Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - O95971 (BY55_HUMAN)

Entry version 170 (07 Oct 2020)
Sequence version 1 (01 May 1999)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

CD160 antigen

Gene

CD160

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Receptor on immune cells capable to deliver stimulatory or inhibitory signals that regulate cell activation and differentiation. Exists as a GPI-anchored and as a transmembrane form, each likely initiating distinct signaling pathways via phosphoinositol 3-kinase in activated NK cells and via LCK and CD247/CD3 zeta chain in activated T cells (PubMed:19109136, PubMed:11978774, PubMed:17307798). Receptor for both classical and non-classical MHC class I molecules (PubMed:9973372, PubMed:12486241). In the context of acute viral infection, recognizes HLA-C and triggers NK cell cytotoxic activity, likely playing a role in anti-viral innate immune response (PubMed:12486241). On CD8+ T cells, binds HLA-A2-B2M in complex with a viral peptide and provides a costimulatory signal to activated/memory T cells (PubMed:9973372). Upon persistent antigen stimulation, such as occurs during chronic viral infection, may progressively inhibit TCR signaling in memory CD8+ T cells, contributing to T cell exhaustion (PubMed:25255144). On endothelial cells, recognizes HLA-G and controls angiogenesis in immune privileged sites (PubMed:16809620). Receptor or ligand for TNF superfamily member TNFRSF14, participating in bidirectional cell-cell contact signaling between antigen presenting cells and lymphocytes. Upon ligation of TNFRSF14, provides stimulatory signal to NK cells enhancing IFNG production and anti-tumor immune response (By similarity). On activated CD4+ T cells, interacts with TNFRSF14 and downregulates CD28 costimulatory signaling, restricting memory and alloantigen-specific immune response (PubMed:18193050). In the context of bacterial infection, acts as a ligand for TNFRSF14 on epithelial cells, triggering the production of antimicrobial proteins and proinflammatory cytokines (By similarity).By similarity8 Publications
The soluble GPI-cleaved form, usually released by activated lymphocytes, might play an immune regulatory role by limiting lymphocyte effector functions.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionReceptor
Biological processAdaptive immunity, Angiogenesis, Immunity, Innate immunity

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		O95971

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-198933, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
CD160 antigen
Alternative name(s):
Natural killer cell receptor BY55
CD_antigen: CD1601 Publication
Cleaved into the following chain:
CD160 antigen, soluble form1 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CD1601 PublicationImported
Synonyms:BY551 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000117281.15

Human Gene Nomenclature Database

More...HGNCi		HGNC:17013, CD160

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		604463, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_O95971

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		11126

Open Targets

More...OpenTargetsi		ENSG00000117281

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA134943137

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		O95971, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		CD160

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 24Sequence analysisAdd BLAST24
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001454325 – 159CD160 antigenAdd BLAST135
ChainiPRO_000044604925 – 159CD160 antigen, soluble form3 PublicationsAdd BLAST135
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes a propeptide, which is a part of a protein that is cleaved during maturation or activation. Once cleaved, a propeptide generally has no independent biological function.<p><a href='/help/propep' target='_top'>More...</a></p>PropeptideiPRO_0000014544160 – 181Removed in mature formSequence analysisAdd BLAST22

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi28N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi44 ↔ 112Sequence analysis
Disulfide bondi61 ↔ 68Sequence analysis
Glycosylationi137N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi159GPI-anchor amidated serineBy similarity1

Keywords - PTMi

Disulfide bond, Glycoprotein, GPI-anchor, Lipoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		O95971

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		O95971

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		O95971

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		O95971

PeptideAtlas

More...PeptideAtlasi		O95971

PRoteomics IDEntifications database

More...PRIDEi		O95971

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		51154
64361

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		O95971, 2 sites

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		O95971

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		O95971

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expression is restricted to functional NK and cytotoxic T lymphocytes. Expressed in viral-specific effector memory and terminally differentiated effector memory CD8+ T cells. Expressed in memory and activated CD4+ T cell subsets (at protein level) (PubMed:9743336, PubMed:18193050, PubMed:11978774, PubMed:25255144). Expressed at high levels in intraepithelial lymphocytes (at protein level) (PubMed:9743336). Expressed in both alpha-beta and gamma-delta CD8+ T cell subsets (at protein level) (PubMed:9743336, PubMed:18193050, PubMed:11978774). Expressed in umbilical vein endothelial cells (at protein level) (PubMed:16809620). Expressed in monocytes and at lower levels in B cells (PubMed:23761635). Isoform 3: Expressed exclusively in activated NK cells (at protein level) (PubMed:19109136).7 Publications

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Up-regulated on CD4+ T cells upon stimulation via T cell receptor plus costimulation via CD28 (PubMed:18193050). Up-regulated by IL15 on immunoregulatory NCAM1/CD56-bright NK cells (PubMed:17237375).2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000117281, Expressed in granulocyte and 134 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		O95971, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		O95971, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000117281, Tissue enhanced (blood, brain, intestine, lymphoid tissue)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homomultimer; disulfide-linked (Probable).

Interacts with HLA-G (PubMed:16809620).

Interacts with HLA-A2-B2M in complex with an HIV-derived peptide (PubMed:9973372).

Interacts with TNFRSF14 (via cysteine-rich domain 1); this interaction is direct (PubMed:18193050).

Interacts with LCK and CD247/CD3 zeta chain (PubMed:11978774).

1 Publication4 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		116299, 46 interactors

Protein interaction database and analysis system

More...IntActi		O95971, 9 interactors

Molecular INTeraction database

More...MINTi		O95971

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000235933

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		O95971, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1181
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		O95971

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini25 – 133Ig-like V-type1 PublicationAdd BLAST109

Keywords - Domaini

Immunoglobulin domain, Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502RR8D, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00390000007258

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_103393_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		O95971

KEGG Orthology (KO)

More...KOi		K06542

Identification of Orthologs from Complete Genome Data

More...OMAi		MAPGRGC

Database of Orthologous Groups

More...OrthoDBi		1278184at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		O95971

TreeFam database of animal gene trees

More...TreeFami		TF338321

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.60.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR042385, CD160
IPR036179, Ig-like_dom_sf
IPR013783, Ig-like_fold

The PANTHER Classification System

More...PANTHERi		PTHR15425, PTHR15425, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF48726, SSF48726, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: O95971-1) [UniParc]FASTAAdd to basket
Also known as: CD1601 Publication

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLLEPGRGCC ALAILLAIVD IQSGGCINIT SSASQEGTRL NLICTVWHKK 
        60         70         80         90        100
EEAEGFVVFL CKDRSGDCSP ETSLKQLRLK RDPGIDGVGE ISSQLMFTIS 
       110        120        130        140        150
QVTPLHSGTY QCCARSQKSG IRLQGHFFSI LFTETGNYTV TGLKQRQHLE 
       160        170        180 
FSHNEGTLSS GFLQEKVWVM LVTSLVALQA L
Length:181
Mass (Da):19,810
Last modified:May 1, 1999 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iEF0B981ACC7478BD
GO
Isoform 2 (identifier: O95971-2) [UniParc]FASTAAdd to basket
Also known as: CD160deltaIg1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     25-133: Missing.

Show »
Length:72
Mass (Da):7,801
Checksum:i3F062F1BE6AEFF73
GO
Isoform 3 (identifier: O95971-3) [UniParc]FASTAAdd to basket
Also known as: CD160-TM1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     180-181: AL → GMSKRAVSTPSNEGAIIFLPPWLFSRRRRLERMSRGREKCYSSPGYPQESSNQFH

Note: Mutagenesis of TYR-225 to Phe abolishes intracellular signaling.1 Publication
Show »
Length:234
Mass (Da):25,995
Checksum:iDF7035563A9D47D1
GO
Isoform 4 (identifier: O95971-4) [UniParc]FASTAAdd to basket
Also known as: CD160deltaIg-TM1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     25-181: GCINITSSAS...VTSLVALQAL → ETGNYTVTGL...YPQESSNQFH

Show »
Length:125
Mass (Da):13,986
Checksum:i855049816C819E3E
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_02774791I → V. Corresponds to variant dbSNP:rs2231373Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_06001725 – 181GCINI…ALQAL → ETGNYTVTGLKQRQHLEFSH NEGTLSSGFLQEKVWVMLVT SLVALQGMSKRAVSTPSNEG AIIFLPPWLFSRRRRLERMS RGREKCYSSPGYPQESSNQF H in isoform 4. Add BLAST157
Alternative sequenceiVSP_06001825 – 133Missing in isoform 2. Add BLAST109
Alternative sequenceiVSP_060019180 – 181AL → GMSKRAVSTPSNEGAIIFLP PWLFSRRRRLERMSRGREKC YSSPGYPQESSNQFH in isoform 3. 1 Publication2

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF060981 mRNA Translation: AAC72302.1
EU016100 mRNA Translation: ABV89736.1
EU016101 mRNA Translation: ABV89737.1
AL390725 Genomic DNA Translation: CAI13714.1
AC242845 Genomic DNA No translation available.
BC014465 mRNA Translation: AAH14465.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS72861.1 [O95971-1]

NCBI Reference Sequences

More...RefSeqi		NP_008984.1, NM_007053.3 [O95971-1]
XP_005272986.1, XM_005272929.3 [O95971-3]
XP_011507406.1, XM_011509104.2 [O95971-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000235933; ENSP00000235933; ENSG00000117281 [O95971-1]
ENST00000369288; ENSP00000358294; ENSG00000117281 [O95971-1]
ENST00000401557; ENSP00000385199; ENSG00000117281 [O95971-3]
ENST00000584442; ENSP00000462594; ENSG00000117281 [O95971-2]
ENST00000616463; ENSP00000483935; ENSG00000117281 [O95971-4]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		11126

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:11126

UCSC genome browser

More...UCSCi		uc010oyz.3, human
uc031ute.2, human

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF060981 mRNA Translation: AAC72302.1
EU016100 mRNA Translation: ABV89736.1
EU016101 mRNA Translation: ABV89737.1
AL390725 Genomic DNA Translation: CAI13714.1
AC242845 Genomic DNA No translation available.
BC014465 mRNA Translation: AAH14465.1
CCDSiCCDS72861.1 [O95971-1]
RefSeqiNP_008984.1, NM_007053.3 [O95971-1]
XP_005272986.1, XM_005272929.3 [O95971-3]
XP_011507406.1, XM_011509104.2 [O95971-3]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
6NG3X-ray2.88A27-144[»]
6NG9X-ray1.95A/B27-144[»]
6NGGX-ray1.95A/B27-144[»]
SMRiO95971
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi116299, 46 interactors
IntActiO95971, 9 interactors
MINTiO95971
STRINGi9606.ENSP00000235933

PTM databases

GlyGeniO95971, 2 sites
iPTMnetiO95971
PhosphoSitePlusiO95971

Polymorphism and mutation databases

BioMutaiCD160

Proteomic databases

EPDiO95971
jPOSTiO95971
MassIVEiO95971
PaxDbiO95971
PeptideAtlasiO95971
PRIDEiO95971
ProteomicsDBi51154
64361

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		33967, 583 antibodies

The DNASU plasmid repository

More...DNASUi		11126

Genome annotation databases

EnsembliENST00000235933; ENSP00000235933; ENSG00000117281 [O95971-1]
ENST00000369288; ENSP00000358294; ENSG00000117281 [O95971-1]
ENST00000401557; ENSP00000385199; ENSG00000117281 [O95971-3]
ENST00000584442; ENSP00000462594; ENSG00000117281 [O95971-2]
ENST00000616463; ENSP00000483935; ENSG00000117281 [O95971-4]
GeneIDi11126
KEGGihsa:11126
UCSCiuc010oyz.3, human
uc031ute.2, human

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		11126
DisGeNETi11126
EuPathDBiHostDB:ENSG00000117281.15

GeneCards: human genes, protein and diseases

More...GeneCardsi		CD160
HGNCiHGNC:17013, CD160
HPAiENSG00000117281, Tissue enhanced (blood, brain, intestine, lymphoid tissue)
MIMi604463, gene
neXtProtiNX_O95971
OpenTargetsiENSG00000117281
PharmGKBiPA134943137

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG502RR8D, Eukaryota
GeneTreeiENSGT00390000007258
HOGENOMiCLU_103393_0_0_1
InParanoidiO95971
KOiK06542
OMAiMAPGRGC
OrthoDBi1278184at2759
PhylomeDBiO95971
TreeFamiTF338321

Enzyme and pathway databases

PathwayCommonsiO95971
ReactomeiR-HSA-198933, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		11126, 3 hits in 872 CRISPR screens

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		CD160

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		11126
PharosiO95971, Tbio

Protein Ontology

More...PROi		PR:O95971
RNActiO95971, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000117281, Expressed in granulocyte and 134 other tissues
ExpressionAtlasiO95971, baseline and differential
GenevisibleiO95971, HS

Family and domain databases

Gene3Di2.60.40.10, 1 hit
InterProiView protein in InterPro
IPR042385, CD160
IPR036179, Ig-like_dom_sf
IPR013783, Ig-like_fold
PANTHERiPTHR15425, PTHR15425, 1 hit
SUPFAMiSSF48726, SSF48726, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiBY55_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O95971
Secondary accession number(s): A0A0B4J2A1, B8PRF2, Q5T2V6
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 18, 2001
Last sequence update: May 1, 1999
Last modified: October 7, 2020
This is version 170 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again