Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P00387 (NB5R3_HUMAN)

Entry version 255 (02 Jun 2021)
Sequence version 3 (23 Jan 2007)
Previous versions | rss
Add a publicationFeedback
Protein

NADH-cytochrome b5 reductase 3

Gene

CYB5R3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Desaturation and elongation of fatty acids, cholesterol biosynthesis, drug metabolism, and, in erythrocyte, methemoglobin reduction.

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

FAD

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi132 – 147FADBy similarityAdd BLAST16
Nucleotide bindingi171 – 206FADBy similarityAdd BLAST36

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionOxidoreductase
Biological processCholesterol biosynthesis, Cholesterol metabolism, Lipid biosynthesis, Lipid metabolism, Steroid biosynthesis, Steroid metabolism, Sterol biosynthesis, Sterol metabolism
LigandFAD, Flavoprotein, NAD

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...BioCyci		MetaCyc:HS02015-MONOMER

BRENDA Comprehensive Enzyme Information System

More...BRENDAi		1.6.2.2, 2681

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		P00387

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-196836, Vitamin C (ascorbate) metabolism
R-HSA-211945, Phase I - Functionalization of compounds
R-HSA-6798695, Neutrophil degranulation

SABIO-RK: Biochemical Reaction Kinetics Database

More...SABIO-RKi		P00387

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
NADH-cytochrome b5 reductase 3 (EC:1.6.2.2)
Short name:
B5R
Short name:
Cytochrome b5 reductase
Alternative name(s):
Diaphorase-1
Cleaved into the following 2 chains:
NADH-cytochrome b5 reductase 3 membrane-bound form
NADH-cytochrome b5 reductase 3 soluble form
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CYB5R3
Synonyms:DIA1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 22

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:2873, CYB5R3

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		613213, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P00387

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000100243.20

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm, Endoplasmic reticulum, Membrane, Mitochondrion, Mitochondrion outer membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Methemoglobinemia CYB5R3-related (METHB-CYB5R3)11 Publications
The disease is caused by variants affecting the gene represented in this entry.
Disease descriptionA form of methemoglobinemia, a hematologic disease characterized by the presence of excessive amounts of methemoglobin in blood cells, resulting in decreased oxygen carrying capacity of the blood, cyanosis and hypoxia. There are two types of methemoglobinemia CYB5R3-related. In type 1, the defect affects the soluble form of the enzyme, is restricted to red blood cells, and causes well-tolerated methemoglobinemia. In type 2, the defect affects both the soluble and microsomal forms of the enzyme and is thus generalized, affecting red cells, leukocytes and all body tissues. Type 2 methemoglobinemia is associated with mental deficiency and other neurologic symptoms.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_00461958R → Q in METHB-CYB5R3; type 1; 62% of activity. 3 PublicationsCorresponds to variant dbSNP:rs121965007EnsemblClinVar.1
Natural variantiVAR_01075073L → P in METHB-CYB5R3; type 1. 2 PublicationsCorresponds to variant dbSNP:rs121965013EnsemblClinVar.1
Natural variantiVAR_004620106V → M in METHB-CYB5R3; type 1; 77% of activity. 1 PublicationCorresponds to variant dbSNP:rs121965009EnsemblClinVar.1
Natural variantiVAR_004621128S → P in METHB-CYB5R3; type 2; Hiroshima. 1 PublicationCorresponds to variant dbSNP:rs121965006EnsemblClinVar.1
Natural variantiVAR_004622149L → P in METHB-CYB5R3. 1 PublicationCorresponds to variant dbSNP:rs121965008EnsemblClinVar.1
Natural variantiVAR_010752179A → V in METHB-CYB5R3; type 1. 1 PublicationCorresponds to variant dbSNP:rs201232518Ensembl.1
Natural variantiVAR_010753204C → R in METHB-CYB5R3; type 2. 1 PublicationCorresponds to variant dbSNP:rs121965011EnsemblClinVar.1
Natural variantiVAR_010754204C → Y in METHB-CYB5R3; type 1. 2 PublicationsCorresponds to variant dbSNP:rs121965015EnsemblClinVar.1
Natural variantiVAR_037315256Missing in METHB-CYB5R3; type 1; retains approximately 38% of residual diaphorase activity. 2 PublicationsCorresponds to variant dbSNP:rs121965017Ensembl.1
Natural variantiVAR_010755273Missing in METHB-CYB5R3; type 2. 1 PublicationCorresponds to variant dbSNP:rs794728012Ensembl.1
Natural variantiVAR_037316292G → D in METHB-CYB5R3; type 1; retains approximately 58% of residual diaphorase activity. 2 PublicationsCorresponds to variant dbSNP:rs121965016EnsemblClinVar.1
Natural variantiVAR_004623299Missing in METHB-CYB5R3; type2; almost complete loss of activity. 1 PublicationCorresponds to variant dbSNP:rs121965012Ensembl.1

Keywords - Diseasei

Disease variant

Organism-specific databases

DisGeNET

More...DisGeNETi		1727

MalaCards human disease database

More...MalaCardsi		CYB5R3
MIMi250800, phenotype

Open Targets

More...OpenTargetsi		ENSG00000100243

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		621, Hereditary methemoglobinemia

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA27331

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P00387, Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL2146

Drug and drug target database

More...DrugBanki		DB09130, Copper
DB03147, Flavin adenine dinucleotide
DB00157, NADH

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		CYB5R3

Domain mapping of disease mutations (DMDM)

More...DMDMi		127846

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemoved1 Publication
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000193922 – 301NADH-cytochrome b5 reductase 3 membrane-bound formAdd BLAST300
ChainiPRO_000001939427 – 301NADH-cytochrome b5 reductase 3 soluble formAdd BLAST275

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi2N-myristoyl glycine2 Publications1
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei42N6-acetyllysineCombined sources1
Modified residuei43PhosphotyrosineCombined sources1
Modified residuei120N6-acetyllysineBy similarity1

Keywords - PTMi

Acetylation, Lipoprotein, Myristate, Phosphoprotein

Proteomic databases

The CPTAC Assay portal

More...CPTACi		CPTAC-55
CPTAC-56

Encyclopedia of Proteome Dynamics

More...EPDi		P00387

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P00387

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P00387

MaxQB - The MaxQuant DataBase

More...MaxQBi		P00387

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P00387

PeptideAtlas

More...PeptideAtlasi		P00387

PRoteomics IDEntifications database

More...PRIDEi		P00387

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		51238 [P00387-1]
51239 [P00387-2]
51240 [P00387-3]

Consortium for Top Down Proteomics

More...TopDownProteomicsi		P00387-1 [P00387-1]
P00387-2 [P00387-2]

2D gel databases

REPRODUCTION-2DPAGE

More...REPRODUCTION-2DPAGEi		IPI00446235

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P00387

MetOSite database of methionine sulfoxide sites

More...MetOSitei		P00387

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P00387

SwissPalm database of S-palmitoylation events

More...SwissPalmi		P00387

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 2 is expressed at late stages of erythroid maturation.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000100243, Expressed in thoracic aorta and 252 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P00387, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P00387, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000100243, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of a complex composed of cytochrome b5, NADH-cytochrome b5 reductase (CYB5R3) and MTARC2 (By similarity).

Interacts with MTLN; the interaction is required to maintain cellular lipid composition and leads to stimulation of mitochondrial respiratory complex I activity (By similarity).

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

P00387
With#Exp.IntAct
ADAM33 [Q08AM2]3EBI-1046040,EBI-10225815
AGTRAP - isoform 2 [Q6RW13-2]3EBI-1046040,EBI-11522760
AIG1 - isoform 1 [Q9NVV5-2]3EBI-1046040,EBI-11957045
ALG8 [Q9BVK2]3EBI-1046040,EBI-3921603
AQP6 [Q13520]3EBI-1046040,EBI-13059134
ASGR1 [P07306]3EBI-1046040,EBI-1172335
BNIP2 [Q12982]3EBI-1046040,EBI-752094
CDIPT [O14735]3EBI-1046040,EBI-358858
CERS4 [Q9HA82]3EBI-1046040,EBI-2622997
CNIH1 [O95406]3EBI-1046040,EBI-12172273
COL8A2 [Q4VAQ0]3EBI-1046040,EBI-10241815
CSGALNACT2 [Q8N6G5]3EBI-1046040,EBI-10267100
ELOVL4 [Q9GZR5]3EBI-1046040,EBI-18535450
FAM210B [Q96KR6]3EBI-1046040,EBI-18938272
FAM3C [Q92520]3EBI-1046040,EBI-2876774
FAXDC2 [Q96IV6]3EBI-1046040,EBI-12142299
FUNDC2 [Q9BWH2]3EBI-1046040,EBI-714482
FXYD3 - isoform 3 [Q14802-3]3EBI-1046040,EBI-12175685
GAST [P01350]3EBI-1046040,EBI-3436637
GPR152 [Q8TDT2]3EBI-1046040,EBI-13345167
GRM2 [Q14416]3EBI-1046040,EBI-10232876
HBA2 [P69905]2EBI-1046040,EBI-714680
HSD17B13 [Q7Z5P4]3EBI-1046040,EBI-18053395
LAPTM5 [Q13571]3EBI-1046040,EBI-2865663
LRCH4 [O75427]3EBI-1046040,EBI-718707
MFSD6 [Q6ZSS7]3EBI-1046040,EBI-2858252
NINJ1 [Q92982]3EBI-1046040,EBI-2802124
NRM [Q8IXM6]3EBI-1046040,EBI-10262547
NSG1 [P42857]3EBI-1046040,EBI-6380741
NXPE3 [Q969Y0]3EBI-1046040,EBI-17973370
ORMDL2 [Q53FV1]3EBI-1046040,EBI-11075081
PNLIPRP1 [P54315]3EBI-1046040,EBI-8652812
REEP4 [Q9H6H4]3EBI-1046040,EBI-7545592
SLC10A1 [Q14973]3EBI-1046040,EBI-3923031
SLC10A6 [Q3KNW5]3EBI-1046040,EBI-18159983
SLC13A3 [Q8WWT9]3EBI-1046040,EBI-12938720
SLC35A4 [Q96G79]3EBI-1046040,EBI-12363689
SLC35B2 [Q8TB61]3EBI-1046040,EBI-1054782
SLC38A7 [Q9NVC3]3EBI-1046040,EBI-10314552
STOM [P27105]3EBI-1046040,EBI-1211440
TMEM115 [Q12893]3EBI-1046040,EBI-8633987
TMEM14B [Q9NUH8]3EBI-1046040,EBI-8638294
TMEM14C [Q9P0S9]3EBI-1046040,EBI-2339195
TMEM201 - isoform 2 [Q5SNT2-2]3EBI-1046040,EBI-11994282
TMEM51 [Q9NW97]3EBI-1046040,EBI-726044
TMEM60 [Q9H2L4]3EBI-1046040,EBI-2852148
TMEM79 [Q9BSE2]3EBI-1046040,EBI-8649725
TNF [P01375]3EBI-1046040,EBI-359977
TNFRSF10C [O14798]3EBI-1046040,EBI-717441
UBIAD1 [Q9Y5Z9]3EBI-1046040,EBI-2819725
VAMP1 - isoform 2 [P23763-3]3EBI-1046040,EBI-12097582
VAMP4 [O75379]3EBI-1046040,EBI-744953
VAMP5 [O95183]3EBI-1046040,EBI-10191195
VMP1 [Q96GC9]3EBI-1046040,EBI-2800296
WFDC2 [Q14508]3EBI-1046040,EBI-723529
ZDHHC15 [Q96MV8]3EBI-1046040,EBI-12837904

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		108071, 244 interactors

Database of interacting proteins

More...DIPi		DIP-50463N

Protein interaction database and analysis system

More...IntActi		P00387, 102 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000354468

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P00387, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1301
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P00387

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		P00387

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini40 – 152FAD-binding FR-typePROSITE-ProRule annotationAdd BLAST113

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the flavoprotein pyridine nucleotide cytochrome reductase family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0534, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000153962

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_003827_9_2_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P00387

Identification of Orthologs from Complete Genome Data

More...OMAi		KHDHIAL

Database of Orthologous Groups

More...OrthoDBi		1311668at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P00387

TreeFam database of animal gene trees

More...TreeFami		TF314333

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.40.50.80, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR001834, CBR-like
IPR008333, Cbr1-like_FAD-bd_dom
IPR017927, FAD-bd_FR_type
IPR001709, Flavoprot_Pyr_Nucl_cyt_Rdtase
IPR039261, FNR_nucleotide-bd
IPR001433, OxRdtase_FAD/NAD-bd
IPR017938, Riboflavin_synthase-like_b-brl

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00970, FAD_binding_6, 1 hit
PF00175, NAD_binding_1, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00406, CYTB5RDTASE
PR00371, FPNCR

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF52343, SSF52343, 1 hit
SSF63380, SSF63380, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS51384, FAD_FR, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative promoter usage and alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: P00387-1) [UniParc]FASTAAdd to basket
Also known as: M

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGAQLSTLGH MVLFPVWFLY SLLMKLFQRS TPAITLESPD IKYPLRLIDR 
        60         70         80         90        100
EIISHDTRRF RFALPSPQHI LGLPVGQHIY LSARIDGNLV VRPYTPISSD 
       110        120        130        140        150
DDKGFVDLVI KVYFKDTHPK FPAGGKMSQY LESMQIGDTI EFRGPSGLLV 
       160        170        180        190        200
YQGKGKFAIR PDKKSNPIIR TVKSVGMIAG GTGITPMLQV IRAIMKDPDD 
       210        220        230        240        250
HTVCHLLFAN QTEKDILLRP ELEELRNKHS ARFKLWYTLD RAPEAWDYGQ 
       260        270        280        290        300
GFVNEEMIRD HLPPPEEEPL VLMCGPPPMI QYACLPNLDH VGHPTERCFV 

F
Length:301
Mass (Da):34,235
Last modified:January 23, 2007 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iFDCDCDC4EC3570B4
GO
Isoform 2 (identifier: P00387-2) [UniParc]FASTAAdd to basket
Also known as: S

The sequence of this isoform differs from the canonical sequence as follows:
     1-23: Missing.

Show »
Length:278
Mass (Da):31,629
Checksum:i229597F14FA6582E
GO
Isoform 3 (identifier: P00387-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-7: MGAQLST → MNRSLLVGCMQSKDIWGREESICERLKQDGLDVERAESWE

Show »
Length:334
Mass (Da):38,226
Checksum:i91CCE3D9A18621E8
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B1AHF3B1AHF3_HUMAN
NADH-cytochrome b5 reductase 3
CYB5R3
147Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti28 – 32QRSTP → RWPRA in AAA52307 (PubMed:3035541).Curated5
Sequence conflicti29R → G in AAA59900 (PubMed:2479590).Curated1
Sequence conflicti31T → K in CAA09006 (Ref. 4) Curated1
Sequence conflicti31T → K in CAA09007 (Ref. 4) Curated1
Sequence conflicti31T → K in CAA09008 (Ref. 4) Curated1
Sequence conflicti34 – 35IT → LA in AAA52307 (PubMed:3035541).Curated2
Sequence conflicti187 – 188ML → IV in CAA09006 (Ref. 4) Curated2
Sequence conflicti187 – 188ML → IV in CAA09007 (Ref. 4) Curated2
Sequence conflicti191 – 192IR → MS in CAA09006 (Ref. 4) Curated2
Sequence conflicti191 – 192IR → MS in CAA09007 (Ref. 4) Curated2
Sequence conflicti192R → G in AAA52306 (PubMed:3035541).Curated1
Sequence conflicti233 – 234FK → CN in CAA09006 (Ref. 4) Curated2
Sequence conflicti233 – 234FK → CN in CAA09007 (Ref. 4) Curated2
Sequence conflicti280I → N in AAL87744 (Ref. 3) Curated1

<p>This subsection of the 'Sequence' section provides information on polymorphic variants. If the variant is associated with a disease state, the description of the latter can be found in the <a href="http://www.uniprot.org/manual/involvement%5Fin%5Fdisease">'Involvement in disease'</a> subsection.<p><a href='/help/polymorphism' target='_top'>More...</a></p>Polymorphismi

Ser-117 seems to only be found in persons of African origin. The allele frequency is 0.23 in African Americans. It was not found in Caucasians, Asians, Indo-Aryans, or Arabs. There seems to be no effect on the enzyme activity.1 Publication

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_00461958R → Q in METHB-CYB5R3; type 1; 62% of activity. 3 PublicationsCorresponds to variant dbSNP:rs121965007EnsemblClinVar.1
Natural variantiVAR_01841966S → P3 PublicationsCorresponds to variant dbSNP:rs1130706Ensembl.1
Natural variantiVAR_01075073L → P in METHB-CYB5R3; type 1. 2 PublicationsCorresponds to variant dbSNP:rs121965013EnsemblClinVar.1
Natural variantiVAR_004620106V → M in METHB-CYB5R3; type 1; 77% of activity. 1 PublicationCorresponds to variant dbSNP:rs121965009EnsemblClinVar.1
Natural variantiVAR_010751117T → S2 PublicationsCorresponds to variant dbSNP:rs1800457EnsemblClinVar.1
Natural variantiVAR_004621128S → P in METHB-CYB5R3; type 2; Hiroshima. 1 PublicationCorresponds to variant dbSNP:rs121965006EnsemblClinVar.1
Natural variantiVAR_004622149L → P in METHB-CYB5R3. 1 PublicationCorresponds to variant dbSNP:rs121965008EnsemblClinVar.1
Natural variantiVAR_010752179A → V in METHB-CYB5R3; type 1. 1 PublicationCorresponds to variant dbSNP:rs201232518Ensembl.1
Natural variantiVAR_010753204C → R in METHB-CYB5R3; type 2. 1 PublicationCorresponds to variant dbSNP:rs121965011EnsemblClinVar.1
Natural variantiVAR_010754204C → Y in METHB-CYB5R3; type 1. 2 PublicationsCorresponds to variant dbSNP:rs121965015EnsemblClinVar.1
Natural variantiVAR_037315256Missing in METHB-CYB5R3; type 1; retains approximately 38% of residual diaphorase activity. 2 PublicationsCorresponds to variant dbSNP:rs121965017Ensembl.1
Natural variantiVAR_010755273Missing in METHB-CYB5R3; type 2. 1 PublicationCorresponds to variant dbSNP:rs794728012Ensembl.1
Natural variantiVAR_037316292G → D in METHB-CYB5R3; type 1; retains approximately 58% of residual diaphorase activity. 2 PublicationsCorresponds to variant dbSNP:rs121965016EnsemblClinVar.1
Natural variantiVAR_004623299Missing in METHB-CYB5R3; type2; almost complete loss of activity. 1 PublicationCorresponds to variant dbSNP:rs121965012Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0102001 – 23Missing in isoform 2. CuratedAdd BLAST23
Alternative sequenceiVSP_0428271 – 7MGAQLST → MNRSLLVGCMQSKDIWGREE SICERLKQDGLDVERAESWE in isoform 3. 1 Publication7

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
M28713 M28711 Genomic DNA Translation: AAA59900.1
Y09501 mRNA Translation: CAA70696.1
AF361370 mRNA Translation: AAL87744.1
AJ010116 mRNA Translation: CAA09006.1
AJ010117 mRNA Translation: CAA09007.1
AJ010118 mRNA Translation: CAA09008.1
AY341030 Genomic DNA Translation: AAP88936.1
BT009821 mRNA Translation: AAP88823.1
CR456435 mRNA Translation: CAG30321.1
AF061830 Genomic DNA Translation: AAF06818.1
AF061831 Genomic DNA Translation: AAF06819.1
AK302204 mRNA Translation: BAH13649.1
Z93241 Genomic DNA No translation available.
BC004821 mRNA Translation: AAH04821.1
AJ310899 mRNA Translation: CAC84523.1
AJ310900 mRNA Translation: CAC84524.1
M16461 mRNA Translation: AAA52306.1
M16462 mRNA Translation: AAA52307.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS14040.1 [P00387-2]
CCDS33658.1 [P00387-1]
CCDS54535.1 [P00387-3]

Protein sequence database of the Protein Information Resource

More...PIRi		JS0468, RDHUB5

NCBI Reference Sequences

More...RefSeqi		NP_000389.1, NM_000398.6 [P00387-1]
NP_001123291.1, NM_001129819.2 [P00387-2]
NP_001165131.1, NM_001171660.1 [P00387-3]
NP_001165132.1, NM_001171661.1 [P00387-2]
NP_015565.1, NM_007326.4 [P00387-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000352397; ENSP00000338461; ENSG00000100243 [P00387-1]
ENST00000361740; ENSP00000354468; ENSG00000100243 [P00387-3]
ENST00000402438; ENSP00000385679; ENSG00000100243 [P00387-2]
ENST00000407332; ENSP00000384457; ENSG00000100243 [P00387-2]
ENST00000407623; ENSP00000384834; ENSG00000100243 [P00387-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		1727

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:1727

UCSC genome browser

More...UCSCi		uc003bcx.4, human [P00387-1]

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M28713 M28711 Genomic DNA Translation: AAA59900.1
Y09501 mRNA Translation: CAA70696.1
AF361370 mRNA Translation: AAL87744.1
AJ010116 mRNA Translation: CAA09006.1
AJ010117 mRNA Translation: CAA09007.1
AJ010118 mRNA Translation: CAA09008.1
AY341030 Genomic DNA Translation: AAP88936.1
BT009821 mRNA Translation: AAP88823.1
CR456435 mRNA Translation: CAG30321.1
AF061830 Genomic DNA Translation: AAF06818.1
AF061831 Genomic DNA Translation: AAF06819.1
AK302204 mRNA Translation: BAH13649.1
Z93241 Genomic DNA No translation available.
BC004821 mRNA Translation: AAH04821.1
AJ310899 mRNA Translation: CAC84523.1
AJ310900 mRNA Translation: CAC84524.1
M16461 mRNA Translation: AAA52306.1
M16462 mRNA Translation: AAA52307.1
CCDSiCCDS14040.1 [P00387-2]
CCDS33658.1 [P00387-1]
CCDS54535.1 [P00387-3]
PIRiJS0468, RDHUB5
RefSeqiNP_000389.1, NM_000398.6 [P00387-1]
NP_001123291.1, NM_001129819.2 [P00387-2]
NP_001165131.1, NM_001171660.1 [P00387-3]
NP_001165132.1, NM_001171661.1 [P00387-2]
NP_015565.1, NM_007326.4 [P00387-2]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1M91model-A1-301[»]
1UMKX-ray1.75A27-301[»]
SMRiP00387
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi108071, 244 interactors
DIPiDIP-50463N
IntActiP00387, 102 interactors
STRINGi9606.ENSP00000354468

Chemistry databases

ChEMBLiCHEMBL2146
DrugBankiDB09130, Copper
DB03147, Flavin adenine dinucleotide
DB00157, NADH

PTM databases

iPTMnetiP00387
MetOSiteiP00387
PhosphoSitePlusiP00387
SwissPalmiP00387

Genetic variation databases

BioMutaiCYB5R3
DMDMi127846

2D gel databases

REPRODUCTION-2DPAGEiIPI00446235

Proteomic databases

CPTACiCPTAC-55
CPTAC-56
EPDiP00387
jPOSTiP00387
MassIVEiP00387
MaxQBiP00387
PaxDbiP00387
PeptideAtlasiP00387
PRIDEiP00387
ProteomicsDBi51238 [P00387-1]
51239 [P00387-2]
51240 [P00387-3]
TopDownProteomicsiP00387-1 [P00387-1]
P00387-2 [P00387-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		219, 428 antibodies

The DNASU plasmid repository

More...DNASUi		1727

Genome annotation databases

EnsembliENST00000352397; ENSP00000338461; ENSG00000100243 [P00387-1]
ENST00000361740; ENSP00000354468; ENSG00000100243 [P00387-3]
ENST00000402438; ENSP00000385679; ENSG00000100243 [P00387-2]
ENST00000407332; ENSP00000384457; ENSG00000100243 [P00387-2]
ENST00000407623; ENSP00000384834; ENSG00000100243 [P00387-2]
GeneIDi1727
KEGGihsa:1727
UCSCiuc003bcx.4, human [P00387-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		1727
DisGeNETi1727

GeneCards: human genes, protein and diseases

More...GeneCardsi		CYB5R3
HGNCiHGNC:2873, CYB5R3
HPAiENSG00000100243, Low tissue specificity
MalaCardsiCYB5R3
MIMi250800, phenotype
613213, gene
neXtProtiNX_P00387
OpenTargetsiENSG00000100243
Orphaneti621, Hereditary methemoglobinemia
PharmGKBiPA27331
VEuPathDBiHostDB:ENSG00000100243.20

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0534, Eukaryota
GeneTreeiENSGT00940000153962
HOGENOMiCLU_003827_9_2_1
InParanoidiP00387
OMAiKHDHIAL
OrthoDBi1311668at2759
PhylomeDBiP00387
TreeFamiTF314333

Enzyme and pathway databases

BioCyciMetaCyc:HS02015-MONOMER
BRENDAi1.6.2.2, 2681
PathwayCommonsiP00387
ReactomeiR-HSA-196836, Vitamin C (ascorbate) metabolism
R-HSA-211945, Phase I - Functionalization of compounds
R-HSA-6798695, Neutrophil degranulation
SABIO-RKiP00387

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		1727, 11 hits in 999 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		CYB5R3, human
EvolutionaryTraceiP00387

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		CYB5R3

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		1727
PharosiP00387, Tbio

Protein Ontology

More...PROi		PR:P00387
RNActiP00387, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000100243, Expressed in thoracic aorta and 252 other tissues
ExpressionAtlasiP00387, baseline and differential
GenevisibleiP00387, HS

Family and domain databases

Gene3Di3.40.50.80, 1 hit
InterProiView protein in InterPro
IPR001834, CBR-like
IPR008333, Cbr1-like_FAD-bd_dom
IPR017927, FAD-bd_FR_type
IPR001709, Flavoprot_Pyr_Nucl_cyt_Rdtase
IPR039261, FNR_nucleotide-bd
IPR001433, OxRdtase_FAD/NAD-bd
IPR017938, Riboflavin_synthase-like_b-brl
PfamiView protein in Pfam
PF00970, FAD_binding_6, 1 hit
PF00175, NAD_binding_1, 1 hit
PRINTSiPR00406, CYTB5RDTASE
PR00371, FPNCR
SUPFAMiSSF52343, SSF52343, 1 hit
SSF63380, SSF63380, 1 hit
PROSITEiView protein in PROSITE
PS51384, FAD_FR, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNB5R3_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P00387
Secondary accession number(s): B1AHF2
, B7Z7L3, O75675, Q8TDL8, Q8WTS8, Q9UEN4, Q9UEN5, Q9UL55, Q9UL56
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 21, 1986
Last sequence update: January 23, 2007
Last modified: June 2, 2021
This is version 255 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again