Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

NADH-cytochrome b5 reductase 3

Gene

CYB5R3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Desaturation and elongation of fatty acids, cholesterol biosynthesis, drug metabolism, and, in erythrocyte, methemoglobin reduction.

Catalytic activityi

NADH + 2 ferricytochrome b5 = NAD+ + H+ + 2 ferrocytochrome b5.

Cofactori

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi132 – 147FADBy similarityAdd BLAST16
Nucleotide bindingi171 – 206FADBy similarityAdd BLAST36

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionOxidoreductase
Biological processCholesterol biosynthesis, Cholesterol metabolism, Lipid biosynthesis, Lipid metabolism, Steroid biosynthesis, Steroid metabolism, Sterol biosynthesis, Sterol metabolism
LigandFAD, Flavoprotein, NAD

Enzyme and pathway databases

BioCyciMetaCyc:HS02015-MONOMER
BRENDAi1.6.2.2 2681
ReactomeiR-HSA-196836 Vitamin C (ascorbate) metabolism
R-HSA-211945 Phase I - Functionalization of compounds
R-HSA-6798695 Neutrophil degranulation
SABIO-RKiP00387

Names & Taxonomyi

Protein namesi
Recommended name:
NADH-cytochrome b5 reductase 3 (EC:1.6.2.2)
Short name:
B5R
Short name:
Cytochrome b5 reductase
Alternative name(s):
Diaphorase-1
Cleaved into the following 2 chains:
Gene namesi
Name:CYB5R3
Synonyms:DIA1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 22

Organism-specific databases

EuPathDBiHostDB:ENSG00000100243.20
HGNCiHGNC:2873 CYB5R3
MIMi613213 gene
neXtProtiNX_P00387

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Endoplasmic reticulum, Membrane, Mitochondrion, Mitochondrion outer membrane

Pathology & Biotechi

Involvement in diseasei

Methemoglobinemia CYB5R3-related (METHB-CYB5R3)11 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of methemoglobinemia, a hematologic disease characterized by the presence of excessive amounts of methemoglobin in blood cells, resulting in decreased oxygen carrying capacity of the blood, cyanosis and hypoxia. There are two types of methemoglobinemia CYB5R3-related. In type 1, the defect affects the soluble form of the enzyme, is restricted to red blood cells, and causes well-tolerated methemoglobinemia. In type 2, the defect affects both the soluble and microsomal forms of the enzyme and is thus generalized, affecting red cells, leukocytes and all body tissues. Type 2 methemoglobinemia is associated with mental deficiency and other neurologic symptoms.
See also OMIM:250800
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_00461958R → Q in METHB-CYB5R3; type 1; 62% of activity. 3 PublicationsCorresponds to variant dbSNP:rs121965007EnsemblClinVar.1
Natural variantiVAR_01075073L → P in METHB-CYB5R3; type 1. 2 PublicationsCorresponds to variant dbSNP:rs121965013EnsemblClinVar.1
Natural variantiVAR_004620106V → M in METHB-CYB5R3; type 1; 77% of activity. 1 PublicationCorresponds to variant dbSNP:rs121965009EnsemblClinVar.1
Natural variantiVAR_004621128S → P in METHB-CYB5R3; type 2; Hiroshima. 1 PublicationCorresponds to variant dbSNP:rs121965006EnsemblClinVar.1
Natural variantiVAR_004622149L → P in METHB-CYB5R3. 1 PublicationCorresponds to variant dbSNP:rs121965008EnsemblClinVar.1
Natural variantiVAR_010752179A → V in METHB-CYB5R3; type 1. 1 PublicationCorresponds to variant dbSNP:rs201232518Ensembl.1
Natural variantiVAR_010753204C → R in METHB-CYB5R3; type 2. 1 PublicationCorresponds to variant dbSNP:rs121965011EnsemblClinVar.1
Natural variantiVAR_010754204C → Y in METHB-CYB5R3; type 1. 2 PublicationsCorresponds to variant dbSNP:rs121965015EnsemblClinVar.1
Natural variantiVAR_037315256Missing in METHB-CYB5R3; type 1; retains approximately 38% of residual diaphorase activity. 2 Publications1
Natural variantiVAR_010755273Missing in METHB-CYB5R3; type 2. 1 Publication1
Natural variantiVAR_037316292G → D in METHB-CYB5R3; type 1; retains approximately 58% of residual diaphorase activity. 2 PublicationsCorresponds to variant dbSNP:rs121965016EnsemblClinVar.1
Natural variantiVAR_004623299Missing in METHB-CYB5R3; type2; almost complete loss of activity. 1 Publication1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNETi1727
MalaCardsiCYB5R3
MIMi250800 phenotype
OpenTargetsiENSG00000100243
Orphaneti621 Hereditary methemoglobinemia
PharmGKBiPA27331

Chemistry databases

ChEMBLiCHEMBL2146
DrugBankiDB03147 Flavin adenine dinucleotide
DB00157 NADH

Polymorphism and mutation databases

BioMutaiCYB5R3
DMDMi127846

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemoved1 Publication
ChainiPRO_00000193922 – 301NADH-cytochrome b5 reductase 3 membrane-bound formAdd BLAST300
ChainiPRO_000001939427 – 301NADH-cytochrome b5 reductase 3 soluble formAdd BLAST275

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Lipidationi2N-myristoyl glycine2 Publications1
Modified residuei42N6-acetyllysineCombined sources1
Modified residuei43PhosphotyrosineCombined sources1
Modified residuei120N6-acetyllysineBy similarity1

Keywords - PTMi

Acetylation, Lipoprotein, Myristate, Phosphoprotein

Proteomic databases

EPDiP00387
MaxQBiP00387
PaxDbiP00387
PeptideAtlasiP00387
PRIDEiP00387
ProteomicsDBi51238
51239 [P00387-2]
51240 [P00387-3]
TopDownProteomicsiP00387-1 [P00387-1]
P00387-2 [P00387-2]

2D gel databases

REPRODUCTION-2DPAGEiIPI00446235

PTM databases

iPTMnetiP00387
PhosphoSitePlusiP00387
SwissPalmiP00387

Expressioni

Tissue specificityi

Isoform 2 is expressed at late stages of erythroid maturation.

Gene expression databases

BgeeiENSG00000100243 Expressed in 239 organ(s), highest expression level in thoracic aorta
CleanExiHS_CYB5R3
ExpressionAtlasiP00387 baseline and differential
GenevisibleiP00387 HS

Organism-specific databases

HPAiHPA001566

Interactioni

Subunit structurei

Component of a complex composed of cytochrome b5, NADH-cytochrome b5 reductase (CYB5R3) and MOSC2.By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
HBA2P699052EBI-1046040,EBI-714680

Protein-protein interaction databases

BioGridi108071, 46 interactors
DIPiDIP-50463N
IntActiP00387, 66 interactors
STRINGi9606.ENSP00000354468

Structurei

Secondary structure

1301
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliP00387
SMRiP00387
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP00387

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini40 – 152FAD-binding FR-typePROSITE-ProRule annotationAdd BLAST113

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG0534 Eukaryota
COG0543 LUCA
GeneTreeiENSGT00390000008881
HOGENOMiHOG000175005
HOVERGENiHBG052580
InParanoidiP00387
KOiK00326
OMAiHNTAIYR
OrthoDBiEOG091G0EIS
PhylomeDBiP00387
TreeFamiTF314333

Family and domain databases

Gene3Di3.40.50.80, 1 hit
InterProiView protein in InterPro
IPR008333 Cbr1-like_FAD-bd_dom
IPR017927 FAD-bd_FR_type
IPR001709 Flavoprot_Pyr_Nucl_cyt_Rdtase
IPR039261 FNR_nucleotide-bd
IPR001834 NADH-Cyt_B5_reductase
IPR001433 OxRdtase_FAD/NAD-bd
IPR017938 Riboflavin_synthase-like_b-brl
PfamiView protein in Pfam
PF00970 FAD_binding_6, 1 hit
PF00175 NAD_binding_1, 1 hit
PRINTSiPR00406 CYTB5RDTASE
PR00371 FPNCR
SUPFAMiSSF52343 SSF52343, 1 hit
SSF63380 SSF63380, 1 hit
PROSITEiView protein in PROSITE
PS51384 FAD_FR, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative promoter usage and alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: P00387-1) [UniParc]FASTAAdd to basket
Also known as: M

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGAQLSTLGH MVLFPVWFLY SLLMKLFQRS TPAITLESPD IKYPLRLIDR
60 70 80 90 100
EIISHDTRRF RFALPSPQHI LGLPVGQHIY LSARIDGNLV VRPYTPISSD
110 120 130 140 150
DDKGFVDLVI KVYFKDTHPK FPAGGKMSQY LESMQIGDTI EFRGPSGLLV
160 170 180 190 200
YQGKGKFAIR PDKKSNPIIR TVKSVGMIAG GTGITPMLQV IRAIMKDPDD
210 220 230 240 250
HTVCHLLFAN QTEKDILLRP ELEELRNKHS ARFKLWYTLD RAPEAWDYGQ
260 270 280 290 300
GFVNEEMIRD HLPPPEEEPL VLMCGPPPMI QYACLPNLDH VGHPTERCFV

F
Length:301
Mass (Da):34,235
Last modified:January 23, 2007 - v3
Checksum:iFDCDCDC4EC3570B4
GO
Isoform 2 (identifier: P00387-2) [UniParc]FASTAAdd to basket
Also known as: S

The sequence of this isoform differs from the canonical sequence as follows:
     1-23: Missing.

Show »
Length:278
Mass (Da):31,629
Checksum:i229597F14FA6582E
GO
Isoform 3 (identifier: P00387-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-7: MGAQLST → MNRSLLVGCMQSKDIWGREESICERLKQDGLDVERAESWE

Note: No experimental confirmation available.
Show »
Length:334
Mass (Da):38,226
Checksum:i91CCE3D9A18621E8
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B1AHF3B1AHF3_HUMAN
NADH-cytochrome b5 reductase 3
CYB5R3
147Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti28 – 32QRSTP → RWPRA in AAA52307 (PubMed:3035541).Curated5
Sequence conflicti29R → G in AAA59900 (PubMed:2479590).Curated1
Sequence conflicti31T → K in CAA09006 (Ref. 4) Curated1
Sequence conflicti31T → K in CAA09007 (Ref. 4) Curated1
Sequence conflicti31T → K in CAA09008 (Ref. 4) Curated1
Sequence conflicti34 – 35IT → LA in AAA52307 (PubMed:3035541).Curated2
Sequence conflicti187 – 188ML → IV in CAA09006 (Ref. 4) Curated2
Sequence conflicti187 – 188ML → IV in CAA09007 (Ref. 4) Curated2
Sequence conflicti191 – 192IR → MS in CAA09006 (Ref. 4) Curated2
Sequence conflicti191 – 192IR → MS in CAA09007 (Ref. 4) Curated2
Sequence conflicti192R → G in AAA52306 (PubMed:3035541).Curated1
Sequence conflicti233 – 234FK → CN in CAA09006 (Ref. 4) Curated2
Sequence conflicti233 – 234FK → CN in CAA09007 (Ref. 4) Curated2
Sequence conflicti280I → N in AAL87744 (Ref. 3) Curated1

Polymorphismi

Ser-117 seems to only be found in persons of African origin. The allele frequency is 0.23 in African Americans. It was not found in Caucasians, Asians, Indo-Aryans, or Arabs. There seems to be no effect on the enzyme activity.1 Publication

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_00461958R → Q in METHB-CYB5R3; type 1; 62% of activity. 3 PublicationsCorresponds to variant dbSNP:rs121965007EnsemblClinVar.1
Natural variantiVAR_01841966S → P3 PublicationsCorresponds to variant dbSNP:rs1130706Ensembl.1
Natural variantiVAR_01075073L → P in METHB-CYB5R3; type 1. 2 PublicationsCorresponds to variant dbSNP:rs121965013EnsemblClinVar.1
Natural variantiVAR_004620106V → M in METHB-CYB5R3; type 1; 77% of activity. 1 PublicationCorresponds to variant dbSNP:rs121965009EnsemblClinVar.1
Natural variantiVAR_010751117T → S2 PublicationsCorresponds to variant dbSNP:rs1800457EnsemblClinVar.1
Natural variantiVAR_004621128S → P in METHB-CYB5R3; type 2; Hiroshima. 1 PublicationCorresponds to variant dbSNP:rs121965006EnsemblClinVar.1
Natural variantiVAR_004622149L → P in METHB-CYB5R3. 1 PublicationCorresponds to variant dbSNP:rs121965008EnsemblClinVar.1
Natural variantiVAR_010752179A → V in METHB-CYB5R3; type 1. 1 PublicationCorresponds to variant dbSNP:rs201232518Ensembl.1
Natural variantiVAR_010753204C → R in METHB-CYB5R3; type 2. 1 PublicationCorresponds to variant dbSNP:rs121965011EnsemblClinVar.1
Natural variantiVAR_010754204C → Y in METHB-CYB5R3; type 1. 2 PublicationsCorresponds to variant dbSNP:rs121965015EnsemblClinVar.1
Natural variantiVAR_037315256Missing in METHB-CYB5R3; type 1; retains approximately 38% of residual diaphorase activity. 2 Publications1
Natural variantiVAR_010755273Missing in METHB-CYB5R3; type 2. 1 Publication1
Natural variantiVAR_037316292G → D in METHB-CYB5R3; type 1; retains approximately 58% of residual diaphorase activity. 2 PublicationsCorresponds to variant dbSNP:rs121965016EnsemblClinVar.1
Natural variantiVAR_004623299Missing in METHB-CYB5R3; type2; almost complete loss of activity. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0102001 – 23Missing in isoform 2. CuratedAdd BLAST23
Alternative sequenceiVSP_0428271 – 7MGAQLST → MNRSLLVGCMQSKDIWGREE SICERLKQDGLDVERAESWE in isoform 3. 1 Publication7

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M28713
, M28705, M28706, M28707, M28708, M28709, M28710, M28711 Genomic DNA Translation: AAA59900.1
Y09501 mRNA Translation: CAA70696.1
AF361370 mRNA Translation: AAL87744.1
AJ010116 mRNA Translation: CAA09006.1
AJ010117 mRNA Translation: CAA09007.1
AJ010118 mRNA Translation: CAA09008.1
AY341030 Genomic DNA Translation: AAP88936.1
BT009821 mRNA Translation: AAP88823.1
CR456435 mRNA Translation: CAG30321.1
AF061830 Genomic DNA Translation: AAF06818.1
AF061831 Genomic DNA Translation: AAF06819.1
AK302204 mRNA Translation: BAH13649.1
Z93241 Genomic DNA No translation available.
BC004821 mRNA Translation: AAH04821.1
AJ310899 mRNA Translation: CAC84523.1
AJ310900 mRNA Translation: CAC84524.1
M16461 mRNA Translation: AAA52306.1
M16462 mRNA Translation: AAA52307.1
CCDSiCCDS14040.1 [P00387-2]
CCDS33658.1 [P00387-1]
CCDS54535.1 [P00387-3]
PIRiJS0468 RDHUB5
RefSeqiNP_000389.1, NM_000398.6 [P00387-1]
NP_001123291.1, NM_001129819.2 [P00387-2]
NP_001165131.1, NM_001171660.1 [P00387-3]
NP_001165132.1, NM_001171661.1 [P00387-2]
NP_015565.1, NM_007326.4 [P00387-2]
UniGeneiHs.561064

Genome annotation databases

EnsembliENST00000352397; ENSP00000338461; ENSG00000100243 [P00387-1]
ENST00000361740; ENSP00000354468; ENSG00000100243 [P00387-3]
ENST00000402438; ENSP00000385679; ENSG00000100243 [P00387-2]
ENST00000407332; ENSP00000384457; ENSG00000100243 [P00387-2]
ENST00000407623; ENSP00000384834; ENSG00000100243 [P00387-2]
GeneIDi1727
KEGGihsa:1727
UCSCiuc003bcx.4 human [P00387-1]

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M28713
, M28705, M28706, M28707, M28708, M28709, M28710, M28711 Genomic DNA Translation: AAA59900.1
Y09501 mRNA Translation: CAA70696.1
AF361370 mRNA Translation: AAL87744.1
AJ010116 mRNA Translation: CAA09006.1
AJ010117 mRNA Translation: CAA09007.1
AJ010118 mRNA Translation: CAA09008.1
AY341030 Genomic DNA Translation: AAP88936.1
BT009821 mRNA Translation: AAP88823.1
CR456435 mRNA Translation: CAG30321.1
AF061830 Genomic DNA Translation: AAF06818.1
AF061831 Genomic DNA Translation: AAF06819.1
AK302204 mRNA Translation: BAH13649.1
Z93241 Genomic DNA No translation available.
BC004821 mRNA Translation: AAH04821.1
AJ310899 mRNA Translation: CAC84523.1
AJ310900 mRNA Translation: CAC84524.1
M16461 mRNA Translation: AAA52306.1
M16462 mRNA Translation: AAA52307.1
CCDSiCCDS14040.1 [P00387-2]
CCDS33658.1 [P00387-1]
CCDS54535.1 [P00387-3]
PIRiJS0468 RDHUB5
RefSeqiNP_000389.1, NM_000398.6 [P00387-1]
NP_001123291.1, NM_001129819.2 [P00387-2]
NP_001165131.1, NM_001171660.1 [P00387-3]
NP_001165132.1, NM_001171661.1 [P00387-2]
NP_015565.1, NM_007326.4 [P00387-2]
UniGeneiHs.561064

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1M91model-A1-301[»]
1UMKX-ray1.75A27-301[»]
ProteinModelPortaliP00387
SMRiP00387
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi108071, 46 interactors
DIPiDIP-50463N
IntActiP00387, 66 interactors
STRINGi9606.ENSP00000354468

Chemistry databases

ChEMBLiCHEMBL2146
DrugBankiDB03147 Flavin adenine dinucleotide
DB00157 NADH

PTM databases

iPTMnetiP00387
PhosphoSitePlusiP00387
SwissPalmiP00387

Polymorphism and mutation databases

BioMutaiCYB5R3
DMDMi127846

2D gel databases

REPRODUCTION-2DPAGEiIPI00446235

Proteomic databases

EPDiP00387
MaxQBiP00387
PaxDbiP00387
PeptideAtlasiP00387
PRIDEiP00387
ProteomicsDBi51238
51239 [P00387-2]
51240 [P00387-3]
TopDownProteomicsiP00387-1 [P00387-1]
P00387-2 [P00387-2]

Protocols and materials databases

DNASUi1727
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000352397; ENSP00000338461; ENSG00000100243 [P00387-1]
ENST00000361740; ENSP00000354468; ENSG00000100243 [P00387-3]
ENST00000402438; ENSP00000385679; ENSG00000100243 [P00387-2]
ENST00000407332; ENSP00000384457; ENSG00000100243 [P00387-2]
ENST00000407623; ENSP00000384834; ENSG00000100243 [P00387-2]
GeneIDi1727
KEGGihsa:1727
UCSCiuc003bcx.4 human [P00387-1]

Organism-specific databases

CTDi1727
DisGeNETi1727
EuPathDBiHostDB:ENSG00000100243.20
GeneCardsiCYB5R3
HGNCiHGNC:2873 CYB5R3
HPAiHPA001566
MalaCardsiCYB5R3
MIMi250800 phenotype
613213 gene
neXtProtiNX_P00387
OpenTargetsiENSG00000100243
Orphaneti621 Hereditary methemoglobinemia
PharmGKBiPA27331
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0534 Eukaryota
COG0543 LUCA
GeneTreeiENSGT00390000008881
HOGENOMiHOG000175005
HOVERGENiHBG052580
InParanoidiP00387
KOiK00326
OMAiHNTAIYR
OrthoDBiEOG091G0EIS
PhylomeDBiP00387
TreeFamiTF314333

Enzyme and pathway databases

BioCyciMetaCyc:HS02015-MONOMER
BRENDAi1.6.2.2 2681
ReactomeiR-HSA-196836 Vitamin C (ascorbate) metabolism
R-HSA-211945 Phase I - Functionalization of compounds
R-HSA-6798695 Neutrophil degranulation
SABIO-RKiP00387

Miscellaneous databases

EvolutionaryTraceiP00387
GeneWikiiCYB5R3
GenomeRNAii1727
PROiPR:P00387
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000100243 Expressed in 239 organ(s), highest expression level in thoracic aorta
CleanExiHS_CYB5R3
ExpressionAtlasiP00387 baseline and differential
GenevisibleiP00387 HS

Family and domain databases

Gene3Di3.40.50.80, 1 hit
InterProiView protein in InterPro
IPR008333 Cbr1-like_FAD-bd_dom
IPR017927 FAD-bd_FR_type
IPR001709 Flavoprot_Pyr_Nucl_cyt_Rdtase
IPR039261 FNR_nucleotide-bd
IPR001834 NADH-Cyt_B5_reductase
IPR001433 OxRdtase_FAD/NAD-bd
IPR017938 Riboflavin_synthase-like_b-brl
PfamiView protein in Pfam
PF00970 FAD_binding_6, 1 hit
PF00175 NAD_binding_1, 1 hit
PRINTSiPR00406 CYTB5RDTASE
PR00371 FPNCR
SUPFAMiSSF52343 SSF52343, 1 hit
SSF63380 SSF63380, 1 hit
PROSITEiView protein in PROSITE
PS51384 FAD_FR, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiNB5R3_HUMAN
AccessioniPrimary (citable) accession number: P00387
Secondary accession number(s): B1AHF2
, B7Z7L3, O75675, Q8TDL8, Q8WTS8, Q9UEN4, Q9UEN5, Q9UL55, Q9UL56
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 21, 1986
Last sequence update: January 23, 2007
Last modified: November 7, 2018
This is version 236 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again