENSG00000261701 Expressed in 125 organ(s), highest expression level in liver
CleanExiHS_HPR
ExpressionAtlasiP00739 baseline and differential
GenevisibleiP00739 HS

Organism-specific databases

HPAiHPA047750

Interactioni

GO - Molecular functioni

Protein-protein interaction databases

BioGridi109487, 3 interactors
CORUMiP00739
STRINGi9606.ENSP00000441828

Structurei

3D structure databases

ProteinModelPortaliP00739
SMRiP00739
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini34 – 87SushiAdd BLAST54
Domaini104 – 346Peptidase S1PROSITE-ProRule annotationAdd BLAST243

Domaini

The uncleaved signal sequence interacts with HDL fluid lipids and mediates incorporation into the HDL particle.1 Publication

Sequence similaritiesi

Belongs to the peptidase S1 family.PROSITE-ProRule annotation

Keywords - Domaini

Signal, Sushi

Phylogenomic databases

eggNOGiKOG3627 Eukaryota
COG5640 LUCA
GeneTreeiENSGT00760000118890
HOGENOMiHOG000112945
HOVERGENiHBG005989
InParanoidiP00739
KOiK14477
OMAiSYLPWIH
OrthoDBiEOG091G099M
PhylomeDBiP00739
TreeFamiTF334326

Family and domain databases

CDDicd00190 Tryp_SPc, 1 hit
InterProiView protein in InterPro
IPR008292 Haptoglobin
IPR009003 Peptidase_S1_PA
IPR001314 Peptidase_S1A
IPR035976 Sushi/SCR/CCP_sf
IPR001254 Trypsin_dom
PANTHERiPTHR44686 PTHR44686, 1 hit
PfamiView protein in Pfam
PF00089 Trypsin, 1 hit
PIRSFiPIRSF001137 Haptoglobin, 1 hit
PRINTSiPR00722 CHYMOTRYPSIN
SMARTiView protein in SMART
SM00020 Tryp_SPc, 1 hit
SUPFAMiSSF50494 SSF50494, 1 hit
SSF57535 SSF57535, 1 hit
PROSITEiView protein in PROSITE
PS50240 TRYPSIN_DOM, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P00739-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSDLGAVISL LLWGRQLFAL YSGNDVTDIS DDRFPKPPEI ANGYVEHLFR
60 70 80 90 100
YQCKNYYRLR TEGDGVYTLN DKKQWINKAV GDKLPECEAV CGKPKNPANP
110 120 130 140 150
VQRILGGHLD AKGSFPWQAK MVSHHNLTTG ATLINEQWLL TTAKNLFLNH
160 170 180 190 200
SENATAKDIA PTLTLYVGKK QLVEIEKVVL HPNYHQVDIG LIKLKQKVLV
210 220 230 240 250
NERVMPICLP SKNYAEVGRV GYVSGWGQSD NFKLTDHLKY VMLPVADQYD
260 270 280 290 300
CITHYEGSTC PKWKAPKSPV GVQPILNEHT FCVGMSKYQE DTCYGDAGSA
310 320 330 340
FAVHDLEEDT WYAAGILSFD KSCAVAEYGV YVKVTSIQHW VQKTIAEN
Length:348
Mass (Da):39,030
Last modified:November 3, 2009 - v2
Checksum:iCF9EC3352B8182FA
GO
Isoform 2 (identifier: P00739-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MHVCVCVCVCVYMPVCVDACMCCEAGRPAFRSFLFSLC

Show »
Length:385
Mass (Da):43,078
Checksum:i8445DD27A496188B
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
J3KTC3J3KTC3_HUMAN
Haptoglobin-related protein
HPR
117Annotation score:
A0A0A0MRD9A0A0A0MRD9_HUMAN
Haptoglobin-related protein
HPR
281Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti191L → I in CAA25927 (PubMed:4018023).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05716127T → M. Corresponds to variant dbSNP:rs11642506Ensembl.1
Natural variantiVAR_05716242N → H. Corresponds to variant dbSNP:rs152832Ensembl.1
Natural variantiVAR_05716358R → K. Corresponds to variant dbSNP:rs152833Ensembl.1
Natural variantiVAR_059789156A → V. Corresponds to variant dbSNP:rs1049933Ensembl.1
Natural variantiVAR_057164203R → K. Corresponds to variant dbSNP:rs2021171Ensembl.1
Natural variantiVAR_057165283V → A. Corresponds to variant dbSNP:rs1065360Ensembl.1
Natural variantiVAR_014571339H → D3 PublicationsCorresponds to variant dbSNP:rs12646Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0145291M → MHVCVCVCVCVYMPVCVDAC MCCEAGRPAFRSFLFSLC in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X01794
, X01787, X01788, X01790, X01792 Genomic DNA Translation: CAA25927.1
K03431, M10935 Genomic DNA Translation: AAA88081.1
M69197 Genomic DNA Translation: AAA88079.1
X89214 mRNA Translation: CAA61501.1
AC009087 Genomic DNA No translation available.
AC004682 Genomic DNA Translation: AAC27433.1
CCDSiCCDS42193.1 [P00739-1]
PIRiA00919 HPHUR
RefSeqiNP_066275.3, NM_020995.3 [P00739-1]
UniGeneiHs.655361

Genome annotation databases

EnsembliENST00000540303; ENSP00000441828; ENSG00000261701 [P00739-1]
GeneIDi3250
KEGGihsa:3250
UCSCiuc002fby.4 human [P00739-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X01794
, X01787, X01788, X01790, X01792 Genomic DNA Translation: CAA25927.1
K03431, M10935 Genomic DNA Translation: AAA88081.1
M69197 Genomic DNA Translation: AAA88079.1
X89214 mRNA Translation: CAA61501.1
AC009087 Genomic DNA No translation available.
AC004682 Genomic DNA Translation: AAC27433.1
CCDSiCCDS42193.1 [P00739-1]
PIRiA00919 HPHUR
RefSeqiNP_066275.3, NM_020995.3 [P00739-1]
UniGeneiHs.655361

3D structure databases

ProteinModelPortaliP00739
SMRiP00739
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi109487, 3 interactors
CORUMiP00739
STRINGi9606.ENSP00000441828

Protein family/group databases

MEROPSiS01.974

PTM databases

GlyConnecti1293
iPTMnetiP00739
PhosphoSitePlusiP00739

Polymorphism and mutation databases

BioMutaiHPR
DMDMi262527547

2D gel databases

DOSAC-COBS-2DPAGEiP00739

Proteomic databases

MaxQBiP00739
PaxDbiP00739
PeptideAtlasiP00739
PRIDEiP00739
ProteomicsDBi51272
51273 [P00739-2]

Protocols and materials databases

DNASUi3250
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000540303; ENSP00000441828; ENSG00000261701 [P00739-1]
GeneIDi3250
KEGGihsa:3250
UCSCiuc002fby.4 human [P00739-1]

Organism-specific databases

CTDi3250
DisGeNETi3250
EuPathDBiHostDB:ENSG00000261701.6
GeneCardsiHPR
HGNCiHGNC:5156 HPR
HPAiHPA047750
MIMi140210 gene
neXtProtiNX_P00739
OpenTargetsiENSG00000261701
PharmGKBiPA29426
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3627 Eukaryota
COG5640 LUCA
GeneTreeiENSGT00760000118890
HOGENOMiHOG000112945
HOVERGENiHBG005989
InParanoidiP00739
KOiK14477
OMAiSYLPWIH
OrthoDBiEOG091G099M
PhylomeDBiP00739
TreeFamiTF334326

Enzyme and pathway databases

ReactomeiR-HSA-2168880 Scavenging of heme from plasma

Miscellaneous databases

ChiTaRSiHPR human
GeneWikiiHPR_(gene)
GenomeRNAii3250
PROiPR:P00739
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000261701 Expressed in 125 organ(s), highest expression level in liver
CleanExiHS_HPR
ExpressionAtlasiP00739 baseline and differential
GenevisibleiP00739 HS

Family and domain databases

CDDicd00190 Tryp_SPc, 1 hit
InterProiView protein in InterPro
IPR008292 Haptoglobin
IPR009003 Peptidase_S1_PA
IPR001314 Peptidase_S1A
IPR035976 Sushi/SCR/CCP_sf
IPR001254 Trypsin_dom
PANTHERiPTHR44686 PTHR44686, 1 hit
PfamiView protein in Pfam
PF00089 Trypsin, 1 hit
PIRSFiPIRSF001137 Haptoglobin, 1 hit
PRINTSiPR00722 CHYMOTRYPSIN
SMARTiView protein in SMART
SM00020 Tryp_SPc, 1 hit
SUPFAMiSSF50494 SSF50494, 1 hit
SSF57535 SSF57535, 1 hit
PROSITEiView protein in PROSITE
PS50240 TRYPSIN_DOM, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiHPTR_HUMAN
AccessioniPrimary (citable) accession number: P00739
Secondary accession number(s): Q7LE20
, Q92658, Q92659, Q9ULB0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 21, 1986
Last sequence update: November 3, 2009
Last modified: November 7, 2018
This is version 168 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Peptidase families
    Classification of peptidase families and list of entries
  5. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again