Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

L-lactate dehydrogenase A chain

Gene

LDHA

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Catalytic activityi

(S)-lactate + NAD+ = pyruvate + NADH.

Pathwayi: pyruvate fermentation to lactate

This protein is involved in step 1 of the subpathway that synthesizes (S)-lactate from pyruvate.
Proteins known to be involved in this subpathway in this organism are:
  1. L-lactate dehydrogenase A chain (LDHA), L-lactate dehydrogenase A-like 6B (LDHAL6B), L-lactate dehydrogenase A-like 6A (LDHAL6A), L-lactate dehydrogenase C chain (LDHC), L-lactate dehydrogenase B chain (LDHB), L-lactate dehydrogenase (LDHC), L-lactate dehydrogenase (LDHC), L-lactate dehydrogenase (LDHC), L-lactate dehydrogenase (LDHAL6A), L-lactate dehydrogenase (HEL-S-281), L-lactate dehydrogenase (LDHC), L-lactate dehydrogenase, L-lactate dehydrogenase (LDHC), L-lactate dehydrogenase (LDHB), L-lactate dehydrogenase (HEL-S-133P), L-lactate dehydrogenase, L-lactate dehydrogenase, L-lactate dehydrogenase (LDHAL6A), L-lactate dehydrogenase (LDHC), L-lactate dehydrogenase (LDHC)
This subpathway is part of the pathway pyruvate fermentation to lactate, which is itself part of Fermentation.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes (S)-lactate from pyruvate, the pathway pyruvate fermentation to lactate and in Fermentation.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei99NAD1 Publication1
Binding sitei106Substrate1
Binding sitei138NAD or substrate1 Publication1
Binding sitei169Substrate1
Active sitei193Proton acceptor1
Binding sitei248Substrate1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi29 – 57NAD1 PublicationAdd BLAST29

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionOxidoreductase
LigandNAD

Enzyme and pathway databases

ReactomeiR-HSA-70268 Pyruvate metabolism
SABIO-RKiP00338
SIGNORiP00338
UniPathwayi
UPA00554;UER00611

Names & Taxonomyi

Protein namesi
Recommended name:
L-lactate dehydrogenase A chain (EC:1.1.1.27)
Short name:
LDH-A
Alternative name(s):
Cell proliferation-inducing gene 19 protein
LDH muscle subunit
Short name:
LDH-M
Renal carcinoma antigen NY-REN-59
Gene namesi
Name:LDHA
ORF Names:PIG19
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

EuPathDBiHostDB:ENSG00000134333.13
HGNCiHGNC:6535 LDHA
MIMi150000 gene
neXtProtiNX_P00338

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Involvement in diseasei

Glycogen storage disease 11 (GSD11)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA metabolic disorder that results in exertional myoglobinuria, pain, cramps and easy fatigue.
See also OMIM:612933

Keywords - Diseasei

Disease mutation, Glycogen storage disease

Organism-specific databases

DisGeNETi3939
MalaCardsiLDHA
MIMi612933 phenotype
OpenTargetsiENSG00000134333
Orphaneti284426 Glycogen storage disease due to lactate dehydrogenase M-subunit deficiency
PharmGKBiPA30319

Chemistry databases

ChEMBLiCHEMBL4835
DrugBankiDB02483 Etheno-Nad
DB00157 NADH
DB02701 Nicotinamide
DB03940 Oxamic Acid

Polymorphism and mutation databases

BioMutaiLDHA
DMDMi126047

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources1 Publication
ChainiPRO_00001684112 – 332L-lactate dehydrogenase A chainAdd BLAST331

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1 Publication1
Modified residuei5N6-acetyllysine; alternateCombined sources1
Modified residuei5N6-succinyllysine; alternateBy similarity1
Modified residuei10PhosphotyrosineCombined sources1
Modified residuei14N6-acetyllysineCombined sources1
Modified residuei18PhosphothreonineCombined sources1
Modified residuei57N6-acetyllysine; alternateCombined sources1
Cross-linki57Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternateCombined sources
Modified residuei81N6-acetyllysineCombined sources1
Modified residuei118N6-acetyllysine; alternateCombined sources1
Modified residuei118N6-succinyllysine; alternateBy similarity1
Modified residuei126N6-acetyllysineCombined sources1
Modified residuei224N6-acetyllysineBy similarity1
Modified residuei232N6-acetyllysineBy similarity1
Modified residuei239PhosphotyrosineBy similarity1
Modified residuei243N6-acetyllysineBy similarity1
Modified residuei309PhosphothreonineBy similarity1
Modified residuei310PhosphoserineCombined sources1
Modified residuei318N6-acetyllysine; alternateCombined sources1
Modified residuei318N6-succinyllysine; alternateBy similarity1
Modified residuei322PhosphothreonineBy similarity1

Post-translational modificationi

ISGylated.1 Publication

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiP00338
PaxDbiP00338
PeptideAtlasiP00338
PRIDEiP00338
ProteomicsDBi51230
51231 [P00338-2]
51232 [P00338-3]
51233 [P00338-4]
51234 [P00338-5]
TopDownProteomicsiP00338-1 [P00338-1]
P00338-4 [P00338-4]
P00338-5 [P00338-5]

2D gel databases

DOSAC-COBS-2DPAGEiP00338
OGPiP00338
REPRODUCTION-2DPAGEiIPI00217966

PTM databases

iPTMnetiP00338
PhosphoSitePlusiP00338
SwissPalmiP00338

Expressioni

Gene expression databases

BgeeiENSG00000134333 Expressed in 107 organ(s), highest expression level in left coronary artery
CleanExiHS_LDHA
ExpressionAtlasiP00338 baseline and differential
GenevisibleiP00338 HS

Organism-specific databases

HPAiCAB015336
CAB069404

Interactioni

Subunit structurei

Homotetramer.1 Publication

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi110131, 159 interactors
IntActiP00338, 46 interactors
MINTiP00338
STRINGi9606.ENSP00000445175

Chemistry databases

BindingDBiP00338

Structurei

Secondary structure

1332
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliP00338
SMRiP00338
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP00338

Family & Domainsi

Sequence similaritiesi

Belongs to the LDH/MDH superfamily. LDH family.Curated

Phylogenomic databases

eggNOGiKOG1495 Eukaryota
COG0039 LUCA
GeneTreeiENSGT00550000074541
HOGENOMiHOG000213793
HOVERGENiHBG000462
InParanoidiP00338
KOiK00016
OMAiMDLMQTA
OrthoDBiEOG091G0HME
PhylomeDBiP00338
TreeFamiTF314963

Family and domain databases

Gene3Di3.90.110.10, 1 hit
HAMAPiMF_00488 Lactate_dehydrog, 1 hit
InterProiView protein in InterPro
IPR001557 L-lactate/malate_DH
IPR011304 L-lactate_DH
IPR018177 L-lactate_DH_AS
IPR022383 Lactate/malate_DH_C
IPR001236 Lactate/malate_DH_N
IPR015955 Lactate_DH/Glyco_Ohase_4_C
IPR036291 NAD(P)-bd_dom_sf
PfamiView protein in Pfam
PF02866 Ldh_1_C, 1 hit
PF00056 Ldh_1_N, 1 hit
PIRSFiPIRSF000102 Lac_mal_DH, 1 hit
PRINTSiPR00086 LLDHDRGNASE
SUPFAMiSSF51735 SSF51735, 1 hit
SSF56327 SSF56327, 1 hit
TIGRFAMsiTIGR01771 L-LDH-NAD, 1 hit
PROSITEiView protein in PROSITE
PS00064 L_LDH, 1 hit

Sequences (5+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 10 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P00338-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MATLKDQLIY NLLKEEQTPQ NKITVVGVGA VGMACAISIL MKDLADELAL
60 70 80 90 100
VDVIEDKLKG EMMDLQHGSL FLRTPKIVSG KDYNVTANSK LVIITAGARQ
110 120 130 140 150
QEGESRLNLV QRNVNIFKFI IPNVVKYSPN CKLLIVSNPV DILTYVAWKI
160 170 180 190 200
SGFPKNRVIG SGCNLDSARF RYLMGERLGV HPLSCHGWVL GEHGDSSVPV
210 220 230 240 250
WSGMNVAGVS LKTLHPDLGT DKDKEQWKEV HKQVVESAYE VIKLKGYTSW
260 270 280 290 300
AIGLSVADLA ESIMKNLRRV HPVSTMIKGL YGIKDDVFLS VPCILGQNGI
310 320 330
SDLVKVTLTS EEEARLKKSA DTLWGIQKEL QF
Length:332
Mass (Da):36,689
Last modified:January 23, 2007 - v2
Checksum:i401E8604CEB7F908
GO
Isoform 2 (identifier: P00338-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     230-274: VHKQVVESAY...KNLRRVHPVS → CRYTLGDPKG...ACCPFYLICD
     275-332: Missing.

Note: No experimental confirmation available.
Show »
Length:274
Mass (Da):30,057
Checksum:iD43CB4ACB426D6F0
GO
Isoform 3 (identifier: P00338-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGEPSGGYTYTQTSIFLFHAKIPFGSKSNM

Show »
Length:361
Mass (Da):39,837
Checksum:iD47D88F7C90BF11D
GO
Isoform 4 (identifier: P00338-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     82-139: Missing.

Show »
Length:274
Mass (Da):30,205
Checksum:i1EB83D11978134AD
GO
Isoform 5 (identifier: P00338-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     237-241: SAYEV → RVFTE
     242-332: Missing.

Show »
Length:241
Mass (Da):26,712
Checksum:i20B4A3E33A1ED002
GO

Computationally mapped potential isoform sequencesi

There are 10 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F5H8H6F5H8H6_HUMAN
L-lactate dehydrogenase A chain
LDHA
42Annotation score:
F5GXC7F5GXC7_HUMAN
L-lactate dehydrogenase A chain
LDHA
45Annotation score:
F5GWW2F5GWW2_HUMAN
L-lactate dehydrogenase A chain
LDHA
45Annotation score:
F5GXU1F5GXU1_HUMAN
L-lactate dehydrogenase A chain
LDHA
46Annotation score:
F5GZQ4F5GZQ4_HUMAN
L-lactate dehydrogenase A chain
LDHA
72Annotation score:
F5GXH2F5GXH2_HUMAN
L-lactate dehydrogenase A chain
LDHA
114Annotation score:
F5GYU2F5GYU2_HUMAN
L-lactate dehydrogenase A chain
LDHA
144Annotation score:
F5H5J4F5H5J4_HUMAN
L-lactate dehydrogenase A chain
LDHA
89Annotation score:
F5H6W8F5H6W8_HUMAN
L-lactate dehydrogenase A chain
LDHA
94Annotation score:
F5GXY2F5GXY2_HUMAN
L-lactate dehydrogenase A chain
LDHA
156Annotation score:

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_004180222K → E2 PublicationsCorresponds to variant dbSNP:rs748436361Ensembl.1
Natural variantiVAR_004181315R → C1 PublicationCorresponds to variant dbSNP:rs200093825Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0422061M → MGEPSGGYTYTQTSIFLFHA KIPFGSKSNM in isoform 3. 1 Publication1
Alternative sequenceiVSP_04278682 – 139Missing in isoform 4. 1 PublicationAdd BLAST58
Alternative sequenceiVSP_014261230 – 274VHKQV…VHPVS → CRYTLGDPKGAAILKSSDVI SFHCLGYNRILGGGCACCPF YLICD in isoform 2. 1 PublicationAdd BLAST45
Alternative sequenceiVSP_042788237 – 241SAYEV → RVFTE in isoform 5. Curated5
Alternative sequenceiVSP_042789242 – 332Missing in isoform 5. CuratedAdd BLAST91
Alternative sequenceiVSP_042787275 – 332Missing in isoform 2. 1 PublicationAdd BLAST58

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X02152 mRNA Translation: CAA26088.1
X03077
, X03078, X03079, X03080, X03081, X03082, X03083 Genomic DNA Translation: CAA26879.1
AY423727 mRNA Translation: AAS00490.1
AK130587 mRNA Translation: BAC85389.1
AK296667 mRNA Translation: BAG59264.1
AK298834 mRNA Translation: BAH12879.1
CR456775 mRNA Translation: CAG33056.1
CR541714 mRNA Translation: CAG46515.1
AK223078 mRNA Translation: BAD96798.1
AC084117 Genomic DNA No translation available.
CH471064 Genomic DNA Translation: EAW68395.1
CH471064 Genomic DNA Translation: EAW68396.1
BC067223 mRNA Translation: AAH67223.1
S66853 Genomic DNA Translation: AAB20418.1
CCDSiCCDS44549.1 [P00338-4]
CCDS53609.1 [P00338-3]
CCDS53610.1 [P00338-2]
CCDS53611.1 [P00338-5]
CCDS7839.1 [P00338-1]
PIRiA00347 DEHULM
RefSeqiNP_001128711.1, NM_001135239.1 [P00338-4]
NP_001158886.1, NM_001165414.1 [P00338-3]
NP_001158887.1, NM_001165415.1 [P00338-2]
NP_001158888.1, NM_001165416.1 [P00338-5]
NP_005557.1, NM_005566.3 [P00338-1]
UniGeneiHs.2795

Genome annotation databases

EnsembliENST00000227157; ENSP00000227157; ENSG00000134333 [P00338-5]
ENST00000379412; ENSP00000368722; ENSG00000134333 [P00338-1]
ENST00000396222; ENSP00000379524; ENSG00000134333 [P00338-2]
ENST00000422447; ENSP00000395337; ENSG00000134333 [P00338-1]
ENST00000430553; ENSP00000406172; ENSG00000134333 [P00338-4]
ENST00000540430; ENSP00000445175; ENSG00000134333 [P00338-3]
ENST00000542179; ENSP00000445331; ENSG00000134333 [P00338-1]
GeneIDi3939
KEGGihsa:3939
UCSCiuc001mol.4 human [P00338-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Web resourcesi

Wikipedia

Lactate dehydrogenase entry

Protein Spotlight

Another dark horse - Issue 109 of September 2009

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X02152 mRNA Translation: CAA26088.1
X03077
, X03078, X03079, X03080, X03081, X03082, X03083 Genomic DNA Translation: CAA26879.1
AY423727 mRNA Translation: AAS00490.1
AK130587 mRNA Translation: BAC85389.1
AK296667 mRNA Translation: BAG59264.1
AK298834 mRNA Translation: BAH12879.1
CR456775 mRNA Translation: CAG33056.1
CR541714 mRNA Translation: CAG46515.1
AK223078 mRNA Translation: BAD96798.1
AC084117 Genomic DNA No translation available.
CH471064 Genomic DNA Translation: EAW68395.1
CH471064 Genomic DNA Translation: EAW68396.1
BC067223 mRNA Translation: AAH67223.1
S66853 Genomic DNA Translation: AAB20418.1
CCDSiCCDS44549.1 [P00338-4]
CCDS53609.1 [P00338-3]
CCDS53610.1 [P00338-2]
CCDS53611.1 [P00338-5]
CCDS7839.1 [P00338-1]
PIRiA00347 DEHULM
RefSeqiNP_001128711.1, NM_001135239.1 [P00338-4]
NP_001158886.1, NM_001165414.1 [P00338-3]
NP_001158887.1, NM_001165415.1 [P00338-2]
NP_001158888.1, NM_001165416.1 [P00338-5]
NP_005557.1, NM_005566.3 [P00338-1]
UniGeneiHs.2795

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1I10X-ray2.30A/B/C/D/E/F/G/H2-332[»]
4AJPX-ray2.38A/B/C/D2-332[»]
4JNKX-ray1.90A/B/C/D2-332[»]
4L4RX-ray2.10A/H2-332[»]
4L4SX-ray2.90A/H2-332[»]
4M49X-ray2.05A/B/C/D2-332[»]
4OJNX-ray2.40A/B/C/D/E/F/G/H2-332[»]
4OKNX-ray2.10A/B/C/D/E/F/G/H2-332[»]
4QO7X-ray2.14A/B/C/D2-332[»]
4QO8X-ray2.00A/B/C/D2-332[»]
4QSMX-ray3.00A/B/C/D/E/F/G/H2-332[»]
4QT0X-ray3.20A/B/C/D/E/F/G/H2-332[»]
4R68X-ray2.11A/B/C/D2-332[»]
4R69X-ray3.19A/B/C/D2-332[»]
4RLSX-ray1.91A/B/C/D2-332[»]
4ZVVX-ray2.20A/B/C/D1-332[»]
5IXSX-ray2.05A/B/C/D2-332[»]
5IXYX-ray3.00A/B/C/D2-332[»]
5W8HX-ray1.80A/B/C/D1-332[»]
5W8IX-ray1.95A/B/C/D1-332[»]
5W8JX-ray1.55A/B/C/D1-332[»]
5W8KX-ray1.60A/B/C/D1-332[»]
5W8LX-ray1.95A/B/C/D1-332[»]
ProteinModelPortaliP00338
SMRiP00338
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110131, 159 interactors
IntActiP00338, 46 interactors
MINTiP00338
STRINGi9606.ENSP00000445175

Chemistry databases

BindingDBiP00338
ChEMBLiCHEMBL4835
DrugBankiDB02483 Etheno-Nad
DB00157 NADH
DB02701 Nicotinamide
DB03940 Oxamic Acid

PTM databases

iPTMnetiP00338
PhosphoSitePlusiP00338
SwissPalmiP00338

Polymorphism and mutation databases

BioMutaiLDHA
DMDMi126047

2D gel databases

DOSAC-COBS-2DPAGEiP00338
OGPiP00338
REPRODUCTION-2DPAGEiIPI00217966

Proteomic databases

EPDiP00338
PaxDbiP00338
PeptideAtlasiP00338
PRIDEiP00338
ProteomicsDBi51230
51231 [P00338-2]
51232 [P00338-3]
51233 [P00338-4]
51234 [P00338-5]
TopDownProteomicsiP00338-1 [P00338-1]
P00338-4 [P00338-4]
P00338-5 [P00338-5]

Protocols and materials databases

DNASUi3939
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000227157; ENSP00000227157; ENSG00000134333 [P00338-5]
ENST00000379412; ENSP00000368722; ENSG00000134333 [P00338-1]
ENST00000396222; ENSP00000379524; ENSG00000134333 [P00338-2]
ENST00000422447; ENSP00000395337; ENSG00000134333 [P00338-1]
ENST00000430553; ENSP00000406172; ENSG00000134333 [P00338-4]
ENST00000540430; ENSP00000445175; ENSG00000134333 [P00338-3]
ENST00000542179; ENSP00000445331; ENSG00000134333 [P00338-1]
GeneIDi3939
KEGGihsa:3939
UCSCiuc001mol.4 human [P00338-1]

Organism-specific databases

CTDi3939
DisGeNETi3939
EuPathDBiHostDB:ENSG00000134333.13
GeneCardsiLDHA
HGNCiHGNC:6535 LDHA
HPAiCAB015336
CAB069404
MalaCardsiLDHA
MIMi150000 gene
612933 phenotype
neXtProtiNX_P00338
OpenTargetsiENSG00000134333
Orphaneti284426 Glycogen storage disease due to lactate dehydrogenase M-subunit deficiency
PharmGKBiPA30319
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1495 Eukaryota
COG0039 LUCA
GeneTreeiENSGT00550000074541
HOGENOMiHOG000213793
HOVERGENiHBG000462
InParanoidiP00338
KOiK00016
OMAiMDLMQTA
OrthoDBiEOG091G0HME
PhylomeDBiP00338
TreeFamiTF314963

Enzyme and pathway databases

UniPathwayi
UPA00554;UER00611

ReactomeiR-HSA-70268 Pyruvate metabolism
SABIO-RKiP00338
SIGNORiP00338

Miscellaneous databases

ChiTaRSiLDHA human
EvolutionaryTraceiP00338
GeneWikiiLDHA
GenomeRNAii3939
PROiPR:P00338
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000134333 Expressed in 107 organ(s), highest expression level in left coronary artery
CleanExiHS_LDHA
ExpressionAtlasiP00338 baseline and differential
GenevisibleiP00338 HS

Family and domain databases

Gene3Di3.90.110.10, 1 hit
HAMAPiMF_00488 Lactate_dehydrog, 1 hit
InterProiView protein in InterPro
IPR001557 L-lactate/malate_DH
IPR011304 L-lactate_DH
IPR018177 L-lactate_DH_AS
IPR022383 Lactate/malate_DH_C
IPR001236 Lactate/malate_DH_N
IPR015955 Lactate_DH/Glyco_Ohase_4_C
IPR036291 NAD(P)-bd_dom_sf
PfamiView protein in Pfam
PF02866 Ldh_1_C, 1 hit
PF00056 Ldh_1_N, 1 hit
PIRSFiPIRSF000102 Lac_mal_DH, 1 hit
PRINTSiPR00086 LLDHDRGNASE
SUPFAMiSSF51735 SSF51735, 1 hit
SSF56327 SSF56327, 1 hit
TIGRFAMsiTIGR01771 L-LDH-NAD, 1 hit
PROSITEiView protein in PROSITE
PS00064 L_LDH, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiLDHA_HUMAN
AccessioniPrimary (citable) accession number: P00338
Secondary accession number(s): B4DKQ2
, B7Z5E3, D3DQY3, F8W819, Q53G53, Q6IBM7, Q6ZNV1, Q9UDE8, Q9UDE9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 21, 1986
Last sequence update: January 23, 2007
Last modified: November 7, 2018
This is version 226 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  8. Protein Spotlight
    Protein Spotlight articles and cited UniProtKB/Swiss-Prot entries
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again